Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAR_171301617122722712127e-171
PYAP_165861617125325311272e-157
PHYSO_5388861617122822710955e-153
PPTG_101841617122822710922e-152
PITG_206291617122822710913e-152
PHYCA_1228181617122922810904e-152
PHYKE_108181617123022910886e-152
PYIR_170331617123222510827e-151
PYIW_177511617122422610764e-150
PHALS_051931617122822710687e-149
PYVX_146271617122922810635e-148
PYU1_G0019711617122222610573e-147
PHYRA_8473016170194321510268e-128
HYAP_07162161711942278903e-122
CCI46337161712292278761e-119
CCA17366161712282268571e-116
H310_01462161712252298231e-111
SDRG_06607161712202298179e-111
SPRG_05306161712202298161e-110
HYAP_07161161701881787635e-103
H257_00325161712402447633e-102
PYU1_G002262933416863681.1
PYIW_2766816706413840721.2
PYVX_1620411207118864731.8
CCA1777411841218133712.6
PYU1_G01234196771219140685.5
SPRG_1674113166722546669.2
PYIW_181941609853374679.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAR_17130

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYAR_17130                                                            471     7e-171
PYAP_16586                                                            438     2e-157
PHYSO_538886                                                          426     5e-153
PPTG_10184                                                            425     2e-152
PITG_20629                                                            424     3e-152
PHYCA_122818                                                          424     4e-152
PHYKE_10818                                                           423     6e-152
PYIR_17033                                                            421     7e-151
PYIW_17751                                                            419     4e-150
PHALS_05193                                                           416     7e-149
PYVX_14627                                                            414     5e-148
PYU1_G001971                                                          411     3e-147
PHYRA_84730                                                           399     8e-128
HYAP_07162                                                            347     3e-122
CCI46337                                                              342     1e-119
CCA17366                                                              334     1e-116
H310_01462                                                            321     1e-111
SDRG_06607                                                            319     9e-111
SPRG_05306                                                            318     1e-110
HYAP_07161                                                            298     5e-103
H257_00325                                                            298     3e-102
PYU1_G002262                                                          30.8    1.1   
PYIW_27668                                                            32.3    1.2   
PYVX_16204                                                            32.7    1.8   
CCA17774                                                              32.0    2.6   
PYU1_G012341                                                          30.8    5.5   
SPRG_16741                                                            30.0    9.2   
PYIW_18194                                                            30.4    9.8   

>PYAR_17130
Length=227

 Score = 471 bits (1212),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 227/227 (100%), Positives = 227/227 (100%), Gaps = 0/227 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR
Sbjct  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227
            NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT
Sbjct  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227

>PYAP_16586
Length=253

 Score = 438 bits (1127),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 219/253 (87%), Positives = 224/253 (89%), Gaps = 26/253 (10%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLC+SIYDFVHIGDAFVH
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCLSIYDFVHIGDAFVH  60

Query  61   PADGTSHSQV------------EFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDII  108
            PADGTSHSQV            EFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDII
Sbjct  61   PADGTSHSQVKRDGSTDARGVVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDII  120

Query  109  IPSYALQTPSYFDTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAH-----  163
            IPSYA+QTPSYFDTAERLWVWKYSEGNEKFYMDLHEEIRFRVT+INFTRVTKTAH     
Sbjct  121  IPSYAMQTPSYFDTAERLWVWKYSEGNEKFYMDLHEEIRFRVTSINFTRVTKTAHGGWYV  180

Query  164  ---------GIQATTTEASDKTEGARNAGDMRQSLARGRSASVDLSESDPTPSAIHILGT  214
                     GIQATTTEAS+KTEG  NAGDMRQSL RGRSASVDLS+SDPTPSAIHILGT
Sbjct  181  DADGVVGGVGIQATTTEASEKTEGTANAGDMRQSLTRGRSASVDLSDSDPTPSAIHILGT  240

Query  215  IDEDGLGLSSWWT  227
            IDEDGLGLSSWWT
Sbjct  241  IDEDGLGLSSWWT  253

>PHYSO_538886
Length=228

 Score = 426 bits (1095),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 202/227 (89%), Positives = 216/227 (95%), Gaps = 0/227 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPVAP+LF+ DY +VL+EEIDRKYANKVIADVGLC+++YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFR+VVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAERLWVWKYSEG EKFYMDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK E   
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227
            +AGDMRQSLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGLSSWWT
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWT  227

>PPTG_10184
Length=228

 Score = 425 bits (1092),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 201/227 (89%), Positives = 215/227 (95%), Gaps = 0/227 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MF LTRISDVIPVAP+LF+ DY +VL+EEIDRKYANKVIADVGLC+++YDFV IGDAFVH
Sbjct  1    MFALTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFR+VVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAERLWVWKYSEG EKFYMDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK E   
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227
            +AGDMRQSLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGLSSWWT
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWT  227

>PITG_20629
Length=228

 Score = 424 bits (1091),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 201/227 (89%), Positives = 215/227 (95%), Gaps = 0/227 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPVAP+LF+ DY +VL+EEIDRKYANKVIADVGLC+++YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFR+VVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAERLWVWKYSEG EKFYMDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK E   
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEI  180

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227
            +AGDMRQSLAR RS+SVDLS++DPTPSAIHIL TIDEDGLGLSSWWT
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWT  227

>PHYCA_122818
Length=229

 Score = 424 bits (1090),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 216/228 (95%), Gaps = 1/228 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPVAP+LF+ DY +VLVEE+DRKYANKVIADVGLC+++YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEVDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFRMVVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHG-IQATTTEASDKTEGA  179
            DTAERLWVWKYSEG EKFYMDLHEEIRFRVTNINFTRVTKTA G IQATTTEA+DK E  
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGSIQATTTEATDKAEKE  180

Query  180  RNAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227
             +AGDMRQSLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGLSSWWT
Sbjct  181  TSAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWT  228

>PHYKE_10818
Length=230

 Score = 423 bits (1088),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 203/229 (89%), Positives = 216/229 (94%), Gaps = 2/229 (1%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPVAP+LF+ DY +VLVEEIDRKYANKVI+DVGLC+++YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVISDVGLCITLYDFVSIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFRMVVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDK--TEG  178
            D+AERLWVWKYSEG EKFYMDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK   EG
Sbjct  121  DSAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAENEG  180

Query  179  ARNAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227
               AGDMRQSLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGLSSWWT
Sbjct  181  VVTAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWT  229

>PYIR_17033
Length=232

 Score = 421 bits (1082),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 213/225 (95%), Gaps = 1/225 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPV+P+LF+ DY KVLVEEIDRKYANKVIADVGLC++IYDFVHIGDAFVH
Sbjct  1    MFVLTRISDVIPVSPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFRMVVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAERLWVWKYSEG EKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEASDK     
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTATGIQATTTEASDKA-ATS  179

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSW  225
             AGDMRQSLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGL+SW
Sbjct  180  AAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSW  224

>PYIW_17751
Length=224

 Score = 419 bits (1076),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 200/226 (88%), Positives = 213/226 (94%), Gaps = 4/226 (2%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV P+LF+ DY KVLVEEIDRKYANKV+ADVGLC++IYDFVHIGDAFVH
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVVADVGLCITIYDFVHIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFRMVVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAERLWVWKYSEG EKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEASDK E   
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTATGIQATTTEASDKAE---  177

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226
             A D+RQSLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGL+SWW
Sbjct  178  -ASDLRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWW  222

>PHALS_05193
Length=228

 Score = 416 bits (1068),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 197/227 (87%), Positives = 214/227 (94%), Gaps = 0/227 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPV P+LF+ DY +VL+EEIDRKYANKVIADVGLC+++YDFV IGDA VH
Sbjct  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFR+VVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAERLWVWKYS+G EKF+MDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK+E   
Sbjct  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227
             AGDMR+SLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGLSSWWT
Sbjct  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWT  227

>PYVX_14627
Length=229

 Score = 414 bits (1063),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 217/228 (95%), Gaps = 3/228 (1%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTR+SDVIPVAP+LF+ DY +VLVEEIDRKYANKVIADVGLC++++DFVHIGDAF+H
Sbjct  1    MFVLTRLSDVIPVAPELFDADYTQVLVEEIDRKYANKVIADVGLCITLHDFVHIGDAFIH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFRMVVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTE--G  178
            D+AERLWVWKYS+  EKFYMDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK +  G
Sbjct  121  DSAERLWVWKYSDSQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKEQDGG  180

Query  179  ARNAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226
            A+N GDMR+SLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGL+SWW
Sbjct  181  AKN-GDMRESLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWW  227

>PYU1_G001971
Length=222

 Score = 411 bits (1057),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 199/226 (88%), Positives = 210/226 (93%), Gaps = 6/226 (3%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV P+LF+ DY KVLVEEIDRKYANKVIADVGLC++IYDFVHIGDAFVH
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFRMVVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAERLWVWKYSEG EKFYMD+HEEIRFRVTNINFTRVTKTA+GIQATTTEASDK     
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDK-----  175

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226
             A    QSLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGLSSWW
Sbjct  176  -AASEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220

>PHYRA_84730
Length=1943

 Score = 399 bits (1026),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 201/215 (93%), Gaps = 0/215 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVIPVAP+LF+ DY +VLVEEIDRKYANKV+ADVGLC+++YDFV IGDA+VH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVLADVGLCITLYDFVSIGDAYVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFRMVVFRPFVGEVLKGR+VSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRVVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            D AERLWVWKYSEG EKFYMDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK E   
Sbjct  121  DAAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTI  215
            +AGDMRQSLAR RS+SVDLS++DPTPSAIHIL  +
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILARL  215

>HYAP_07162
Length=194

 Score = 347 bits (890),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 184/227 (81%), Gaps = 34/227 (15%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTR+SDVIPVAP LF+ DY +VL+EEIDRKYANKVIADVGLCV++YDFV IGDAFVH
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHS VEFRM+VFRPFVGEVLKGRIV C +EHIRVSMDFVQDIIIPSYALQTPSY+
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DTAE+LWVWKYS+G EKFYMDLHEEIRFRVTNINFTRVTKTA                  
Sbjct  121  DTAEKLWVWKYSDGQEKFYMDLHEEIRFRVTNINFTRVTKTAK-----------------  163

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227
                             DLS++DPTPSAIHILG+IDEDGLGLSSWWT
Sbjct  164  -----------------DLSDNDPTPSAIHILGSIDEDGLGLSSWWT  193

>CCI46337
Length=229

 Score = 342 bits (876),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 196/227 (86%), Gaps = 3/227 (1%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTRISDVI + P LF+ DY KVL EEIDRKY NKVIADVGLC+S+YDF+ IGDA +H
Sbjct  1    MFVLTRISDVIAIHPMLFDGDYTKVLKEEIDRKYCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P++G SH+QVEFRM+VFRPF+GEVLKG+I+SCNE HIR++M+F+QDI+IPSYALQTPS+F
Sbjct  61   PSEGDSHTQVEFRMIVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DT ERLWVW +++  EKF+MDL+EEIRFRVTN+NFT+V KTA G+QATT+E+++K + A 
Sbjct  121  DTYERLWVWTFTDSAEKFHMDLNEEIRFRVTNVNFTQVHKTAKGMQATTSESTEKKDKAS  180

Query  181  -NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226
               G++     R R +SVDLS+SDPTPSA+ ILGTIDEDGLGL+SWW
Sbjct  181  LKRGNLDDK--RRRLSSVDLSDSDPTPSAMQILGTIDEDGLGLTSWW  225

>CCA17366
Length=228

 Score = 334 bits (857),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 191/226 (85%), Gaps = 1/226 (0%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVL RISDVI + P LF+ DY +VL EEID+K+ NKVIADVGLC+S+YDF+ IGDA +H
Sbjct  1    MFVLARISDVIAIHPMLFDGDYTRVLKEEIDKKFCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P++G SH+QVEFRMVVFRPF+GEVLKG+I+SCNE HIR++M+F+QDI+IPSYALQTPS+F
Sbjct  61   PSEGDSHTQVEFRMVVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180
            DT ERLWVW ++E  EKF+MDL+EE+RFRVTN+NFT+V KTA G+QATT E++DK   + 
Sbjct  121  DTYERLWVWTFTESGEKFHMDLNEEVRFRVTNVNFTQVHKTAKGMQATTIESTDKDGKST  180

Query  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226
              G       R R +SVDLS++DPTPSA+ ILGTIDEDGLGL+SWW
Sbjct  181  LKGGNIDDRKR-RLSSVDLSDNDPTPSAMQILGTIDEDGLGLTSWW  225

>H310_01462
Length=225

 Score = 321 bits (823),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 185/229 (81%), Gaps = 10/229 (4%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVL R++DVI VAP+LF  DY  VL+EEIDRKYANKVIADVGLC++ YDF+ IGDA+VH
Sbjct  1    MFVLCRVADVIQVAPELFSADYSSVLIEEIDRKYANKVIADVGLCITHYDFIEIGDAYVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSH+ V FRMVVFRPF+GE+LKG+I++C EEHIRVSM+F+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIINCTEEHIRVSMEFMQDIIIPSYAMQNPSFF  120

Query  121  DTAERLWVWKY---SEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTE  177
            D  ERLW WK+    +  + +YM L+EE+RFRVTNINFTRV KTA+G+QA T  A  K +
Sbjct  121  DKTERLWEWKFPGREDDQDPYYMYLNEEVRFRVTNINFTRVLKTANGMQAVTEAADTKPD  180

Query  178  GARNAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226
             + N         R RS+SVDLS++DP P+A+ I+GTIDEDGLGLSSWW
Sbjct  181  KSENP-------TRRRSSSVDLSDTDPKPAALQIIGTIDEDGLGLSSWW  222

>SDRG_06607
Length=220

 Score = 319 bits (817),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 187/229 (82%), Gaps = 15/229 (7%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVL RI+DVI +AP+LF  DY  VL EEIDRKYANKVIADVGLC+++YDF+ IGDA++H
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSH++V FRMVVF+PF+GEVLKG+I+SC EEHIRVSMDFVQDIIIPSYA+QTPS+F
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DTAERLWVWKY---SEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTE  177
            D  ERLW WK+    +  + +YM LHEEIRFRVTNINFTRVTKTA GIQAT TEA+    
Sbjct  121  DKNERLWEWKFPGKEDEQDPYYMYLHEEIRFRVTNINFTRVTKTAKGIQATVTEAA----  176

Query  178  GARNAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226
                      + +R RS+SVDLSE DP PSA+ I+GTIDEDGLGLSSWW
Sbjct  177  --------DSASSRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWW  217

>SPRG_05306
Length=220

 Score = 318 bits (816),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 187/229 (82%), Gaps = 15/229 (7%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVL RI+DVI +AP+LF  DY  VL EEIDRKYANKVIADVGLC+++YDF+ IGDA++H
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSH++V FRMVVF+PF+GEVLKG+I+SC EEHIRVSMDFVQDIIIPSYA+QTPS+F
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DTAERLWVWKY---SEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTE  177
            D  ERLW WK+    +  + +YM LHEE+RFRVTNINFTRVTKTA GIQAT TEA+    
Sbjct  121  DKNERLWEWKFPGKEDEQDPYYMYLHEEVRFRVTNINFTRVTKTAKGIQATVTEAA----  176

Query  178  GARNAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226
                      + +R RS+SVDLSE DP PSA+ I+GTIDEDGLGLSSWW
Sbjct  177  --------DSASSRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWW  217

>HYAP_07161
Length=188

 Score = 298 bits (763),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 155/178 (87%), Gaps = 14/178 (8%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVLTR+SDVIPVAP LF+ DY +VL+EEIDRKYANKVIADVGLCV++YDFV IGDAFVH
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHS VEFRM+VFRPFVGEVLKGRIV C +EHIRVSMDFVQDIIIPSYALQTPSY+
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DTAERLWVWKYSEGN--------------EKFYMDLHEEIRFRVTNINFTRVTKTAHG  164
            DTAE+LWVWKYS+G               EKFYMDLHEEIRFRVTNINFTRVTKTA G
Sbjct  121  DTAEKLWVWKYSDGQGEGVPQTWSRCLAVEKFYMDLHEEIRFRVTNINFTRVTKTAKG  178

>H257_00325
Length=240

 Score = 298 bits (763),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 185/244 (76%), Gaps = 25/244 (10%)

Query  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60
            MFVL R++DVI VAP+LF  DY  VL+EEIDRKYANKV+ADVGLC++ YDF+ IGDA++H
Sbjct  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60

Query  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSH+ V FRMVVFRPF+GE+LKG+I+SC EEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120

Query  121  DTAERLWVWKYS--EG----------------NEKFYMDLHEEIRFRVTNINFTRVTKTA  162
            D  ERLW WK+   EG                 + +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180

Query  163  HGIQATTTEASDKTEGARNAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGL  222
             G+QA T     K        D  ++ +R RS+SVDLS+SDP P+A+ I+GTIDEDGLGL
Sbjct  181  KGMQAVTDATDSKP-------DKHEAPSRRRSSSVDLSDSDPKPAALQIIGTIDEDGLGL  233

Query  223  SSWW  226
            SSWW
Sbjct  234  SSWW  237

>PYU1_G002262
Length=68

 Score = 30.8 bits (68),  Expect = 1.1, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (8%)

Query  88   RIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYFDTAER---LWVWKYSEGNEKFYMDLHE  144
            +++ C   ++ + MD V      SY  Q  SYFDT  +    W+   S  N+K+Y D+  
Sbjct  3    QLIGCFGSYLFMKMDKVS--AAKSYLSQIKSYFDTKWQDNIEWILYPSRSNDKWYSDIRS  60

Query  145  EIR  147
             +R
Sbjct  61   GVR  63

>PYIW_27668
Length=138

 Score = 32.3 bits (72),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 26/40 (65%), Gaps = 3/40 (8%)

Query  83   EVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPS--YF  120
            E+ K    + +++H+ ++MDF Q++  PS A +TPS  YF
Sbjct  26   ELYKNEFAAVSDDHVVLTMDFAQNLTTPS-AAETPSEWYF  64

>PYVX_16204
Length=1188

 Score = 32.7 bits (73),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (52%), Gaps = 5/64 (8%)

Query  10   VIPVAPDLFEEDYQKVLVEEIDRKYAN-KVIADVGLCVSIYDFVHIGDAFVHPADGTSHS  68
            VIPV    FE + +  L+ E+   Y N   ++D    V+  + V + DAF++P +G    
Sbjct  829  VIPV----FENEKRHQLIAELKALYKNLSTLSDAATAVACPELVCLYDAFMNPNEGNVSI  884

Query  69   QVEF  72
             VE+
Sbjct  885  VVEY  888

>CCA17774
Length=218

 Score = 32.0 bits (71),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 59/133 (44%), Gaps = 8/133 (6%)

Query  2    FVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYA--NKVIADVGLCVSIYDFVHIGDAFV  59
            FV  ++   + ++P    +  Q +  +E++      N+ +  V LC   ++ +H+GD + 
Sbjct  8    FVSIKVRHSLTLSPCHLSDPLQGIQ-QELNGSVMQYNETLKGVILC---FNSIHLGDPYG  63

Query  60   HPADGTS--HSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTP  117
            H    +   H ++    +VF+P  G +LK +I      HI +    V +  + +  L   
Sbjct  64   HIISDSPYVHCKIIANALVFQPRQGMLLKAQINKIGSNHIGMLFVGVFNGSVAASELPEG  123

Query  118  SYFDTAERLWVWK  130
              ++  +  W+ K
Sbjct  124  FVYNYHKEAWIGK  136

>PYU1_G012341
Length=219

 Score = 30.8 bits (68),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 33/140 (24%), Positives = 54/140 (39%), Gaps = 15/140 (11%)

Query  88   RIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYFDTAER---LWVWKYSEGNEKFYMDLHE  144
            +++ C   ++ + MD V      SY  Q  SYFDT  +    W+   S  N+K+Y D+  
Sbjct  54   QLIGCFGSYLFMEMDKVS--AAQSYLSQIKSYFDTKWQDNVEWILHPSRSNDKWYSDIRS  111

Query  145  EIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGARNAGDMRQSLARGRSASVDLSESDP  204
             +R    N            I   +          R++     ++    + S+ L E D 
Sbjct  112  GVRRMYIN----------RAIAEGSALVDQAPPMYRDSLRQVCAMLVANNTSMSLRERDL  161

Query  205  TPSAIHILGTIDEDGLGLSS  224
              +  H +G   E GL  SS
Sbjct  162  LVTQWHCMGRAVETGLRHSS  181

>SPRG_16741
Length=225

 Score = 30.0 bits (66),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 4/46 (9%)

Query  34   YANKVIADVGLCVSIYDFVHIGDAFVHPADGTSHSQVEFRMVVFRP  79
            Y  ++ ADV  CV IYDF    DAF+      S + ++ R+ + RP
Sbjct  159  YNAQLPADVECCVPIYDF----DAFLGLGSDISTATIQERIDIQRP  200

>PYIW_18194
Length=533

 Score = 30.4 bits (67),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 5/74 (7%)

Query  85   LKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYFDTAERLWVWKYSEGNEKFYMDLHE  144
            ++GRIV+   ++ ++SM    DI +  +A Q   YF    ++  W + E    F   LH 
Sbjct  168  MQGRIVAVKVQYPKLSMQMGADIRVMKWAAQLTEYFFPDVQVQ-WMFPE----FEAALHS  222

Query  145  EIRFRVTNINFTRV  158
            E+ F     N  R+
Sbjct  223  ELDFENEKRNSRRI  236

Lambda      K        H        a         alpha
   0.320    0.135    0.404    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11475046035

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40