Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAP_24882111491791799414e-131
PYAR_22689111493041686237e-81
PYIW_14749111493141666091e-78
PYIR_15197111492841725774e-74
PHYCA_60964111491771675423e-70
PHYSO_315015111492061695271e-67
PITG_13744111491781674954e-63
SDRG_14093111492871414899e-61
H310_11728111492911424715e-58
PHYRA_81677111491731684581e-57
SPRG_03281111491531264562e-57
H257_12786111492781414662e-57
CCA17990111492831633775e-44
PYU1_G00596511149117963575e-43
PHYKE_64081114991692521e-27
PPTG_09254111493071012436e-24
PHYCA_505767128364601351402e-09
PHALS_09846128364811451366e-09
PYIW_21378128364961131332e-08
H310_14476128364901311313e-08
PHYSO_249618128364851131305e-08
SDRG_14076128364711281296e-08
H257_13329128364451331271e-07
PYU1_G000982128365281131271e-07
PITG_15925128364551131271e-07
PYIR_18116128365321131271e-07
SPRG_09603128364671221243e-07
PYAR_14105128364941501234e-07
PHYRA_741511283511271111163e-06
PPTG_12717128364961341041e-04
PYVX_17526128365211351013e-04
PHYKE_62591283623065800.100
PITG_069025809201685721.9
PPTG_2239286272692129712.0
PITG_01233109172165702.5
SDRG_10849131027632357712.7
PPTG_0960412966228398694.2
PYAP_207288482113452664.8
SDRG_144907528172667.0
PYAR_1377710038856848668.1
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAP_24882

Length=179
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYAP_24882                                                            367     4e-131
PYAR_22689                                                            244     7e-81 
PYIW_14749                                                            239     1e-78 
PYIR_15197                                                            226     4e-74 
PHYCA_60964                                                           213     3e-70 
PHYSO_315015                                                          207     1e-67 
PITG_13744                                                            195     4e-63 
SDRG_14093                                                            192     9e-61 
H310_11728                                                            186     5e-58 
PHYRA_81677                                                           181     1e-57 
SPRG_03281                                                            180     2e-57 
H257_12786                                                            184     2e-57 
CCA17990                                                              149     5e-44 
PYU1_G005965                                                          142     5e-43 
PHYKE_6408                                                            101     1e-27 
PPTG_09254                                                            98.2    6e-24 
PHYCA_505767                                                          58.5    2e-09 
PHALS_09846                                                           57.0    6e-09 
PYIW_21378                                                            55.8    2e-08 
H310_14476                                                            55.1    3e-08 
PHYSO_249618                                                          54.7    5e-08 
SDRG_14076                                                            54.3    6e-08 
H257_13329                                                            53.5    1e-07 
PYU1_G000982                                                          53.5    1e-07 
PITG_15925                                                            53.5    1e-07 
PYIR_18116                                                            53.5    1e-07 
SPRG_09603                                                            52.4    3e-07 
PYAR_14105                                                            52.0    4e-07 
PHYRA_74151                                                           49.3    3e-06 
PPTG_12717                                                            44.7    1e-04 
PYVX_17526                                                            43.5    3e-04 
PHYKE_6259                                                            35.4    0.100 
PITG_06902                                                            32.3    1.9   
PPTG_22392                                                            32.0    2.0   
PITG_01233                                                            31.6    2.5   
SDRG_10849                                                            32.0    2.7   
PPTG_09604                                                            31.2    4.2   
PYAP_20728                                                            30.0    4.8   
SDRG_14490                                                            30.0    7.0   
PYAR_13777                                                            30.0    8.1   

>PYAP_24882
Length=179

 Score = 367 bits (941),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)

Query  1    MAPRTWMTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQ  60
            MAPRTWMTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQ
Sbjct  1    MAPRTWMTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQ  60

Query  61   LLGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKE  120
            LLGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKE
Sbjct  61   LLGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKE  120

Query  121  EMESLMTRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREKMPLRS  179
            EMESLMTRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREKMPLRS
Sbjct  121  EMESLMTRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREKMPLRS  179

>PYAR_22689
Length=304

 Score = 244 bits (623),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 138/168 (82%), Gaps = 6/168 (4%)

Query  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNV  66
            M FEIP VRALVRR +R+ AQRLLE+IA QVLPIL+KRRFRV+ L EFFP D  LLGMNV
Sbjct  1    MEFEIPVVRALVRRADRDAAQRLLEKIALQVLPILTKRRFRVKRLHEFFPSDANLLGMNV  60

Query  67   NRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLM  126
            NRGATIYIRLRP  RP SF PYEALLETMLHELTHMVHGPHNQAFY      K+E+ESLM
Sbjct  61   NRGATIYIRLRPQHRPESFLPYEALLETMLHELTHMVHGPHNQAFY------KDEVESLM  114

Query  127  TRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREK  174
             RGL GHEGARFQDAG  YSIQT++  IAVR  NDN AAVLAA RREK
Sbjct  115  LRGLTGHEGARFQDAGDGYSIQTQTTAIAVRHTNDNLAAVLAAARREK  162

>PYIW_14749
Length=314

 Score = 239 bits (609),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 140/166 (84%), Gaps = 1/166 (1%)

Query  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNV  66
            M+F+I +VRALVRRP R++AQ+LLERIA+ VLPIL++RRFRV  L+EFFP    LLGMNV
Sbjct  1    MSFKIGEVRALVRRPRRDEAQQLLERIASHVLPILTQRRFRVLRLQEFFPTSAHLLGMNV  60

Query  67   NRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLM  126
            NRG  IY+RLRPA++P +F+P+EALLETMLHELTHMVHGPHNQAFYKYLDELK EME+LM
Sbjct  61   NRGYKIYLRLRPAAQPAAFYPFEALLETMLHELTHMVHGPHNQAFYKYLDELKTEMEALM  120

Query  127  TRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRR  172
             +GL+G EGA+F  AG+   I+  SR I+VR +NDN AAVL A+RR
Sbjct  121  IQGLIGAEGAKFHSAGEGRVIKA-SRSISVRFQNDNAAAVLVAKRR  165

>PYIR_15197
Length=284

 Score = 226 bits (577),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 133/172 (77%), Gaps = 14/172 (8%)

Query  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNV  66
            M+FEI +VRALVRRP R++AQ+LL+RIA+ VLPIL++RRFRV  L+EFFP +  LLGMNV
Sbjct  1    MSFEILEVRALVRRPRRDEAQQLLDRIASHVLPILAQRRFRVLRLQEFFPTNAHLLGMNV  60

Query  67   NRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLM  126
            NRG  IY+RLRPA+RP SF P+EALLETMLHELTHMVHGPHNQAFY YLDELK EME+LM
Sbjct  61   NRGIKIYLRLRPAARPESFLPFEALLETMLHELTHMVHGPHNQAFYNYLDELKMEMEALM  120

Query  127  TRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREKMPLR  178
             R L+G EGA+F  AG+                NDN AAVLAA+ RE+  LR
Sbjct  121  IRDLLGTEGAKFHSAGEGR--------------NDNAAAVLAAKHREQDQLR  158

>PHYCA_60964
Length=177

 Score = 213 bits (542),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 134/167 (80%), Gaps = 5/167 (3%)

Query  8    TFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNVN  67
            ++ I +++ALVR+P+RE AQRLLER+AA VLPI+++RRFRVR L EFFPKDG LLGMNVN
Sbjct  2    SYAITEIKALVRQPQREDAQRLLERLAAAVLPIMTRRRFRVRRLLEFFPKDGALLGMNVN  61

Query  68   RGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLMT  127
            RGA IY+RLRP   P SF+ YE LL T+LHELTHMVHGPHNQAFYKYLDELK +MESLM 
Sbjct  62   RGAKIYVRLRPQRNPESFYSYEELLGTLLHELTHMVHGPHNQAFYKYLDELKHDMESLMV  121

Query  128  RGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREK  174
            RGLVG EGA+F +AG+ + +   S  + +R      AAVLAA+RRE+
Sbjct  122  RGLVGEEGAKFSEAGEGHRLGGSSVGVPIR-----VAAVLAAKRREQ  163

>PHYSO_315015
Length=206

 Score = 207 bits (527),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 136/169 (80%), Gaps = 7/169 (4%)

Query  8    TFEIPDVRALVRRPE--REQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMN  65
            +F IP+V+ALVR+P+  R +AQ+LLER+AA VLPIL+KRRFRVR L EFFPKDG LLGMN
Sbjct  4    SFAIPEVKALVRQPQPQRARAQQLLERLAAAVLPILTKRRFRVRWLLEFFPKDGCLLGMN  63

Query  66   VNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL  125
            VNRGA IY+RLRP   P SF PYEALLET+LHELTHMVHGPHNQAFY+YLDELK+EMESL
Sbjct  64   VNRGAKIYVRLRPQRSPQSFLPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMESL  123

Query  126  MTRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREK  174
            M RGLVG EGA+F DAG    +   S  + +R      AAVLAA+RRE+
Sbjct  124  MVRGLVGEEGAKFADAGAGQRLGGNSAGVPIR-----VAAVLAAKRREQ  167

>PITG_13744
Length=178

 Score = 195 bits (495),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 132/167 (79%), Gaps = 5/167 (3%)

Query  8    TFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNVN  67
             F I +++ALVR+P+R QAQ+LLER+AA VLPIL++RRF VR L EFFPKDG LLGMNVN
Sbjct  3    AFAIAEIKALVRQPQRVQAQQLLERLAAAVLPILTRRRFHVRRLHEFFPKDGALLGMNVN  62

Query  68   RGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLMT  127
            RGA IY+RLR    P +F+PYEALLET+LHELTHMVHGPHN+AFY YL+ELK EMESLM 
Sbjct  63   RGAKIYVRLRLKHAPDTFYPYEALLETLLHELTHMVHGPHNEAFYTYLEELKAEMESLMV  122

Query  128  RGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREK  174
            RGLVG EGA+F DAG    +   SRV A  R     AAVLAA+RRE+
Sbjct  123  RGLVGEEGAKFADAGTGQRLGG-SRVSAPARV----AAVLAAKRREQ  164

>SDRG_14093
Length=287

 Score = 192 bits (489),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 113/141 (80%), Gaps = 0/141 (0%)

Query  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNV  66
            M ++IP +RAL R+ + ++AQR+LERIA+ VLPI++KR++RV+ L EFFPK+  LLGMNV
Sbjct  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60

Query  67   NRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLM  126
            N G  IY+RLRPA RPTSF P+E LL TMLHEL HM  GPHN AFYK LDEL  EMESLM
Sbjct  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120

Query  127  TRGLVGHEGARFQDAGQAYSI  147
             +GL+G  GA+FQ+AGQ +++
Sbjct  121  AQGLIGITGAQFQNAGQGHAL  141

>H310_11728
Length=291

 Score = 186 bits (471),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 3/142 (2%)

Query  6    WMTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMN  65
            WM   IP ++ L R+ ++++AQR+LERIA  VLPI +KR+F+VR L EFFPK+G LLGMN
Sbjct  7    WM---IPTIQVLKRQSKKDEAQRILERIADHVLPICTKRQFKVRNLLEFFPKNGNLLGMN  63

Query  66   VNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL  125
            VN+G  I++RLRPAS+PT+F P+E +L TMLHEL HM  GPHN +FYK LDEL  EME+L
Sbjct  64   VNQGWKIFLRLRPASQPTTFLPFEDILGTMLHELVHMKIGPHNASFYKMLDELTREMENL  123

Query  126  MTRGLVGHEGARFQDAGQAYSI  147
            + RGL+G  GA FQDAG   S+
Sbjct  124  LERGLLGAAGAAFQDAGNGQSL  145

>PHYRA_81677
Length=173

 Score = 181 bits (458),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 131/168 (78%), Gaps = 5/168 (3%)

Query  8    TFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNVN  67
            +F   +V+ALV R +REQAQ+LLER+AA VLPIL++RRFRVR L EFFP DG LLGMNVN
Sbjct  4    SFAFAEVKALVLRRQREQAQQLLERLAAAVLPILTRRRFRVRRLLEFFPTDGALLGMNVN  63

Query  68   RGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLMT  127
            RGA IY+RLRP   P SF+PYEALLET+LHELTHMVHGPHNQAFY+YLDELK+EMESLM 
Sbjct  64   RGAKIYVRLRPKRTPESFYPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMESLMV  123

Query  128  RGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREKM  175
            RGL G E  +F DAG    +  +S  + +       AAVLAA+RRE++
Sbjct  124  RGLEGQEAVKFADAGAGQRLGGDSARVPI-----CVAAVLAAKRREQV  166

>SPRG_03281
Length=153

 Score = 180 bits (456),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 103/126 (82%), Gaps = 0/126 (0%)

Query  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNV  66
            M ++IP +RAL R+P+ ++AQR+LERIA+ VLPI+SKR++RV+ L EFFPK+  LLGMNV
Sbjct  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60

Query  67   NRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLM  126
            N G  IY+RLRPA+RPTSF P+E LL TMLHEL HM  GPHN AFYK LDEL  EME+LM
Sbjct  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120

Query  127  TRGLVG  132
             +GL+G
Sbjct  121  AQGLIG  126

>H257_12786
Length=278

 Score = 184 bits (466),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 107/141 (76%), Gaps = 0/141 (0%)

Query  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNV  66
            M + IP ++AL ++ + ++AQR+LERIA  VLPI +KRRF+VR L EFFPK+  LLGMNV
Sbjct  1    MEWTIPTIQALKKQTKNDEAQRILERIAEHVLPICTKRRFKVRNLLEFFPKNANLLGMNV  60

Query  67   NRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLM  126
            N G  I++RLRPAS PT+F P+E +L TMLHEL HM  GPH+ +FYK LDEL E+ME+LM
Sbjct  61   NEGWKIFLRLRPASHPTTFLPFEEILGTMLHELVHMKIGPHDASFYKMLDELTEDMENLM  120

Query  127  TRGLVGHEGARFQDAGQAYSI  147
             RGL+G  GA FQD G   S+
Sbjct  121  ARGLLGATGAAFQDTGDGQSL  141

>CCA17990
Length=283

 Score = 149 bits (377),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 117/163 (72%), Gaps = 0/163 (0%)

Query  9    FEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNVNR  68
            +E+  ++AL ++    QAQRLL+R+A Q++PIL+K +F+VR L+EFFPKD +LLGMN+NR
Sbjct  4    YEVEAIKALAKQRNPTQAQRLLKRLADQIVPILTKHKFQVRHLQEFFPKDARLLGMNLNR  63

Query  69   GATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLMTR  128
            G  ++IRLRP+ +P +F+PYEALLET+LHELTH V+G H++AFYK+  +LK+E E LM  
Sbjct  64   GWKVFIRLRPSRKPDTFYPYEALLETLLHELTHNVYGQHDEAFYKFFAQLKKEAEDLMMN  123

Query  129  GLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQR  171
            GL G  GA F  +G+ + +Q  S      R     AA + A+R
Sbjct  124  GLSGRSGALFMGSGRGHVLQPNSTSAGDYRHKAALAADIRAKR  166

>PYU1_G005965
Length=117

 Score = 142 bits (357),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 0/96 (0%)

Query  8    TFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNVN  67
            +F I  VRALVRRP R+ AQ+LLE+IAA VLPIL++R FRVR L+EFFP +  LLGMNVN
Sbjct  11   SFAIGKVRALVRRPRRDDAQKLLEQIAAHVLPILTQRCFRVRRLQEFFPTNPHLLGMNVN  70

Query  68   RGATIYIRLRPASRPTSFFPYEALLETMLHELTHMV  103
            +G  IYIRLRPA+ P +FFP+EALLETMLHELTHMV
Sbjct  71   KGVKIYIRLRPANAPGTFFPFEALLETMLHELTHMV  106

>PHYKE_6408
Length=91

 Score = 101 bits (252),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)

Query  8   TFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNVN  67
           +F IP+V+ALVR+P R+ AQ+LLER+A  VLPI+++RRFRV  L EFFPKDG LLGMNVN
Sbjct  4   SFAIPEVKALVRQPRRDHAQQLLERLATAVLPIMTQRRFRVHRLIEFFPKDGSLLGMNVN  63

Query  68  RGATIYIRL  76
            GA IYIRL
Sbjct  64  HGAKIYIRL  72

>PPTG_09254
Length=307

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 5/101 (5%)

Query  74   IRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLMTRGLVGH  133
            +R  P   P SF+PYEALLET+LHELTHMVHGPHN+AFYKYLDELK EME LM RGLVG 
Sbjct  70   LRPLPKRTPKSFYPYEALLETLLHELTHMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129

Query  134  EGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREK  174
            EG RF  AG    +  ++  + +R      AAVLAA+RRE+
Sbjct  130  EGVRFAAAGTGQRLGGDNISVPIR-----VAAVLAAKRREQ  165

>PHYCA_505767
Length=460

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 71/135 (53%), Gaps = 15/135 (11%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATI  72
            + E+AQ +LE +A    +L +++K ++ V  L E  P DG++       LG+N N+G  I
Sbjct  113  DSEKAQEILENLANDRGILAVMAKHKWSVGVLAEM-PPDGKVGVDPVCVLGLNQNKGQKI  171

Query  73   YIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL----MTR  128
             +RLR       F  + ++ + + HEL+H VH  H+  FY+ + ++++E   L     + 
Sbjct  172  LLRLRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDNKFYQLMRQVEKECNELDWTNSSG  230

Query  129  GLVGHEGARFQDAGQ  143
              +G  GA  +D G 
Sbjct  231  AAIGGSGAILRDDGD  245

>PHALS_09846
Length=481

 Score = 57.0 bits (136),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/145 (27%), Positives = 69/145 (48%), Gaps = 15/145 (10%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQ-------LLGMNVNRGATI  72
            ++E+A  +LE++A    +L +++K ++ V  L E  P DG+       +LG+N N+G  I
Sbjct  137  DKEKAHEILEKLATDRGILAVMAKHKWSVGVLAEM-PPDGKVGVDPVCILGLNQNKGQKI  195

Query  73   YIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL----MTR  128
                        F  Y ++ + + HEL+H VH  H+  FY+ + +++ E   L       
Sbjct  196  L-LRLRTDDLLGFRKYLSIKKVLFHELSHNVHSEHDNKFYQLMRQVERECSELDWTQSGG  254

Query  129  GLVGHEGARFQDAGQAYSIQTESRV  153
             +VG   A  +D G      T  R+
Sbjct  255  SVVGGSPAIVEDDGTTLKNSTGYRL  279

>PYIW_21378
Length=496

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 62/113 (55%), Gaps = 11/113 (10%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATI  72
            +R +A+ +LER+A    +L ++ K ++ V  L E  P DG++       LG+N N+G  I
Sbjct  150  DRSRAREILERLANDRGILAVMDKHKWSVGTLAEMHP-DGKVGVDPVCVLGLNQNKGQKI  208

Query  73   YIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL  125
             +RLR       F  Y  + + + HELTH VH  H+  FY+ + ++++E   L
Sbjct  209  LLRLRTDDL-LGFRKYLGIKKVLFHELTHNVHSEHDSKFYQLMRQVEKECSEL  260

>H310_14476
Length=490

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 12/131 (9%)

Query  8    TFEIPDVRALVRRPEREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL----  61
            T++   +  L   P    A+ +LE +A    +L +L++ ++ V  L E FP DG++    
Sbjct  121  TYKFHAIETLPNMPNEATARNILESLATDPGILAVLAQHKWHVGALVEMFP-DGKVGVDP  179

Query  62   ---LGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDEL  118
               LG+N N+G  I +RLR       F  +  + + + HEL+H     HN  FY+ + ++
Sbjct  180  VCVLGLNENKGQRIRLRLR-TDDLLGFRKFLTIKQVLFHELSHNDVSDHNPEFYQLMRQV  238

Query  119  KEEMESL-MTR  128
            + E  ++ MTR
Sbjct  239  EAECNAIPMTR  249

>PHYSO_249618
Length=485

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 63/113 (56%), Gaps = 11/113 (10%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATI  72
            ++ +AQ +LE++A    +L +++K ++ V  L E  P DG++       LG+N N+G  I
Sbjct  139  DKHKAQEILEKLANDRGILAVMAKHKWSVGVLAEM-PPDGKVGVDPVCVLGLNQNKGQKI  197

Query  73   YIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL  125
             +RLR       F  + ++ + + HEL+H VH  H+  FY+ + +++ E   L
Sbjct  198  LLRLRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDSKFYQLMRQIENECNEL  249

>SDRG_14076
Length=471

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 66/128 (52%), Gaps = 11/128 (9%)

Query  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL---  61
            + +   +++ L   P+  +A+ +L  +A    +L +++K ++ V  L E FP DG++   
Sbjct  115  LAYRFHEIQTLPGLPDEAKARAILTSLAQDKGILHVMAKHKWTVGALAEMFP-DGKVGVD  173

Query  62   ----LGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDE  117
                LG+N N+G  I +RLR       F  Y  + + + HELTH     HN  FY+ + +
Sbjct  174  PVCVLGLNENKGQRILLRLR-TDDLQGFRKYLTIKKVLYHELTHNDVSDHNNEFYQLMRQ  232

Query  118  LKEEMESL  125
            ++ E  ++
Sbjct  233  VEAECNTV  240

>H257_13329
Length=445

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 69/133 (52%), Gaps = 12/133 (9%)

Query  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL---  61
            +T++  D+  L   P    A+ +L  +A+   +L +L+  +++V  L E +P DG++   
Sbjct  120  ITYKFRDIETLPGLPNEPTARNILVSLASDPGILAVLAHHKWQVGALVEMYP-DGKVGVD  178

Query  62   ----LGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDE  117
                LG+N N+G  I +RLR       F  +  + + + HEL+H     HN  FY+ + +
Sbjct  179  PVCVLGLNENKGQRIRLRLR-TDDLLGFRKFLTIKQVLFHELSHNEVSDHNNDFYQLMRQ  237

Query  118  LKEEMESL-MTRG  129
            ++ E  ++ MTR 
Sbjct  238  VETECNAVPMTRS  250

>PYU1_G000982
Length=528

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 65/113 (58%), Gaps = 11/113 (10%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATI  72
            ++++A+ +LER+A    +L +++K ++ V  L E +P DG++       LG+N N+G  I
Sbjct  139  DKDRAREILERLANDRGILAVMAKHKWTVGTLAEMYP-DGKVGVDPVCVLGLNQNKGQKI  197

Query  73   YIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL  125
             +RLR       F  Y  + + + HELTH V+  H+  F+  + ++++E  +L
Sbjct  198  LLRLRTDDL-LGFRKYLNIKKVLFHELTHNVYSEHDAKFFTLMSQVEKECAAL  249

>PITG_15925
Length=455

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 63/113 (56%), Gaps = 11/113 (10%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATI  72
            ++ +AQ +LE++A    +L +++K ++ V  L E  P DG++       LG+N N+G  I
Sbjct  137  DKNKAQEILEKLANDRGILAVMAKHKWSVGVLAEM-PPDGKVGVDPVCVLGLNQNKGQKI  195

Query  73   YIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL  125
             +RLR       F  + ++ + + HEL+H VH  H+  FY+ + +++ E   L
Sbjct  196  LLRLRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDNKFYQLMRQVERECSEL  247

>PYIR_18116
Length=532

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 62/113 (55%), Gaps = 11/113 (10%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATI  72
            +R +A+ +LER+A    +L ++ K ++ V  L E  P DG++       LG+N N+G  I
Sbjct  143  DRHRAREILERLANDRGILAVMDKHKWTVGTLAEMHP-DGKVGVDPVCVLGLNQNKGQKI  201

Query  73   YIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL  125
             +RLR       F  Y ++ + + HELTH VH  H+  FY  + ++++E   L
Sbjct  202  LLRLRTDDL-LGFRKYLSVKKVLFHELTHNVHSEHDSKFYTLMRQVEKECGEL  253

>SPRG_09603
Length=467

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 63/122 (52%), Gaps = 11/122 (9%)

Query  13   DVRALVRRPEREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LG  63
            +++ L   P+  +A  +L  +A    +L +++K ++ V  L E +P DG++       LG
Sbjct  121  EIQTLPGLPDEARATAILTSLAQDKGILHVMAKHKWSVGALAEMYP-DGKVGVDPVCVLG  179

Query  64   MNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEME  123
            +N N+G  I +RLR       F  Y  + + + HELTH     HN  FY+ + +++ E  
Sbjct  180  LNENKGQRILLRLR-TDDLQGFRKYLTIKKVLYHELTHNDVSDHNNEFYQLMRQVEAECN  238

Query  124  SL  125
            ++
Sbjct  239  TV  240

>PYAR_14105
Length=494

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 69/150 (46%), Gaps = 41/150 (27%)

Query  26   AQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATIYIRL  76
            A+ +LE++A    +L +++K ++ V CL E +P DG++       LG+N N+G  I +RL
Sbjct  148  ARSILEQLANDRGILAVMAKHKWSVGCLAEMYP-DGKVGVDPVCVLGLNQNKGQKILLRL  206

Query  77   RPA--------------------------SRPTSFFPYEALLETMLHELTHMVHGPHNQA  110
            R                            SR    F Y ++ + + HEL+H VH  H+  
Sbjct  207  RTDDLQGFRKFLKYAIFAERFLYPRFSKHSRSRFAFGY-SIKKVLFHELSHNVHSEHDSQ  265

Query  111  FYKYLDELKEEMESLMTRG----LVGHEGA  136
            FY+ +  ++ E + L         VG EG+
Sbjct  266  FYQLMRLVERECDELDWSNSGGRAVGGEGS  295

>PHYRA_74151
Length=1127

 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 61/111 (55%), Gaps = 11/111 (10%)

Query  24   EQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATIYI  74
            ++A+ +L+++A    +L ++ K ++ V  L E  P DG++       LG+N N+G  I +
Sbjct  155  DKAREILDKLANDRGILAVMDKHKWSVGVLAEM-PPDGKVGVDPVCVLGLNQNKGQKILL  213

Query  75   RLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESL  125
            RLR       F  + ++   + HEL+H VH  H+  FY+ + ++++E   L
Sbjct  214  RLRTDDL-LGFRKFLSIKNVLFHELSHNVHSEHDSKFYQLMRQVEKECNEL  263

>PPTG_12717
Length=496

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 64/134 (48%), Gaps = 31/134 (23%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRR---FRVRCLREFF------------------PKD  58
            ++++AQ +LER+A    +L +++K +   F   C+                      P D
Sbjct  137  DKDKAQEILERLANDRGILAVMAKHKYVFFNSHCIYWTIWDADIVDGRWSVGVLAEMPPD  196

Query  59   GQL-------LGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAF  111
            G++       LG+N N+G  I +RLR       F  + ++ + + HEL+H VH  H+  F
Sbjct  197  GKVGVDPVCVLGLNQNKGQKILLRLRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDNKF  255

Query  112  YKYLDELKEEMESL  125
            Y+ + ++++E   L
Sbjct  256  YQLMRQVEKECNEL  269

>PYVX_17526
Length=521

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 66/135 (49%), Gaps = 25/135 (19%)

Query  14   VRALVRRPEREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGM  64
            +  L +  + ++A+ +L ++A    +L ++ K ++ V  L E +P DG++       LG+
Sbjct  141  IEVLEKFSDADKARDILNQLANDRGILAVMEKHKWSVGVLAEMYP-DGKVGVDPVCVLGL  199

Query  65   NVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTH--------------MVHGPHNQA  110
            N N+G  I +RLR       F  Y ++ + + HEL+H               VH  H+  
Sbjct  200  NQNKGQKILLRLR-TDDLLGFRKYLSIKKVLFHELSHNNSDRNQINAMLMVQVHSEHDSK  258

Query  111  FYKYLDELKEEMESL  125
            FY+ + +++ E + L
Sbjct  259  FYQLMRQVERECDEL  273

>PHYKE_6259
Length=230

 Score = 35.4 bits (80),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 10/65 (15%)

Query  22   EREQAQRLLERIAAQ--VLPILSKRRFRVRCLREFFPKDGQL-------LGMNVNRGATI  72
            + ++A+ +LE++A    +L +++K ++ V  L E  P DG++       LG+N N+G  I
Sbjct  134  DADKAREILEKLANDRGILAVMAKYKWSVGVLAEM-PPDGKVGVDPVCVLGLNQNKGQKI  192

Query  73   YIRLR  77
             +RLR
Sbjct  193  LLRLR  197

>PITG_06902
Length=2016

 Score = 32.3 bits (72),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (45%), Gaps = 3/85 (4%)

Query  18   VRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNVNRGATIYIRLR  77
            +R+       RLL R+    +  +SK +     L + F       G NVN  AT+     
Sbjct  737  IRKAAASGVLRLLSRVHPSCVDWISKHK---DILDDPFGGRFDYGGKNVNLEATLMETPL  793

Query  78   PASRPTSFFPYEALLETMLHELTHM  102
            P SR + + P E  L + L +L+H+
Sbjct  794  PVSRASDYQPSENELSSQLSKLSHL  818

>PPTG_22392
Length=2692

 Score = 32.0 bits (71),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 58/129 (45%), Gaps = 17/129 (13%)

Query  2     APRTWMTFEIPDVRALVRRPERE----QAQRLLERIAAQVLPILSKRRFRVRCLREFFPK  57
             A   +++F +P   +     ERE    Q+Q L+ R+   +LP   +    V  LR FF K
Sbjct  937   AASVYLSFRLPP--SCYIEEERECKGCQSQALVYRL---ILPRSDQLSTHVWNLRVFFSK  991

Query  58    DGQLLGMNVNRGATIYIRLRPASRPTSF---FPYEALLETMLHELTHMVHGPHNQAFYKY  114
                 LG+ V R   I      ++ PT     FP    L+ +L + ++  +G    AFY  
Sbjct  992   ----LGIEV-RETKIRKADGRSTPPTKLHFAFPVAYALQCLLSDCSYFTNGFLPPAFYDV  1046

Query  115   LDELKEEME  123
             L EL E ++
Sbjct  1047  LTELDENVQ  1055

>PITG_01233
Length=721

 Score = 31.6 bits (70),  Expect = 2.5, Method: Composition-based stats.
 Identities = 20/65 (31%), Positives = 33/65 (51%), Gaps = 2/65 (3%)

Query  53   EFFPKDGQLLGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFY  112
            E  PK G++  MNVN G+  ++RL PA   T + P+ +++      L   +    N +F 
Sbjct  463  ESTPKTGKM-AMNVNPGSYFFVRL-PAVSATQWHPFSSVVTPDGKSLGFTIKAMGNGSFT  520

Query  113  KYLDE  117
            + L E
Sbjct  521  RKLLE  525

>SDRG_10849
Length=6323

 Score = 32.0 bits (71),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 26/57 (46%), Gaps = 5/57 (9%)

Query  127   TRGLVGHEGARF-----QDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREKMPLR  178
             TR LV    ARF      +AG      T +RV+A     D    +LAA R +K  LR
Sbjct  1280  TRHLVADVAARFVATVFANAGATMPTTTPTRVVAASIPRDGSRKILAANRIQKCALR  1336

>PPTG_09604
Length=2283

 Score = 31.2 bits (69),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 40/98 (41%), Gaps = 15/98 (15%)

Query  28   RLLERIAAQVLPILSKRRFRVRCLREFFPKDGQ-LLGMNVNRGATI-------YIRLRPA  79
            RLLE ++      L  R    RCL+ F  K+G+ +  M  N+G  +       +I LR  
Sbjct  586  RLLELLSVDSPSSLEMRVEAARCLKRFVQKNGENITEMTQNKGVALLCTLLGDFIELRAG  645

Query  80   SR-------PTSFFPYEALLETMLHELTHMVHGPHNQA  110
            S         T    +E  +E +L  +   +H   N A
Sbjct  646  SNLGNSGVEATRDESHEVAMEAILSTICECIHFADNGA  683

>PYAP_20728
Length=134

 Score = 30.0 bits (66),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 23/52 (44%), Gaps = 5/52 (10%)

Query  116  DELKEEMESLMTRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVL  167
            DE  EE  +L+        G  F D  +AY      RVIA    NDN + VL
Sbjct  34   DEKLEETHALLVHAF--KHGINFWDTAEAYGADAPERVIA---SNDNVSTVL  80

>SDRG_14490
Length=281

 Score = 30.0 bits (66),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 30/72 (42%), Gaps = 17/72 (24%)

Query  75   RLRPASRPTSFF-----------PYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEME  123
            +LR A R +SFF           P E  L+ + + +    HGP   A Y+ +        
Sbjct  57   KLRDAMRTSSFFERIRAVLLAHLPLETPLQLVAYGVGSFAHGPSGNAIYQLV------CA  110

Query  124  SLMTRGLVGHEG  135
            SL+   L GH+ 
Sbjct  111  SLLRELLAGHDA  122

>PYAR_13777
Length=568

 Score = 30.0 bits (66),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  86   FPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLMTRGLVGH  133
               +A  E+  HE+   V    N+    ++D+ ++ ME+ M R L  H
Sbjct  264  LALQAHRESARHEMKQEVEAQSNETIRAHVDDAEKRMEATMQRALNAH  311

Lambda      K        H        a         alpha
   0.324    0.136    0.397    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7175439843

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40