Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAR_247791115069969935210.0
PYIR_1517511150103070328980.0
PYIW_1475211150103169628890.0
PYU1_G00596611150103070228850.0
PHALS_1156611150100969928380.0
PHYSO_56034711150101069728300.0
PHYCA_57003411150101170028270.0
PPTG_0925511150100869628160.0
PITG_1374511150100869628140.0
PYVX_1392111150104172028090.0
HYAP_0849711150100769827350.0
PYAP_248831115098067427150.0
PHYKE_64071115093467227100.0
PHYRA_816781115097569626370.0
CCA179911115096567123270.0
H257_127871115096869921760.0
CCI4083111150116365921760.0
SDRG_1409411150100371221720.0
H310_1172911150100269921560.0
SPRG_0328211150100471320910.0
PYU1_G00699412758333657781.9
PHALS_11598136771421104755.5
PYU1_G0061101127998376756.3
PHYCA_1271304290814978707.7
PYAP_1333350334681738.2
PHALS_08408240431890729.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAR_24779

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYAR_24779                                                            1360    0.0  
PYIR_15175                                                            1120    0.0  
PYIW_14752                                                            1117    0.0  
PYU1_G005966                                                          1115    0.0  
PHALS_11566                                                           1097    0.0  
PHYSO_560347                                                          1094    0.0  
PHYCA_570034                                                          1093    0.0  
PPTG_09255                                                            1089    0.0  
PITG_13745                                                            1088    0.0  
PYVX_13921                                                            1086    0.0  
HYAP_08497                                                            1058    0.0  
PYAP_24883                                                            1050    0.0  
PHYKE_6407                                                            1048    0.0  
PHYRA_81678                                                           1020    0.0  
CCA17991                                                              900     0.0  
H257_12787                                                            842     0.0  
CCI40831                                                              842     0.0  
SDRG_14094                                                            841     0.0  
H310_11729                                                            835     0.0  
SPRG_03282                                                            810     0.0  
PYU1_G006994                                                          34.7    1.9  
PHALS_11598                                                           33.5    5.5  
PYU1_G006110                                                          33.5    6.3  
PHYCA_127130                                                          31.6    7.7  
PYAP_13333                                                            32.7    8.2  
PHALS_08408                                                           32.3    9.7  

>PYAR_24779
Length=699

 Score = 1360 bits (3521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/699 (100%), Positives = 699/699 (100%), Gaps = 0/699 (0%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR
Sbjct  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT
Sbjct  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
            AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA
Sbjct  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN
Sbjct  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            HEDQALVKAVGQAAAAGGGGMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE
Sbjct  241  HEDQALVKAVGQAAAAGGGGMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG
Sbjct  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
            GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS
Sbjct  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE
Sbjct  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL
Sbjct  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600
            VDANKLNGAAGGDAGATANGKALAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS
Sbjct  541  VDANKLNGAAGGDAGATANGKALAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600

Query  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660
            VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL
Sbjct  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660

Query  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS  699
            SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS
Sbjct  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS  699

>PYIR_15175
Length=1030

 Score = 1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/703 (79%), Positives = 608/703 (86%), Gaps = 32/703 (5%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKE LKDANG W+KGVDIT MSANRGMICVGDADGF+HLANRQLE RKF+
Sbjct  1    MAQWRRFAFFDKETLKDANGLWLKGVDITTMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHEHFVSH+VMMKRSN+LV+IGDG+DPRS+ELR QS+A+AEAGR++  N++E+MYA+K T
Sbjct  61   AHEHFVSHVVMMKRSNILVSIGDGIDPRSDELRAQSKAVAEAGRSA--NSAEEMYASKQT  118

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GK++A+VR+WRTDQQDRDG PKLLQQ+PVFAKKYPEEAVTAFAV+DDI QFAVGLKNGA
Sbjct  119  -GKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGA  177

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGL FTSKPVT TV+H +LYA+TRRGL+ YHC 
Sbjct  178  VILFRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVYLYASTRRGLTVYHCT  237

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G A       +PPRTVVLDERGVD N SCVNDEGE+AVGQ DAVYFYTTE
Sbjct  238  HDDPALVKSAGAAG------LPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT    +   
Sbjct  292  DRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTK---  348

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
              GP G R+     N RAPGARFGLD+MEEIRHVVCEFGAIFVVSSVG VYRLTEKDTTS
Sbjct  349  --GPVGGRKPPVAPNTRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTS  406

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNL+SIAISLAFSSNYDINSIMDIFRMYGDHLY+KGD+DGSLRQY RTIGHVE
Sbjct  407  KLEILFRKNLFSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVE  466

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  467  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEI  526

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIA-------KPGSGGMNF  593
            +           D   +     L   NG   A  + ++Q+G +         PG+  +NF
Sbjct  527  L-----------DGKKSDLNGDLLIANGNGTAGDKKAKQDGSVGGADGGKKGPGTAALNF  575

Query  594  DIETAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADA  653
            D+ETAISVLWENYP HAL LAKKHEEHSWYLKIQLDRISYVESEDS ALSAHEKERVADA
Sbjct  576  DVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSAALSAHEKERVADA  635

Query  654  LEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            LEYI+HLSFSEAD+NLRKYGRTLVTHLPGPTT+LLK+LCTG F
Sbjct  636  LEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKF  678

>PYIW_14752
Length=1031

 Score = 1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/696 (79%), Positives = 608/696 (87%), Gaps = 16/696 (2%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKE LKDANG W+KGVDIT+MSANRGMICVGDADGF+HLANRQLE RKF+
Sbjct  1    MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHEHFVSH+VMMKRSN+LV+IGDGMD RSEELR QS+A+AEAGR++  N+ E+MYA+K T
Sbjct  61   AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSA--NSVEEMYASKQT  118

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GK++A+VR+WRTDQQDRDG PKLLQQ+PVFAKKYPEEAVTAFAV+DDI QFAVGLKNGA
Sbjct  119  -GKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGA  177

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGL FTSKPVT T +H FLYA+TRRGL+CYHC 
Sbjct  178  VILFRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCT  237

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G +       +PPRTVVLDERGVD N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  238  HDDPALVKSAGTSG------LPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT    +   
Sbjct  292  DRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTK---  348

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
              G +G R+ +   N RAPGARFGLD+MEEIRHVVCEFGAIFVVSSVG VYRLTEKDTTS
Sbjct  349  --GSTGGRKLSVAPNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTS  406

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLY+KGD+DGSLRQY RTIGHVE
Sbjct  407  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVE  466

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  467  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEI  526

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600
            +D  K + +        ++      ++ G +        +G   + G+  +NFDIETAIS
Sbjct  527  IDGKKGDLSGDLLIANGSSSGDRKVSHSGQDG--LSGGADGGKKRAGAAALNFDIETAIS  584

Query  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660
            VLWENYP HAL LAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYI+HL
Sbjct  585  VLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHL  644

Query  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            SFSEAD+NLRKYGRTLVTHLPGPTT+LLK+LCTG F
Sbjct  645  SFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKF  680

>PYU1_G005966
Length=1030

 Score = 1115 bits (2885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/702 (79%), Positives = 609/702 (87%), Gaps = 29/702 (4%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKE LKD NG W+KGVDIT+MSANRGMICVGD DGF+HLANRQLE RKF+
Sbjct  1    MAQWRRFAFFDKETLKDGNGLWLKGVDITSMSANRGMICVGDGDGFIHLANRQLETRKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE+FVSH+VMMKRSN+LV+IGDG+DPRS ELR QS+A+A+AGR++  N++E+M+A+K T
Sbjct  61   AHENFVSHVVMMKRSNILVSIGDGIDPRSAELRAQSKAVADAGRSA--NSAEEMFASKQT  118

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GK++A+VR+WRTDQQDRDG PKLLQQ+PVFAKKYPEEAVTAFAV+DDI Q AVGLKNGA
Sbjct  119  -GKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQLAVGLKNGA  177

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGL FTSKPVT TV+H FLYA+TRRGL+CYHC 
Sbjct  178  VILFRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVFLYASTRRGLTCYHCT  237

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G +       +PPRTVVLDERGVD N SCVNDEGE+AVGQ DAVYFYTTE
Sbjct  238  HDDPALVKSAGASG------LPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT    +   
Sbjct  292  DRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTSK---  348

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
              GP+G R+     N+RAPGARFGLD+MEEIRHVVCEFGAIFVVSSVG VYRLTEKDTTS
Sbjct  349  --GPAGGRKPPIAPNSRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTS  406

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLY+KGD+DGSLRQY RTIGHVE
Sbjct  407  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVE  466

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  467  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEI  526

Query  541  VdanklngaaggdagatangkaLAKTNG----GDNAHPRPSEQEGQIAK--PGSGGMNFD  594
            V          G     + G AL+  NG    GD    R S    + A+  PG+  +NFD
Sbjct  527  V---------DGKKNDLSGGDALSAVNGTGAAGDKLAKRDSSAGAETAQKGPGTAALNFD  577

Query  595  IETAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADAL  654
            +ETAISVLWENYP HAL LAKKHEEHSWYLKIQLDRISYVESEDSVALS HEKERVADAL
Sbjct  578  VETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSTHEKERVADAL  637

Query  655  EYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            EYI+HLSFSEAD+NLRKYGRTLVTHLP PTT+LLK+LCTG F
Sbjct  638  EYIKHLSFSEADSNLRKYGRTLVTHLPEPTTELLKQLCTGKF  679

>PHALS_11566
Length=1009

 Score = 1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/699 (77%), Positives = 594/699 (85%), Gaps = 41/699 (6%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDANG WMKGVDIT+MSANRG+ICVGDADG V+LANR +E RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGSVYLANRSMEARKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE FVSH+VMMKRSNVLVTIGDG+DPRSEELREQS+ IAEAGRA     +EDMY  K T
Sbjct  61   AHEMFVSHVVMMKRSNVLVTIGDGIDPRSEELREQSKVIAEAGRAPN---AEDMYTAKPT  117

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GKS+A+VR WRTDQQDR+G PKL+QQ+P+FAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  118  -GKSTAIVRFWRTDQQDREGKPKLMQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGL+FTSKPVT T++H FLYA+T RGL+CYHC+
Sbjct  177  VILFRSDLKRRADRPPHLLQPAGQYPVTGLAFTSKPVTVTLSHVFLYASTGRGLTCYHCS  236

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G AAA     +PPRT VLDERGV++N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  237  HDDPALVKSAGGAAA-----LPPRTTVLDERGVEMNCSCVNEEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKK++ FFKHYL+VAHVDPRGRHQVNVYDLQNKFIAFNW+LT  + +   
Sbjct  292  DRSVCFGFEGEKKFVCFFKHYLIVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTSSK---  348

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
              GP   R+     NARAPGARFG+D+MEEIRHVVCEFGAIFVVSS+G VYRL+EKDTTS
Sbjct  349  --GP--IRKAPLSLNARAPGARFGIDEMEEIRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  404

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHVE
Sbjct  405  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  464

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDV+KLDKFIQLDE+
Sbjct  465  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVQKLDKFIQLDEV  524

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600
            +                 N   L   NGG                  +  +NFD+ETAIS
Sbjct  525  I--------DAKKTKTDRNSGDLMLRNGG-----------------ATANLNFDVETAIS  559

Query  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660
            VLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HL
Sbjct  560  VLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAALSESEKERVADALEYIEHL  619

Query  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS  699
            SFSEAD+NLRKYGRTLVTH+P PTT+LLKRLCTG F  S
Sbjct  620  SFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPS  658

>PHYSO_560347
Length=1010

 Score = 1094 bits (2830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/697 (79%), Positives = 601/697 (86%), Gaps = 42/697 (6%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDANG WMKGVDIT+MSANRG+ICVGDADGFVHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE FVSH+VMMKRSNVLVTIGDG+DPR EELREQS+AIAEAGR   G  +E+MY +K T
Sbjct  61   AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGR---GPNAEEMYTSKPT  117

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GKS+A+VR WRTDQQDR+G PKLLQQ+PVFAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  118  -GKSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILF+ DLKR+ DRPP LLQPAGQ+PVTGL+FTSKPVTATVAH FLYA+TRRGL+CYHC+
Sbjct  177  VILFKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCS  236

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G AAA     +PPRT VLDERGVD+N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  237  HDDPALVKSAGGAAA-----LPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKKYL+FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT        
Sbjct  292  DRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT--------  343

Query  361  GVGPSGTRRTASVS-NARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTT  419
               P G  R   ++ NAR PGARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTT
Sbjct  344  STNPKGPMRKPPLAPNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTT  403

Query  420  SKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHV  479
            SKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHV
Sbjct  404  SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463

Query  480  EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  539
            EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE
Sbjct  464  EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523

Query  540  LVdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAI  599
            ++DA                     KT GG ++        G  A      +NFD+ETAI
Sbjct  524  VIDAK--------------------KTKGGSDSGDLTPRNGGAAA----ANLNFDVETAI  559

Query  600  SVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQH  659
            SVLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDSVALS  EKERVADALEYI+H
Sbjct  560  SVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEH  619

Query  660  LSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            LSFSEAD+NLRKYGRTLVTH+PGPTT+LLKRLCTG F
Sbjct  620  LSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKF  656

>PHYCA_570034
Length=1011

 Score = 1093 bits (2827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/700 (79%), Positives = 605/700 (86%), Gaps = 47/700 (7%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDANG WMKGVDIT+MSANRG+ICVGDADGFVHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE FVSH+VMMKRSNVLVTIGDG+DPR EELREQS+AIAEAGR  T NA E+MY +K T
Sbjct  61   AHELFVSHVVMMKRSNVLVTIGDGIDPRPEELREQSKAIAEAGR--TPNA-EEMYTSKPT  117

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GKS+A+VR WRTDQQDR+G PKLLQQ+P+FAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  118  -GKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLTQFAVGLKNGA  176

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGLSF SKPVTATV+H FLYA+TRRGL+CYHC+
Sbjct  177  VILFRSDLKRRTDRPPHLLQPAGQYPVTGLSFASKPVTATVSHVFLYASTRRGLTCYHCS  236

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G AAA     +PPRT VLDERGVD+N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  237  HDDPALVKSAGGAAA-----LPPRTTVLDERGVDVNCSCVNEEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEK+YL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT  +  P G
Sbjct  292  DRSVCFGFEGEKRYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT--STNPKG  349

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
             +     R+    SNARAPGARFGLD+MEE+RHVVCEFGAIFVVSS+G +YRL+EKDTTS
Sbjct  350  PM-----RKPPLASNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHIYRLSEKDTTS  404

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHVE
Sbjct  405  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  464

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  465  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  524

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGG----MNFDIE  596
            +D                     AK NG      +     G +  P +GG    +NFD+E
Sbjct  525  ID---------------------AKKNG-----TKSGSDSGDLT-PRNGGAAANLNFDVE  557

Query  597  TAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEY  656
            TAISVLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEY
Sbjct  558  TAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAALSESEKERVADALEY  617

Query  657  IQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            I+HLSFSEAD+NLRKYGRTLVTHLPGPTT+LLKRLCTG F
Sbjct  618  IEHLSFSEADSNLRKYGRTLVTHLPGPTTELLKRLCTGKF  657

>PPTG_09255
Length=1008

 Score = 1089 bits (2816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/696 (78%), Positives = 601/696 (86%), Gaps = 42/696 (6%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDANG WMKGVDIT+MSANRG+ICVGDADGFVHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE FVSH+VMMKRSNVLVTIGDG+DPR +ELREQS+AIAEAGR+     +E+MY +K +
Sbjct  61   AHELFVSHVVMMKRSNVLVTIGDGIDPRPDELREQSKAIAEAGRSPN---AEEMYTSKPS  117

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GKS+A+VR WRTDQQDR+G PKLLQQ+PVFAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  118  -GKSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGLSFTSKPVTATV+H FLYA+TRRGL+CYHC+
Sbjct  177  VILFRSDLKRRADRPPHLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCS  236

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G AAA     +PPRT VLDERGVD+N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  237  HDDPALVKSAGGAAA-----LPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT  +  P G
Sbjct  292  DRSVCFGFEGEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT--STNPKG  349

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
             +     R+    SNARAPGARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTTS
Sbjct  350  PM-----RKPPLASNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  404

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHVE
Sbjct  405  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  464

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  465  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  524

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600
            +D                     AK    D+     + + G      +  +NFD+ETAIS
Sbjct  525  ID---------------------AKKTKSDSDSGDLTPRNG-----AAANLNFDVETAIS  558

Query  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660
            VLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HL
Sbjct  559  VLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAALSESEKERVADALEYIEHL  618

Query  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            SFSEAD+NLRKYGRTLVTH+P PTT+LLKRLCTG F
Sbjct  619  SFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKF  654

>PITG_13745
Length=1008

 Score = 1088 bits (2814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/696 (78%), Positives = 601/696 (86%), Gaps = 42/696 (6%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDANG WMKGVD+T+MSANRG+ICVGDADGFVHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE FVSH+VMMKRSNVLVTIGDG+DPR EELREQS+AIAEAGRA     +E+MY +K  
Sbjct  61   AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPN---AEEMYTSKP-  116

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
            AGKS+A+VR WRTDQQDR+G PKLLQQ+P+FAKKYPEEAVTAFA +DD+ QFAVGLKNGA
Sbjct  117  AGKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGA  176

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPP LLQPAGQ+PVTGLSFTSKPVTATV+H FLYA+TRRGL+CYHC+
Sbjct  177  VILFRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCS  236

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G AAA     +PPRT VLDERGVD+N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  237  HDDPALVKSAGGAAA-----LPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKK+L+FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT  +  P G
Sbjct  292  DRSVCFGFEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT--STNPKG  349

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
             +     R+    SNAR+PGARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTTS
Sbjct  350  PM-----RKPPLASNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  404

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHVE
Sbjct  405  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  464

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  465  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  524

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600
            +D                     AK    D+     + + G +A      +NFD+ETAIS
Sbjct  525  ID---------------------AKKTKTDSDSGELTPRNGAVA-----NLNFDVETAIS  558

Query  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660
            VLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HL
Sbjct  559  VLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAALSESEKERVADALEYIEHL  618

Query  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            SFSEAD+NLRKYGRTLVTH+P PTT+LLKRLCTG F
Sbjct  619  SFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKF  654

>PYVX_13921
Length=1041

 Score = 1086 bits (2809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/720 (77%), Positives = 602/720 (84%), Gaps = 58/720 (8%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMK-----------------GVDITAMSANRGMICVGDA  43
            MAQWRRFAFFDKEVLKDANG WMK                 GVDIT+MSANRGMICVGDA
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKSLDANFFRRLVVPDAIQGVDITSMSANRGMICVGDA  60

Query  44   DGFVHLANRQLEMRKFRAHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAG  103
            DGFVHLANRQLE RKF+AHE+FVSH+VMMKRSNVLVT+GDG+DPRSEEL+ QS+AIAEAG
Sbjct  61   DGFVHLANRQLEARKFQAHENFVSHVVMMKRSNVLVTVGDGIDPRSEELKAQSKAIAEAG  120

Query  104  RASTGNASEDMYATKTTAGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAF  163
            R  +GNA E+M+  K + GKS+A+VR WRTDQQDRDG PKLLQQ+P+FAKKYPEEAVTAF
Sbjct  121  R--SGNA-EEMFTPKQS-GKSTAVVRFWRTDQQDRDGKPKLLQQVPIFAKKYPEEAVTAF  176

Query  164  AVSDDIGQFAVGLKNGAVILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAH  223
            AV DD+ QFAVGLKNGAVILFR DLKR+ DRPPHLLQPAGQ+PVTGL+FTSKP+TATV+H
Sbjct  177  AVHDDVSQFAVGLKNGAVILFRSDLKRRSDRPPHLLQPAGQYPVTGLAFTSKPITATVSH  236

Query  224  SFLYAATRRGLSCYHCNHEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDE  283
             FLYA+TRRGL+CYHC H+D A+ KA G A       MPPRTVVLDERGVD++ SCVNDE
Sbjct  237  VFLYASTRRGLTCYHCTHDDPAVTKAAGAAG------MPPRTVVLDERGVDMSCSCVNDE  290

Query  284  GELAVGQVDAVYFYTTEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNK  343
            GELAVGQ DAVYFYTTEDRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNK
Sbjct  291  GELAVGQTDAVYFYTTEDRSVCFGFEGEKKYLSFFKHYLLVAHVDPRGRHQVNVYDLQNK  350

Query  344  FIAFNWSLTQMARRPGGGVGPSGTRRTASVSNARAP-------GARFGLDDMEEIRHVVC  396
            FIAFNW+LT       GG      RR     NAR         GARFGLD+MEEIRHVVC
Sbjct  351  FIAFNWTLTSTNSNAKGGA-----RRPPLAPNARXXXXXXXXXGARFGLDEMEEIRHVVC  405

Query  397  EFGAIFVVSSVGCVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG  456
            EFGAIFVVSSVG VYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG
Sbjct  406  EFGAIFVVSSVGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG  465

Query  457  DHLYEKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  516
            DHLY+KGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT
Sbjct  466  DHLYQKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  525

Query  517  LLLNCYTKLKDVKKLDKFIQLDELVdanklngaaggdagatangkaLAKTNGGDNAHPRP  576
            LLLNCYTKLKDVKKLDKFIQLDE++            +   A+  ++AK        PR 
Sbjct  526  LLLNCYTKLKDVKKLDKFIQLDEVI----------DSSKKAADRNSIAKL-------PRS  568

Query  577  SEQEGQIAKPGSGGMNFDIETAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVES  636
            S++ G   K      NFD+ETAISVLWENYP HAL LAKK+EEHSWYLKIQLDRISYVES
Sbjct  569  SDETGLDGK--RDNPNFDVETAISVLWENYPKHALTLAKKYEEHSWYLKIQLDRISYVES  626

Query  637  EDSVALSAHEKERVADALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            EDSVALS HEKERV DALEYI+HLSFSEAD+NLRKYGRTLVTHLPGPTT+LLK+LCTG F
Sbjct  627  EDSVALSDHEKERVTDALEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKF  686

>HYAP_08497
Length=1007

 Score = 1058 bits (2735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/698 (77%), Positives = 591/698 (85%), Gaps = 47/698 (7%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDANG WMKGVDIT+MSANRG+ICVGDADG+VHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE FVSH+VMMKRSNVL TIGDG+DPR +ELREQS+AIAEAGRA   NA E        
Sbjct  61   AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAP--NAEE-------P  111

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GKS+A+VR WRTD QDR+G PKLLQQ+P+FAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  112  TGKSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  171

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRP HLLQPAGQ+PVTGLSF SKPVTAT  H FLYA+TRRGL+CYHC+
Sbjct  172  VILFRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCS  231

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+VG AAA     +PPRT VLDERGVD+N SCVN+E E+AVGQ DAVYFYTTE
Sbjct  232  HDDPALVKSVGGAAA-----LPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTE  286

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCF FEGEKKYL FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNW+LT  +  P G
Sbjct  287  DRSVCFAFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLT--STNPKG  344

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
             +     R+    SN+R   ARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTTS
Sbjct  345  PM-----RKPPLASNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  399

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHVE
Sbjct  400  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  459

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  460  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  519

Query  541  VdanklngaaggdagatangkaLAKTNGG--DNAHPRPSEQEGQIAKPGSGGMNFDIETA  598
            +DA                     KTNG   DN     + ++G     G+  +NFD+ETA
Sbjct  520  IDAK--------------------KTNGTKIDNDASDLALKDGG----GAANLNFDVETA  555

Query  599  ISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQ  658
            ISVLWENYP HAL LA+KHEEHSWYLKIQL +ISYV+SEDS ALS  EKERVADALEYIQ
Sbjct  556  ISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVDSEDSAALSESEKERVADALEYIQ  615

Query  659  HLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            HLSFSEAD+NLRKYGRTLVTH+PGP T+LLKRLCTG +
Sbjct  616  HLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKY  653

>PYAP_24883
Length=980

 Score = 1050 bits (2715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/674 (80%), Positives = 562/674 (83%), Gaps = 53/674 (8%)

Query  31   MSANRGMICVGDADGFVHLANRQLEMRKFRAHEHFVSHIVMMKRSNVLVTIGDGMDPRSE  90
            MSANRGM+CVGDADGFVHLANRQLE RKFRAHEHFVSHIVMMKRSNVLVTIGDG+DPRS+
Sbjct  1    MSANRGMLCVGDADGFVHLANRQLEARKFRAHEHFVSHIVMMKRSNVLVTIGDGIDPRSD  60

Query  91   ELREQSRAIAEAGRASTGNAS-----EDMYATKTTAGKSSAMVRIWRTDQQDRDGSPKLL  145
            ELREQSRAIAEAGRA+    +     +DM+     +GKS+A+VRIWRTDQQDRDG PKLL
Sbjct  61   ELREQSRAIAEAGRAAGAAGAGAATADDMFTRSADSGKSTAVVRIWRTDQQDRDGRPKLL  120

Query  146  QQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGAVILFRIDLKRKVDRPPHLLQPAGQF  205
            QQ+PVFAKKYPEEAVTAFAVSDDIGQFAVGL+NGAVILFRIDLKR+ +RPP LLQPAGQF
Sbjct  121  QQVPVFAKKYPEEAVTAFAVSDDIGQFAVGLRNGAVILFRIDLKRRAERPPQLLQPAGQF  180

Query  206  PVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCNHEDQALVKavgqaaaaggggMPPRT  265
            PVTGLSFTSKP++ TVAH FLYA+TRRGL+CYHCNH+D ALVKA G A       +P RT
Sbjct  181  PVTGLSFTSKPISNTVAHVFLYASTRRGLTCYHCNHDDPALVKAAGAAG------LPSRT  234

Query  266  VVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTEDRSVCFGFEGEKKYLQFFKHYLLVA  325
            VVLDERGVD + SCVNDEGE+AVGQVDAVYFY  EDRSVCFGFEGEKKYLQFFKHYLLVA
Sbjct  235  VVLDERGVDHHCSCVNDEGEIAVGQVDAVYFYNNEDRSVCFGFEGEKKYLQFFKHYLLVA  294

Query  326  HVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGGGVGPSGTRRTASVSNARAPGARFGL  385
            HVDPRGRHQVNVYDLQNKFIAFNWSLTQ A R GG       RR    +N RAPGARFGL
Sbjct  295  HVDPRGRHQVNVYDLQNKFIAFNWSLTQTASRNGG------MRRPPLPTNNRAPGARFGL  348

Query  386  DDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDI  445
            DDMEEIRHVVC            CVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDI
Sbjct  349  DDMEEIRHVVC------------CVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDI  396

Query  446  NSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALH  505
            NSIMDIFRMYGDHLYEKGDFDGSLRQY RTIGHVEPSYVIRRFLDAQRIHNLTAYLEALH
Sbjct  397  NSIMDIFRMYGDHLYEKGDFDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALH  456

Query  506  EKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDELVdanklngaaggdagatangkaLAK  565
            EKAFANAEHTTLLLNCYTKLKDVKKLD FIQLDE             D          A 
Sbjct  457  EKAFANAEHTTLLLNCYTKLKDVKKLDNFIQLDE-----------NTDKLNGETKGIAAV  505

Query  566  TNGG---DNAHPRPSEQEGQIAKPGSGGMNFDIETAISVLWENYPTHALILAKKHEEHSW  622
             NGG   D AH             G  GMNFDIETAISVLWENYP HALILAKKHEEHSW
Sbjct  506  ANGGTSNDKAH----------ENGGKTGMNFDIETAISVLWENYPQHALILAKKHEEHSW  555

Query  623  YLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHLSFSEADANLRKYGRTLVTHLPG  682
            YLKIQLDRISYVESEDSV LSA E+ERVADALEYIQHLSFSEADANLRKYGRTLVTHLPG
Sbjct  556  YLKIQLDRISYVESEDSVGLSASEQERVADALEYIQHLSFSEADANLRKYGRTLVTHLPG  615

Query  683  PTTDLLKRLCTGTF  696
            PTTDLLKRLCTG F
Sbjct  616  PTTDLLKRLCTGKF  629

>PHYKE_6407
Length=934

 Score = 1048 bits (2710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/672 (78%), Positives = 581/672 (86%), Gaps = 43/672 (6%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDANG WMKGVDIT+MSANRG+ICVGDADGFVHL+NR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLSNRSLEARKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE FVSH+VMM+RSNVLVTIGDG+DPRSEELR QS+AIAEAGRA     +EDMY +K +
Sbjct  61   AHELFVSHVVMMQRSNVLVTIGDGIDPRSEELRAQSKAIAEAGRAPN---AEDMYTSKPS  117

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GKS+A+VR WRTDQQDR+G PKLLQQ+P+FAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  118  -GKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGLSFTSKPVTA+V+H FLYA+TRRGL+CYHC+
Sbjct  177  VILFRSDLKRRTDRPPHLLQPAGQYPVTGLSFTSKPVTASVSHVFLYASTRRGLTCYHCS  236

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G AAA     +PPRT VLDERGVD+N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  237  HDDPALVKSAGGAAA-----LPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTE  291

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT  + +   
Sbjct  292  DRSVCFGFEGEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTSSK---  348

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
                +G R+    +NARAPGARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTTS
Sbjct  349  ----AGMRKPPLAANARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  404

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHVE
Sbjct  405  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  464

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  465  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  524

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGG--MNFDIETA  598
            +DA                     KTNG      +     G     G+G   +NFD+ETA
Sbjct  525  IDAK--------------------KTNG-----TKSGSDSGMTTPRGAGASNLNFDVETA  559

Query  599  ISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQ  658
            ISVLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDSVALS +EKERVADALEYI+
Sbjct  560  ISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSENEKERVADALEYIE  619

Query  659  HLSFSEADANLR  670
            HLSFSEAD+NLR
Sbjct  620  HLSFSEADSNLR  631

>PHYRA_81678
Length=975

 Score = 1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/696 (75%), Positives = 570/696 (82%), Gaps = 75/696 (11%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFFDKEVLKDA+G WMKGVDIT+MSANRG+ICVGDADGFVHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDASGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHE FVSH+VMM                                          Y +K T
Sbjct  61   AHELFVSHVVMM------------------------------------------YTSKPT  78

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             GK++A+VR WRTDQQDR+G PKLLQQ+PVFAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  79   -GKTTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  137

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGL FTSKPVTATVAH FLYA+TRRGL+CYHC+
Sbjct  138  VILFRSDLKRRTDRPPHLLQPAGQYPVTGLEFTSKPVTATVAHVFLYASTRRGLTCYHCS  197

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
            H+D ALVK+ G AAA     +PPRT VLDERGVD+N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  198  HDDPALVKSAGGAAA-----LPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTE  252

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGFEGEKKYL+FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT  +  P G
Sbjct  253  DRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT--STNPKG  310

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
             +     R+    SNARAPGARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTTS
Sbjct  311  PM-----RKPPLASNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  365

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGDFDGSLRQYVRTIGHVE
Sbjct  366  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDFDGSLRQYVRTIGHVE  425

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  426  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  485

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600
            +DA K N                   +G D+    P    G  A      +NFD+ETAIS
Sbjct  486  IDARKAN----------------GTKSGSDSGDTTPRNGGGGAA----ANLNFDVETAIS  525

Query  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660
            VLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDSVALS +EKERVADALEYI+HL
Sbjct  526  VLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSENEKERVADALEYIEHL  585

Query  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
            SFSEAD+NLRKYGRTLVTH+PGPTT+LLKRLCTG F
Sbjct  586  SFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKF  621

>CCA17991
Length=965

 Score = 900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/671 (66%), Positives = 521/671 (78%), Gaps = 66/671 (10%)

Query  31   MSANRGMICVGDADGFVHLANRQLEMRKFRAHEHFVSHIVMMKRSNVLVTIGDGMDPRSE  90
            MSANRG+IC GDA+G++HL+N QLE+RKF+AH HFVS IVMMKRSN+LV++GDG+DPR  
Sbjct  1    MSANRGLICAGDAEGYIHLSNSQLEVRKFQAHNHFVSQIVMMKRSNILVSVGDGIDPRPS  60

Query  91   ELREQSRAIAEAGRASTGNASEDMYATKTTAGKSSAMVRIWRTDQQDRDGSPKLLQQMPV  150
             +  +   +      + G++            +S+AM+RIWRTDQQDR+G PK+LQQ+ V
Sbjct  61   MIHAEKADVDINSSKAAGDS------------ESTAMIRIWRTDQQDREGKPKMLQQIQV  108

Query  151  FAKKYPEEAVTAFAVSDDIGQFAVGLKNGAVILFRIDLKRKVDR-PPHLLQPAGQFPVTG  209
            FAK++PEEAVTAFAVSDD+ Q++VGLKNGAVIL+R D + +V+R  P LLQPAGQ PVTG
Sbjct  109  FAKRFPEEAVTAFAVSDDVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTG  168

Query  210  LSFTSKPVTATVAHSFLYAATRRGLSCYHCNHEDQALVKavgqaaaaggggMPPRTVVLD  269
            L+FT+KP+T ++ H FLYA+TRRGL+CYHCN +DQ +VKAVG +       MPPR V LD
Sbjct  169  LAFTTKPITNSLNHVFLYASTRRGLTCYHCNQDDQYIVKAVGASR------MPPRCVTLD  222

Query  270  ERGVDLNASCVNDEGELAVGQVDAVYFYTTEDRSVCFGFEGEKKYLQFFKHYLLVAHVDP  329
            ERGVD + SCVND+GE+AVGQ DAVYFYTT+D+SVCF F+GEKKYL FFK YL+VAHVD 
Sbjct  223  ERGVDFHCSCVNDDGEIAVGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDS  282

Query  330  RGRHQVNVYDLQNKFIAFNWSLTQMARRPGGGVGPSGTRRTASVSNARAPG--ARFGLDD  387
            RGRHQVNVYDLQNKFIAFNW+LT           P+ ++ TA+      P   +RFGLD 
Sbjct  283  RGRHQVNVYDLQNKFIAFNWTLTHSVPSESS---PNVSKATAARGKQSQPNPSSRFGLDR  339

Query  388  MEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINS  447
            ME+I+H+V EFG+IFVVSS G VYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINS
Sbjct  340  MEQIQHIVSEFGSIFVVSSAGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINS  399

Query  448  IMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEK  507
            I+DIFRMYGDHLY+KGD+DGSLRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEK
Sbjct  400  IVDIFRMYGDHLYQKGDYDGSLRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEK  459

Query  508  AFANAEHTTLLLNCYTKLKDVKKLDKFIQLDELVdanklngaaggdagatangkaLAKTN  567
            AFANAEHTTLLLNC+TKLKDVKKLD FIQL                              
Sbjct  460  AFANAEHTTLLLNCFTKLKDVKKLDAFIQL------------------------------  489

Query  568  GGDNAHPRPSEQEGQIAKP-GSGGMNFDIETAISVLWENYPTHALILAKKHEEHSWYLKI  626
                       ++G  AK  G   +NFD+ETAISVLWE YP HAL LA+KHEEHSWYLKI
Sbjct  490  -----------EDGNAAKAGGQTSLNFDVETAISVLWEMYPQHALTLARKHEEHSWYLKI  538

Query  627  QLDRISYVESEDSVALSAHEKERVADALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTD  686
            QLD+ISYV+S+ S  LS+ EKERV DALEYI+HLSF+EADANLRKYGRTLVTHLPGPTT+
Sbjct  539  QLDQISYVDSDGSTTLSSAEKERVIDALEYIKHLSFAEADANLRKYGRTLVTHLPGPTTE  598

Query  687  LLKRLCTGTFA  697
            LLKRLCTG F 
Sbjct  599  LLKRLCTGKFV  609

>H257_12787
Length=968

 Score = 842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/699 (61%), Positives = 508/699 (73%), Gaps = 89/699 (13%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFF+KE+LKD NG W++G+D+T+MS NRG++ +GDA G +H+ANRQLE R FR
Sbjct  1    MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHMANRQLETRAFR  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AH+HFVSH++MMK++N+LV+IGDG DPR  EL + S+AIA+A R +     E ++    +
Sbjct  61   AHDHFVSHVIMMKKANLLVSIGDGKDPRDPELIKASKAIADASR-TQAQQDEQLFTASDS  119

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             G S+A+V+IWRTDQQDRDG PKLLQQ+ +FAK +PEEAVTAF+VSDD+ Q AVGL NGA
Sbjct  120  QG-STALVKIWRTDQQDRDGKPKLLQQIKIFAK-FPEEAVTAFSVSDDLAQIAVGLLNGA  177

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            +ILFR D KR+ D+PP LLQPA Q+PVT L F +K    T     LYAAT+RGL+CYHC+
Sbjct  178  IILFRSDAKRRSDKPPLLLQPATQYPVTSLHFATKLNVPT-----LYAATKRGLTCYHCD  232

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
               ++              G  PR+VVLDERGV L+   V+++G++AVGQ DAVYFYT E
Sbjct  233  DSSRS--------------GGMPRSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPE  278

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            DRSVCFGF+G+KKYL FFK YLLVAHVDPRGRHQVN+YDLQNKFIAFNW+LT  A+    
Sbjct  279  DRSVCFGFDGDKKYLGFFKQYLLVAHVDPRGRHQVNLYDLQNKFIAFNWTLTNTAK----  334

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
                               G RFG D  EEIRHVV EFGA+FV SS+G VYRL E DTTS
Sbjct  335  --------------GGGGGGGRFGDDAAEEIRHVVSEFGAVFVQSSLGYVYRLLEVDTTS  380

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KL+ILFRK+LYSIAISLAFSSNYD+ SIMDIFR YGDHLY+KGDFDGSLRQY RTIG+VE
Sbjct  381  KLDILFRKHLYSIAISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVE  440

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIR+FLDAQRIHNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+ +D+ 
Sbjct  441  PSYVIRQFLDAQRIHNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDD-  499

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600
                                             P+  +Q           + FD+ETA++
Sbjct  500  --------------------------------DPKEKKQP----------LTFDVETALT  517

Query  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660
            VL +NYPTHAL LAKKH EHSWYLKIQLDRI       S  LS  ++ RV DAL YI+ L
Sbjct  518  VLRDNYPTHALTLAKKHHEHSWYLKIQLDRIH------SETLSESDQARVLDALTYIEGL  571

Query  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS  699
            SF EA+ NLRKYGRTLVTH+PGPTT+LLK LCTG F  S
Sbjct  572  SFGEANLNLRKYGRTLVTHVPGPTTELLKALCTGRFHDS  610

>CCI40831
Length=1163

 Score = 842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/659 (65%), Positives = 495/659 (75%), Gaps = 73/659 (11%)

Query  40   VGDADGFVHLANRQLEMRKFRAHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELR-EQSRA  98
            +GDAD     ++ Q     FRAH H V     MKRSN+LV++GDG+DPR+  +  E+S  
Sbjct  219  MGDADDLHIQSDLQ-----FRAHGHRV-----MKRSNILVSVGDGIDPRTSMIHAEKSDV  268

Query  99   IAEAGRASTGNASEDMYATKTTAGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEE  158
               + +  TG++            +S+AM+RIWRTDQQDR+G PK+LQQ+ VFAK++PEE
Sbjct  269  DTTSRKGDTGDS------------ESTAMIRIWRTDQQDREGKPKMLQQIQVFAKRFPEE  316

Query  159  AVTAFAVSDDIGQFAVGLKNGAVILFRIDLKRKVDR-PPHLLQPAGQFPVTGLSFTSKPV  217
            AVTAFAVSD++ Q++VGLKNGAVIL+R D + +V+R  P LLQPAGQ PVTGL+FT+KP+
Sbjct  317  AVTAFAVSDEVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGLAFTTKPI  376

Query  218  TATVAHSFLYAATRRGLSCYHCNHEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNA  277
              ++ H FLYA+TRRGL+CYHCN +DQ +VKAVG         MPPR V LDERGVD   
Sbjct  377  NNSLNHVFLYASTRRGLTCYHCNQDDQYIVKAVGTTG------MPPRCVTLDERGVDFCC  430

Query  278  SCVNDEGELAVGQVDAVYFYTTEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNV  337
            SCVNDEGE+AVGQ DAVYFYTT+D+SVCF F+GEKKYL FFK YL+VAHVD RGRHQVNV
Sbjct  431  SCVNDEGEIAVGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVNV  490

Query  338  YDLQNKFIAFNWSLTQMARRPGGGVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCE  397
            YDLQNKFIAFNW+LT            S T       +   PGARFGLD ME+I+H+V E
Sbjct  491  YDLQNKFIAFNWTLTHSVPSESSA-NVSKTMVARGKQSQPNPGARFGLDKMEQIQHIVSE  549

Query  398  FGAIFVVSSVGCVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGD  457
            FG+IFVVSS G VYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSI+DIFRMYGD
Sbjct  550  FGSIFVVSSAGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGD  609

Query  458  HLYEKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTL  517
            HLY+KGD+DGSLRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTL
Sbjct  610  HLYQKGDYDGSLRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTL  669

Query  518  LLNCYTKLKDVKKLDKFIQLDELVdanklngaaggdagatangkaLAKTNGGDNAHPRPS  577
            LLNC+TKLKDVKKLD FIQL                                        
Sbjct  670  LLNCFTKLKDVKKLDAFIQL----------------------------------------  689

Query  578  EQEGQIAKPGSGGMNFDIETAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESE  637
             ++G +A  G   +NFD+ETAISVLWE YP HAL LA+KHEEHSWYLKIQLD+ISYVES+
Sbjct  690  -EDGNVAG-GHTSLNFDVETAISVLWEMYPQHALTLARKHEEHSWYLKIQLDQISYVESD  747

Query  638  DSVALSAHEKERVADALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696
             S  LS  EKERV DAL+YI+HLSF+EADANLRKYGRTLVTHLPGPTT+LLKRLCTG F
Sbjct  748  GSTTLSGAEKERVIDALKYIEHLSFAEADANLRKYGRTLVTHLPGPTTELLKRLCTGKF  806

>SDRG_14094
Length=1003

 Score = 841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/712 (60%), Positives = 507/712 (71%), Gaps = 86/712 (12%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRF FFD+++LKD NG+W++GVD+T MS NRG++ VGDA G +H+ANRQLE R FR
Sbjct  1    MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AH+HFVSH+VMMK++NVLV+IGDG DPR  +L + S+A+AEA R       + MY +  +
Sbjct  61   AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYTSTGS  120

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
               S+A+V++WRTDQQDR+G PKL+ Q+ +FAK +PEEAVTAFAVS+D  Q AVGL NGA
Sbjct  121  VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  181  VILFRIDLKRKVDR-----PPHLLQPAGQFPVTGLSFTSKPV-------TATVAHSFLYA  228
            +ILFR ++KR+        PP LLQ A   PVT LSF  KP        T+T    +LYA
Sbjct  180  IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  229  ATRRGLSCYHCNHEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAV  288
            AT+RGL+CYHC+                    + PR+VVLDERGV L+  CVND+G++ +
Sbjct  240  ATKRGLTCYHCD-------------DVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCM  286

Query  289  GQVDAVYFYTTEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFN  348
            GQ DAVYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFN
Sbjct  287  GQTDAVYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFN  346

Query  349  WSLTQMARRPGGGVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVG  408
            W LT  A+   G          AS  N  A   RFG +++EEIRHVV EFGA+FVV+S G
Sbjct  347  WILTNTAKALPG----------ASSRNVVA--TRFGYEEVEEIRHVVSEFGAVFVVTSFG  394

Query  409  CVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGS  468
             VYRL+EKDT SKL ILF KNLY IAISLAFSSNYD++SIMDIFRMYGD LY KGD+DGS
Sbjct  395  SVYRLSEKDTASKLSILFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGS  454

Query  469  LRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDV  528
            LRQY RTIGHVEPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDV
Sbjct  455  LRQYARTIGHVEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDV  514

Query  529  KKLDKFIQLDELVdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGS  588
            KKLD F+ +D+                                        +G  AK G+
Sbjct  515  KKLDAFLLIDD----------------------------------------DGSNAKEGT  534

Query  589  -GGMNFDIETAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEK  647
               + FD+ETA++VL ENYP HAL LA+KH EHSWYLKIQLDRIS         LS  E 
Sbjct  535  PQALTFDVETALTVLRENYPQHALALARKHAEHSWYLKIQLDRISDT-------LSDAEH  587

Query  648  ERVADALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS  699
             RVADAL+YI+ LSF+EAD NLRKYGRTLVTHLPGPTT+LL++LCTG F+A+
Sbjct  588  ARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSAT  639

>H310_11729
Length=1002

 Score = 835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/699 (61%), Positives = 507/699 (73%), Gaps = 72/699 (10%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRFAFF+KE+LKD NG W++G+D+T+MS NRG++ +GDA G +HLANRQLE R FR
Sbjct  1    MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHLANRQLETRAFR  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AHEHFVSH++MMK++N+LV+IGDG DPR  +L + S+A+AEA R +     E ++ +  +
Sbjct  61   AHEHFVSHVIMMKKANLLVSIGDGKDPRDPDLIKASKAVAEASR-TQAQQDEQLFTSSDS  119

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
             G S+A+V+IWRTDQQDRDG PKLLQQ+ +F+K + EEAVTAFAVSDD+ Q A+GL NGA
Sbjct  120  RG-STALVKIWRTDQQDRDGKPKLLQQIKIFSK-FAEEAVTAFAVSDDLSQIAIGLLNGA  177

Query  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240
            +ILFR D KR+ D+PP LLQPA Q+PVT L F +K    T     LYAAT+RGL+CYHC 
Sbjct  178  IILFRSDAKRRSDKPPLLLQPATQYPVTSLHFATKVNILT-----LYAATKRGLTCYHC-  231

Query  241  HEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300
              D A  K+             PR+VVLDERGV L+   V+++G++AVGQ DAVYFYT E
Sbjct  232  --DDASSKSNASNNGM------PRSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPE  283

Query  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360
            +RSVCFGFEG+KKYL FFK YLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT  A+   G
Sbjct  284  ERSVCFGFEGDKKYLGFFKQYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTAKIGAG  343

Query  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420
            G G  G                      EEIRHVV EFGA+FV+SS+G VYRL E DTTS
Sbjct  344  GGGRFGDDAA------------------EEIRHVVSEFGAVFVLSSLGYVYRLMEIDTTS  385

Query  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480
            KL+ILFRK+LYSIAISLAFSSNYD+ SIMDIFR YGDHLY+KGDFDGSLRQY RTIG+VE
Sbjct  386  KLDILFRKHLYSIAISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVE  445

Query  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540
            PSYVIR+FLDAQRIHNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+ +D+ 
Sbjct  446  PSYVIRQFLDAQRIHNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDD-  504

Query  541  VdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600
                                   A T       P+               + FD+ETA++
Sbjct  505  -----------------EQTTDDAPTTADTRKQPKQQ-------------LTFDVETALT  534

Query  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660
            VL + YPTHAL LAKKH EHSWYLKIQLDRI       S  LS  +  RV DAL YI+ L
Sbjct  535  VLRDYYPTHALALAKKHHEHSWYLKIQLDRIH------SETLSDADHARVQDALTYIEGL  588

Query  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS  699
            SF+EA+ NLRKYGRTLVTH+PGPTT+LLK LCTG F  S
Sbjct  589  SFTEANLNLRKYGRTLVTHVPGPTTELLKALCTGRFHDS  627

>SPRG_03282
Length=1004

 Score = 810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/713 (58%), Positives = 500/713 (70%), Gaps = 87/713 (12%)

Query  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60
            MAQWRRF FFD+++LKD NG+W++GVD+T MS NRG++ VGDA G +H+ANRQLE R FR
Sbjct  1    MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120
            AH+HFVSH+VMMK++NVLV+IGDG DPR  +L + S+A+AEA R       + MYA+  +
Sbjct  61   AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120

Query  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180
               S+A+V++WRTDQQDR+G PKL+ Q+ +FA K+PEEAVTAFAVS+D  Q AVGL NGA
Sbjct  121  VQNSTALVKMWRTDQQDREGKPKLILQLKIFA-KFPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  181  VILFRIDLKRKVD-----RPPHLLQPAGQFPVTGLSFTSKP-------VTATVAHSFLYA  228
            +ILFR ++KR+        PP LLQ A   PVT LSF  KP        T+T    +LYA
Sbjct  180  IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  229  ATRRGLSCYHCNHEDQALVKavgqaaaaggggMPPRTVVLDERGVDLNASCVNDEGELAV  288
            AT+RGL+CYHC+                    + PR+VVLDERGV L+  CVND+G++ +
Sbjct  240  ATKRGLTCYHCD-------------DVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCM  286

Query  289  GQVDAVYFYTTEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFN  348
            GQ DAVYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFN
Sbjct  287  GQTDAVYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFN  346

Query  349  WSLTQMARRPGGGVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVG  408
            W LT  A+   G          AS  N  A   RFG +++EEIRHVV EFGA+FVV+S G
Sbjct  347  WILTNTAKALPG----------ASSRNVVA--TRFGYEEVEEIRHVVSEFGAVFVVTSFG  394

Query  409  CVYRLTEKDT-TSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDG  467
             V    E++    + +  F KNLY IAISLAFSSNYD++SIMDIFRMYGD LY KGD+DG
Sbjct  395  SVCLPFEREGHRVQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDG  454

Query  468  SLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKD  527
            SLRQY RTIGHVEPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKD
Sbjct  455  SLRQYARTIGHVEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKD  514

Query  528  VKKLDKFIQLDELVdanklngaaggdagatangkaLAKTNGGDNAHPRPSEQEGQIAKPG  587
            VKKLD F+ +D+                                        +G  AK G
Sbjct  515  VKKLDAFLLIDD----------------------------------------DGSSAKEG  534

Query  588  S-GGMNFDIETAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHE  646
            +   + FD+ETA++VL ENYP HAL LAKKH EHSWYLKIQLDRIS         LS  E
Sbjct  535  TPQALTFDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRISDT-------LSDAE  587

Query  647  KERVADALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS  699
              RVADAL+YI+ LSF+EAD NLRKYGRTLVTHLPGPTT+LL++LCTG F+A+
Sbjct  588  HARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSAT  640

>PYU1_G006994
Length=336

 Score = 34.7 bits (78),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query  143  KLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKN---GAVILFRIDLKRKVDRPP  196
            +L+   P   +  PEE + AFA  D I ++   LKN   G     R++    +D PP
Sbjct  121  QLVCPAPECMRSLPEELIVAFASPDMIAKYKKFLKNQKTGVRFCPRVNCSAAIDEPP  177

>PHALS_11598
Length=1421

 Score = 33.5 bits (75),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 54/104 (52%), Gaps = 9/104 (9%)

Query  378  APGARFGLDDMEEIRHVVCEFGAIFVVSSV-GCVYRLTEKDTTSK--LEILFR------K  428
            A GA    DD+  ++  V EFG  FV+SS+ G +Y+L E  +  K  ++ +F+      K
Sbjct  285  AVGAFLSSDDVNHLKAFVREFGLRFVLSSLEGRIYQLNEIVSAMKKGVKNVFKSWLRKPK  344

Query  429  NLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQY  472
            +L    +S + + +Y  ++I    R+  D  +   D++ +L+ Y
Sbjct  345  DLRMSNVSASGNVSYKSDAIESQTRLLADTAFLVRDYELALQMY  388

>PYU1_G006110
Length=983

 Score = 33.5 bits (75),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 34/76 (45%), Gaps = 2/76 (3%)

Query  139  DGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGAVILFRIDLKRKVDRPPHL  198
            D + KL +  P F    P  +V     S +    A G +NG V LF  DL R   R    
Sbjct  720  DSTVKLWRYTPTFIVSSPVYSVLCLDTSPNGAFGAAGTRNGHVYLF--DLNRPAFRIDVF  777

Query  199  LQPAGQFPVTGLSFTS  214
            + P  +  V+ +SFT+
Sbjct  778  VSPTRRGDVSSISFTA  793

>PHYCA_127130
Length=149

 Score = 31.6 bits (70),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 21/78 (27%), Positives = 38/78 (49%), Gaps = 9/78 (12%)

Query  397  EFGAIFVVSSVGCVYRLT-EKDTTSKLE-------ILFRKNLYSIAISLAFSSNYDINSI  448
            ++G ++ V++  C   +T   +   +L+       +LF+ N  +I +  A   NY +  +
Sbjct  32   DYGLLWFVAAAECSVMITWTHNLCQELKLRHRQKTVLFQDNQSTIKVIKALKGNYKVKGV  91

Query  449  MDIFRMYGDHLYEKGDFD  466
               F    D LYE+GDFD
Sbjct  92   DLKFHKVKD-LYERGDFD  108

>PYAP_13333
Length=346

 Score = 32.7 bits (73),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 13/81 (16%)

Query  131  WRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAF--------AVSDDIGQFAVGLKNGAVI  182
            WR  ++ ++     L   PV  K++PE   T          A++D +   A+GL      
Sbjct  116  WRMGERPKNTKFAELNAEPVIPKEFPEWETTMNMWGGKMLDAITDLVEMAAIGLG-----  170

Query  183  LFRIDLKRKVDRPPHLLQPAG  203
            L +  L +++   PHLL P G
Sbjct  171  LEKDALSKRIQNAPHLLAPTG  191

>PHALS_08408
Length=318

 Score = 32.3 bits (72),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 42/90 (47%), Gaps = 0/90 (0%)

Query  47   VHLANRQLEMRKFRAHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRAS  106
            V LA+ +    + R H   V  ++++    + V +G  ++  + +    +R I   GR +
Sbjct  203  VRLADEEDVSLRQRMHNMHVLGLMVIVGPKLKVIVGQLLELSTRKKLHNARDITPQGRLA  262

Query  107  TGNASEDMYATKTTAGKSSAMVRIWRTDQQ  136
            T N    + A+ ++ G +S MVR    D +
Sbjct  263  TANTFPGVIASASSLGPNSVMVRFCGQDME  292

Lambda      K        H        a         alpha
   0.321    0.135    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 55448247168

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40