Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAP_228451005791351356861e-93
PYAR_23206111466001195153e-62
PYU1_G005962111466241364613e-54
PYIR_15178111466381384535e-53
PYIW_14754111466161364491e-52
PHYRA_81674111466161284412e-51
PPTG_09251111466411254361e-50
PHYCA_535379111466271214334e-50
PHALS_11563111466131334306e-50
PHYSO_315018111466361214301e-49
PITG_13738111466101184089e-47
PYVX_20858111466211293941e-44
SPRG_06313111465151353061e-32
SDRG_01805111465191342991e-31
H310_01471111465601342772e-28
CCA15905111466201512738e-28
H257_00314111465631122674e-27
H257_0875914194310722900.001
SDRG_0876214437110923830.008
H310_002841750599423820.033
PHYKE_58421114555019820.040
H310_0578912561522324800.046
SPRG_0700212561517023800.046
H257_1353214437113621770.084
PHALS_099081294449921780.11
H257_123931476120821770.12
PHYRA_934171294433221770.14
H310_0634614437113921760.14
PYU1_G0094341294416321760.14
SDRG_077321476115923760.15
H257_0818414171617325760.17
SDRG_1096117505100523760.21
PPTG_096291294419121750.22
SPRG_0219917505100723760.22
PYIR_132501294421421750.22
PYIW_194741294422421750.26
CCA26132588126629740.35
PYAR_205201494937426740.37
PPTG_040051001064345740.38
H257_0679117505102921740.47
SPRG_005271476116423720.47
SPRG_019821294417521720.48
SDRG_083541294417421720.49
H310_012051294418621720.50
H257_006051294418621720.53
PYAP_1892717505108479730.53
SDRG_103881529262921730.61
H310_019802147929720.70
PPTG_095471494939123720.71
CCI45212588126730720.72
H310_1309112574866221720.73
H310_0652714332124373710.76
H310_051271476120621710.79
PITG_2285717505103628710.92
PITG_187511494933043710.94
PPTG_1928517505111528710.96
HYAP_05343588129625711.0
SDRG_0958012561516123701.0
PHYSO_31799617505105728711.0
H310_0880214171519021701.0
PYVX_173221494938523711.1
PHYSO_4540285596384028711.1
PHYCA_341021750552628711.1
PHYRA_7959417505106828711.1
SPRG_157361529262223711.2
PYIW_23779419734635701.2
PYVX_167341463327722701.3
PYU1_G0049761463317229691.4
PYU1_G010079959999238671.4
PYVX_21690588130225691.5
PHALS_089911494940023691.6
SDRG_115171494935623691.7
CCI50606419729747691.8
PYAR_175901750598057691.8
PYAR_13176827462123691.9
SPRG_001221494935523682.0
PHYRA_810911476121223682.2
PITG_184621476122052682.2
PYU1_G00001817505114437692.3
PYIR_1728317505110937682.3
PYAP_211081294423720682.3
PHALS_072411476129021682.4
PHYSO_5539321476123352672.5
PHALS_01600238447021682.6
PHYCA_110463238446721682.7
PPTG_171321476128821672.7
PYAP_207831463319624672.8
PHYKE_73331494937623673.0
PYAP_151459841538163673.1
H257_10380713424755673.1
PYAR_25212335330723673.2
PYAP_174261494936923673.2
PYAP_1919015084124849673.3
PYVX_180305781166524673.3
PYU1_G008514244353158673.3
CCA1402315176239626673.3
PITG_000252153538673.5
PHYCA_5309151476118621663.6
PYIR_185711494940323673.6
PHYCA_1049121494934723673.6
H257_0603812574868421673.7
PPTG_166532161738673.8
PHYKE_83961476116021653.9
H257_0818314171519321663.9
PHYSO_4989501136542450663.9
SDRG_0425412574850621664.0
PHYSO_2884111494918723664.0
PYAR_21118238441421664.2
PYAR_20706244353066664.3
H310_041401494936823664.3
H310_14008482634243664.4
SPRG_0474612444874542664.4
H310_1257115060478423664.6
PYAR_2014010387928423664.6
PHYCA_1046322156938664.8
PYIW_208531494922423654.9
SPRG_028712142223655.1
PYIW_131281077742570655.2
SDRG_131372142423655.2
PYIR_14154156461724665.3
PYAR_187141343298435665.3
SPRG_0729612574850521655.4
HYAP_071061476129121655.9
PYIW_229991463321922646.2
PHALS_0895717505106621656.3
CCI3999815176239626656.3
H257_1154214332124422646.4
H310_1000914105597221656.4
PPTG_176842400937442656.5
CCI451201476127021646.5
PYU1_G0090581494938923656.6
H257_034562150123656.6
PYIW_13425481025774646.7
PYAP_13371244348255656.8
PYIR_22040244345723656.8
PYVX_24209238451321647.1
H257_16246238441939647.2
PYVX_1640217505158828657.2
CCA1718342571070480657.6
PHALS_10597923056282647.6
PYU1_G0017301476135821647.6
H310_0469812627418821637.7
PYIR_25281419735634647.9
PYAR_204571463313322628.0
PYIW_146641476142621648.0
SDRG_159191771556137648.3
CCA26695419729734648.3
CCA2347915583329734648.3
PYIW_23387156459124648.5
CCA188951476127421639.1
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAP_22845

Length=135
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYAP_22845                                                            268     1e-93
PYAR_23206                                                            202     3e-62
PYU1_G005962                                                          182     3e-54
PYIR_15178                                                            179     5e-53
PYIW_14754                                                            177     1e-52
PHYRA_81674                                                           174     2e-51
PPTG_09251                                                            172     1e-50
PHYCA_535379                                                          171     4e-50
PHALS_11563                                                           170     6e-50
PHYSO_315018                                                          170     1e-49
PITG_13738                                                            161     9e-47
PYVX_20858                                                            156     1e-44
SPRG_06313                                                            122     1e-32
SDRG_01805                                                            119     1e-31
H310_01471                                                            111     2e-28
CCA15905                                                              109     8e-28
H257_00314                                                            107     4e-27
H257_08759                                                            39.3    0.001
SDRG_08762                                                            36.6    0.008
H310_00284                                                            36.2    0.033
PHYKE_5842                                                            36.2    0.040
H310_05789                                                            35.4    0.046
SPRG_07002                                                            35.4    0.046
H257_13532                                                            34.3    0.084
PHALS_09908                                                           34.7    0.11 
H257_12393                                                            34.3    0.12 
PHYRA_93417                                                           34.3    0.14 
H310_06346                                                            33.9    0.14 
PYU1_G009434                                                          33.9    0.14 
SDRG_07732                                                            33.9    0.15 
H257_08184                                                            33.9    0.17 
SDRG_10961                                                            33.9    0.21 
PPTG_09629                                                            33.5    0.22 
SPRG_02199                                                            33.9    0.22 
PYIR_13250                                                            33.5    0.22 
PYIW_19474                                                            33.5    0.26 
CCA26132                                                              33.1    0.35 
PYAR_20520                                                            33.1    0.37 
PPTG_04005                                                            33.1    0.38 
H257_06791                                                            33.1    0.47 
SPRG_00527                                                            32.3    0.47 
SPRG_01982                                                            32.3    0.48 
SDRG_08354                                                            32.3    0.49 
H310_01205                                                            32.3    0.50 
H257_00605                                                            32.3    0.53 
PYAP_18927                                                            32.7    0.53 
SDRG_10388                                                            32.7    0.61 
H310_01980                                                            32.3    0.70 
PPTG_09547                                                            32.3    0.71 
CCI45212                                                              32.3    0.72 
H310_13091                                                            32.3    0.73 
H310_06527                                                            32.0    0.76 
H310_05127                                                            32.0    0.79 
PITG_22857                                                            32.0    0.92 
PITG_18751                                                            32.0    0.94 
PPTG_19285                                                            32.0    0.96 
HYAP_05343                                                            32.0    1.0  
SDRG_09580                                                            31.6    1.0  
PHYSO_317996                                                          32.0    1.0  
H310_08802                                                            31.6    1.0  
PYVX_17322                                                            32.0    1.1  
PHYSO_454028                                                          32.0    1.1  
PHYCA_34102                                                           32.0    1.1  
PHYRA_79594                                                           32.0    1.1  
SPRG_15736                                                            32.0    1.2  
PYIW_23779                                                            31.6    1.2  
PYVX_16734                                                            31.6    1.3  
PYU1_G004976                                                          31.2    1.4  
PYU1_G010079                                                          30.4    1.4  
PYVX_21690                                                            31.2    1.5  
PHALS_08991                                                           31.2    1.6  
SDRG_11517                                                            31.2    1.7  
CCI50606                                                              31.2    1.8  
PYAR_17590                                                            31.2    1.8  
PYAR_13176                                                            31.2    1.9  
SPRG_00122                                                            30.8    2.0  
PHYRA_81091                                                           30.8    2.2  
PITG_18462                                                            30.8    2.2  
PYU1_G000018                                                          31.2    2.3  
PYIR_17283                                                            30.8    2.3  
PYAP_21108                                                            30.8    2.3  
PHALS_07241                                                           30.8    2.4  
PHYSO_553932                                                          30.4    2.5  
PHALS_01600                                                           30.8    2.6  
PHYCA_110463                                                          30.8    2.7  
PPTG_17132                                                            30.4    2.7  
PYAP_20783                                                            30.4    2.8  
PHYKE_7333                                                            30.4    3.0  
PYAP_15145                                                            30.4    3.1  
H257_10380                                                            30.4    3.1  
PYAR_25212                                                            30.4    3.2  
PYAP_17426                                                            30.4    3.2  
PYAP_19190                                                            30.4    3.3  
PYVX_18030                                                            30.4    3.3  
PYU1_G008514                                                          30.4    3.3  
CCA14023                                                              30.4    3.3  
PITG_00025                                                            30.4    3.5  
PHYCA_530915                                                          30.0    3.6  
PYIR_18571                                                            30.4    3.6  
PHYCA_104912                                                          30.4    3.6  
H257_06038                                                            30.4    3.7  
PPTG_16653                                                            30.4    3.8  
PHYKE_8396                                                            29.6    3.9  
H257_08183                                                            30.0    3.9  
PHYSO_498950                                                          30.0    3.9  
SDRG_04254                                                            30.0    4.0  
PHYSO_288411                                                          30.0    4.0  
PYAR_21118                                                            30.0    4.2  
PYAR_20706                                                            30.0    4.3  
H310_04140                                                            30.0    4.3  
H310_14008                                                            30.0    4.4  
SPRG_04746                                                            30.0    4.4  
H310_12571                                                            30.0    4.6  
PYAR_20140                                                            30.0    4.6  
PHYCA_104632                                                          30.0    4.8  
PYIW_20853                                                            29.6    4.9  
SPRG_02871                                                            29.6    5.1  
PYIW_13128                                                            29.6    5.2  
SDRG_13137                                                            29.6    5.2  
PYIR_14154                                                            30.0    5.3  
PYAR_18714                                                            30.0    5.3  
SPRG_07296                                                            29.6    5.4  
HYAP_07106                                                            29.6    5.9  
PYIW_22999                                                            29.3    6.2  
PHALS_08957                                                           29.6    6.3  
CCI39998                                                              29.6    6.3  
H257_11542                                                            29.3    6.4  
H310_10009                                                            29.6    6.4  
PPTG_17684                                                            29.6    6.5  
CCI45120                                                              29.3    6.5  
PYU1_G009058                                                          29.6    6.6  
H257_03456                                                            29.6    6.6  
PYIW_13425                                                            29.3    6.7  
PYAP_13371                                                            29.6    6.8  
PYIR_22040                                                            29.6    6.8  
PYVX_24209                                                            29.3    7.1  
H257_16246                                                            29.3    7.2  
PYVX_16402                                                            29.6    7.2  
CCA17183                                                              29.6    7.6  
PHALS_10597                                                           29.3    7.6  
PYU1_G001730                                                          29.3    7.6  
H310_04698                                                            28.9    7.7  
PYIR_25281                                                            29.3    7.9  
PYAR_20457                                                            28.5    8.0  
PYIW_14664                                                            29.3    8.0  
SDRG_15919                                                            29.3    8.3  
CCA26695                                                              29.3    8.3  
CCA23479                                                              29.3    8.3  
PYIW_23387                                                            29.3    8.5  
CCA18895                                                              28.9    9.1  

>PYAP_22845
Length=135

 Score = 268 bits (686),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%), Gaps = 0/135 (0%)

Query  1    MRNNGSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPT  60
            MRNNGSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAHHHGKKKKNAPT
Sbjct  1    MRNNGSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAHHHGKKKKNAPT  60

Query  61   RTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSF  120
            RTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSF
Sbjct  61   RTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSF  120

Query  121  RAPKITRCGHIFCIE  135
            RAPKITRCGHIFCIE
Sbjct  121  RAPKITRCGHIFCIE  135

>PYAR_23206
Length=600

 Score = 202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 104/119 (87%), Gaps = 3/119 (3%)

Query  17   YIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQMEYLHANYRFVIA  76
            YIEY+GGRMTRNGLSANHLLNF+LPEREK       KK   A  RTQMEYLHANYRFVIA
Sbjct  5    YIEYDGGRMTRNGLSANHLLNFTLPEREKYAPQGKKKKA--ASVRTQMEYLHANYRFVIA  62

Query  77   PLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHIF-CI  134
            PL++D AV+CWD+ETLTEWKSVEQVLLWYDE SPATCPICLDSFRAPKITRCGHIF C+
Sbjct  63   PLSNDDAVACWDIETLTEWKSVEQVLLWYDESSPATCPICLDSFRAPKITRCGHIFWCV  121

>PYU1_G005962
Length=624

 Score = 182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 107/136 (79%), Gaps = 7/136 (5%)

Query  2    RNNGSRRGGSKKERDYI----EYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkN  57
            RNNG  R  S+K++ ++    +YE     RNG+SANHLLNFSLPEREKQ    + KKKKN
Sbjct  3    RNNGFGRRSSRKDQLHLNRTLDYEIRTGGRNGVSANHLLNFSLPEREKQ---VYVKKKKN  59

Query  58   APTRTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICL  117
            AP RTQ EYLHANYRFV+APL++D     WD+E LTEWK+VEQVLLWYDE SPA+CPICL
Sbjct  60   APMRTQNEYLHANYRFVVAPLSNDANTPFWDMEALTEWKNVEQVLLWYDEASPASCPICL  119

Query  118  DSFRAPKITRCGHIFC  133
            D FRAPKIT+CGHIFC
Sbjct  120  DDFRAPKITKCGHIFC  135

>PYIR_15178
Length=638

 Score = 179 bits (453),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 107/138 (78%), Gaps = 8/138 (6%)

Query  2    RNNGSRRGGSKKERDY----IEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkN  57
            +NNGS R GS+K++ +    ++YE  R TRNG+SANHLLNFSLPEREKQ      KKKK 
Sbjct  3    KNNGSGRRGSRKDQVHMNRALDYEI-RSTRNGVSANHLLNFSLPEREKQ---VFTKKKKA  58

Query  58   APTRTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICL  117
             PTRTQ E+LHAN+RFVIAPL DD +   WD+E LTEW SVEQVLLWYDE SP +CPICL
Sbjct  59   GPTRTQNEFLHANFRFVIAPLEDDASTPFWDMEALTEWTSVEQVLLWYDEASPMSCPICL  118

Query  118  DSFRAPKITRCGHIFCIE  135
            D FRAPKIT+CGHIF  E
Sbjct  119  DDFRAPKITKCGHIFWCE  136

>PYIW_14754
Length=616

 Score = 177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 105/136 (77%), Gaps = 7/136 (5%)

Query  2    RNNGSRRGGSKKERDY----IEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkN  57
            +NNGS R GS+K++ +    +++E  R TRNG+SANHLLNFSLPEREKQQ     KK  +
Sbjct  3    KNNGSGRRGSRKDQMHMNRALDHEI-RSTRNGVSANHLLNFSLPEREKQQVFAKKKK--S  59

Query  58   APTRTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICL  117
             P RTQ E+L AN+RFV+APL DD     WD+E LTEWK+VEQVLLW+DE SP +CPICL
Sbjct  60   GPMRTQNEFLQANFRFVVAPLEDDVNTPVWDMEALTEWKNVEQVLLWHDEASPMSCPICL  119

Query  118  DSFRAPKITRCGHIFC  133
            D FRAPKIT+CGHIFC
Sbjct  120  DDFRAPKITKCGHIFC  135

>PHYRA_81674
Length=616

 Score = 174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 103/128 (80%), Gaps = 2/128 (2%)

Query  6    SRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQME  65
            +RRG  ++++  ++YE  R+TRNG+SANHLLNF+LPERE+   HH  KKK +AP RTQ E
Sbjct  15   ARRGPRREQKKNMDYEE-RVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAP-RTQSE  72

Query  66   YLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKI  125
            YLHANYRFVI+PL  D  V  WD+E LTEW SVEQVLLWYD  SP TCPIC+D+FRAPKI
Sbjct  73   YLHANYRFVISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKI  132

Query  126  TRCGHIFC  133
            T+CGHIFC
Sbjct  133  TKCGHIFC  140

>PPTG_09251
Length=641

 Score = 172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 97/125 (78%), Gaps = 5/125 (4%)

Query  9    GGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQMEYLH  68
            G  KK  DY      R+TRNG+SANHLLNFS+PERE+   HH  KKK +AP RTQ EYLH
Sbjct  42   GLQKKTMDY----EARVTRNGVSANHLLNFSMPERERHVYHHQKKKKSSAP-RTQSEYLH  96

Query  69   ANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRC  128
            ANYRFVIAPL  DT V  WD+E LTEW SVEQ+LLWYD  SP TCPIC+D+FRAPKIT+C
Sbjct  97   ANYRFVIAPLDHDTIVPTWDLEALTEWSSVEQILLWYDVESPQTCPICMDTFRAPKITKC  156

Query  129  GHIFC  133
            GHIFC
Sbjct  157  GHIFC  161

>PHYCA_535379
Length=627

 Score = 171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 2/121 (2%)

Query  13   KERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQMEYLHANYR  72
            +++  ++YE  R TRNG+SANHLLNFS+PEREK   HH  KKK +AP RTQ+EYLHANYR
Sbjct  22   EQKKTMDYEA-RATRNGVSANHLLNFSMPEREKTVYHHQKKKKSSAP-RTQIEYLHANYR  79

Query  73   FVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHIF  132
            FVIAPL  D  V  WD+E LTEW SVEQVLLWYD  SP TCPIC+D+FRAPKIT+CGH+F
Sbjct  80   FVIAPLDPDAVVPTWDLEALTEWSSVEQVLLWYDIESPQTCPICMDTFRAPKITKCGHVF  139

Query  133  C  133
            C
Sbjct  140  C  140

>PHALS_11563
Length=613

 Score = 170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 101/133 (76%), Gaps = 1/133 (1%)

Query  1    MRNNGSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPT  60
            + N G  R G ++E++       R+TRNG+SANHLLNFSLPERE    +HH KKK +AP 
Sbjct  9    ISNGGPDRRGPRREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLAKYHHKKKKSSAP-  67

Query  61   RTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSF  120
            RTQ+EYLHANYRFVIAPL  +  V  WDVE+LTEW  VEQVLLWYD  +P TCPIC+DSF
Sbjct  68   RTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSF  127

Query  121  RAPKITRCGHIFC  133
            R PKIT+CGHIFC
Sbjct  128  RVPKITKCGHIFC  140

>PHYSO_315018
Length=636

 Score = 170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 2/121 (2%)

Query  13   KERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQMEYLHANYR  72
            +++  ++YE  R+TRNG+SANHLLNFS+PERE+   HH  KKK +AP RTQ EYLHANYR
Sbjct  22   EQKKNMDYEA-RVTRNGVSANHLLNFSMPERERHVHHHQKKKKSSAP-RTQSEYLHANYR  79

Query  73   FVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHIF  132
            FVIAPL  D  V  WD+E LTEW SVEQVLLWYD  SP TCPIC+D+FRAPKIT+CGHIF
Sbjct  80   FVIAPLDPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIF  139

Query  133  C  133
            C
Sbjct  140  C  140

>PITG_13738
Length=610

 Score = 161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 2/118 (2%)

Query  12   KKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQMEYLHANY  71
            ++++  ++YE  R+TRNG+SANHLLNFS+PERE+Q  HH  K K + P RTQ EYLHANY
Sbjct  22   REQKKNMDYEA-RVTRNGVSANHLLNFSMPERERQVHHHQKKTKSSTP-RTQSEYLHANY  79

Query  72   RFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCG  129
            RFVIAPL  DT V  WD+E LTEW SVEQVLLWYD  SP TCPIC+D+FRAPKIT+CG
Sbjct  80   RFVIAPLDRDTIVPTWDLEALTEWSSVEQVLLWYDVGSPQTCPICMDTFRAPKITKCG  137

>PYVX_20858
Length=621

 Score = 156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query  5    GSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQM  64
            G RR    + +  ++++  R +RNG+SANHLLNF+LPEREK       KKK +   RTQ 
Sbjct  30   GPRREQVDRAKKNLDFDA-RSSRNGVSANHLLNFTLPEREK--PTFARKKKTHVQPRTQS  86

Query  65   EYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPK  124
            E+LHAN+RFVI+ L D TAV   D+E LTEW SVEQVLLWYD+ SP TCPIC+D+FRAPK
Sbjct  87   EFLHANFRFVISQLEDRTAVPLGDLEALTEWTSVEQVLLWYDDDSPMTCPICMDNFRAPK  146

Query  125  ITRCGHIFC  133
            IT+CGHIFC
Sbjct  147  ITKCGHIFC  155

>SPRG_06313
Length=515

 Score = 122 bits (306),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 88/135 (65%), Gaps = 11/135 (8%)

Query  4    NGSRRGGSKKERDYIEYEGG--RMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTR  61
             G RR G+K      E  GG  R  + G+SANHLLNFSLPERE++      KK    P R
Sbjct  20   KGQRRRGAKP---VPEPRGGDRRKRQGGVSANHLLNFSLPEREEKAVAMRKKKA--PPPR  74

Query  62   TQMEYLHANYRFVIAPLTDDTAVSC-WDVETLTEWKSVEQVLLWYDELSPAT--CPICLD  118
            T+ E+LHANYRFVIAPL  + A +  +D E LT W +VEQV++  +E S A   CPICLD
Sbjct  75   TRDEFLHANYRFVIAPLASEKAANVLFDPEALTAWDNVEQVIV-TNEQSEADRRCPICLD  133

Query  119  SFRAPKITRCGHIFC  133
            + RAPKITRCGH FC
Sbjct  134  TLRAPKITRCGHTFC  148

>SDRG_01805
Length=519

 Score = 119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 86/134 (64%), Gaps = 9/134 (7%)

Query  4    NGSRRGGSKKERDYIEYEGG--RMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTR  61
             G RR G+K      E  GG  R  + G+SANHLLNFSLPERE++      KK    P R
Sbjct  23   KGQRRRGAKP---VPEPRGGDRRKRQGGVSANHLLNFSLPEREEKAVAMRKKKA--PPPR  77

Query  62   TQMEYLHANYRFVIAPLTDDTAVSC-WDVETLTEWKSVEQVLLWYDEL-SPATCPICLDS  119
            T+ E+LHANYRFV+APL  + A +  +D E L  W +VEQV++  ++  +   CPICLD+
Sbjct  78   TRDEFLHANYRFVVAPLASEKAANVLFDPEALAAWDNVEQVIVNNEQAEADRRCPICLDT  137

Query  120  FRAPKITRCGHIFC  133
             RAPKITRCGH FC
Sbjct  138  LRAPKITRCGHTFC  151

>H310_01471
Length=560

 Score = 111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 14/134 (10%)

Query  1    MRNNGSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPT  60
            M+ N  R GGS + +             G  ANHLLNFSLP R         +KKK  P 
Sbjct  20   MKGN-KRHGGSDRRKS-----------KGSVANHLLNFSLPVR-NNDPPSFVRKKKGPPP  66

Query  61   RTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELS-PATCPICLDS  119
            RT+ E+LHANYRFVI+PL+ + + + +D++ LTEW  +EQV++  D  +    CPICLD+
Sbjct  67   RTRDEFLHANYRFVISPLSANESPTLYDLDALTEWDKIEQVIVANDATNIDQRCPICLDT  126

Query  120  FRAPKITRCGHIFC  133
             RAPKITRCGH +C
Sbjct  127  LRAPKITRCGHAYC  140

>CCA15905
Length=620

 Score = 109 bits (273),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 82/151 (54%), Gaps = 22/151 (15%)

Query  1    MRNNGSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNA-P  59
            M     R+   ++ER+    E  R TR G+ AN+LLNFSLPER  Q + H G+  K A  
Sbjct  10   MSTRTGRKNTQRRERNDFNQEKSRWTRRGVPANYLLNFSLPER--QNSFHAGRYGKKALV  67

Query  60   TRTQMEYLHANY-----------------RFVIAPLTDDTAVSCWDVETLTEWKSVEQVL  102
            TRTQ E+LHA Y                 RF+I  L  D +     +E L EWK+VEQV 
Sbjct  68   TRTQKEFLHAKYTKRTSQHMIVIKFLCSFRFIIGALRRDESHRL--LEDLVEWKNVEQVK  125

Query  103  LWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            +W     P  CPICLD FR P+ TRCGHIFC
Sbjct  126  VWQKAKFPMQCPICLDEFRLPRTTRCGHIFC  156

>H257_00314
Length=563

 Score = 107 bits (267),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 3/112 (3%)

Query  24   RMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQMEYLHANYRFVIAPLTDDTA  83
            R    G  ANHLLNFS P R         +KKK  P RT+ E+LHAN+RFVI+PL  + +
Sbjct  31   RRKGKGSVANHLLNFSRPVRN-NDTTSFVRKKKGPPPRTRDEFLHANFRFVISPLAANES  89

Query  84   VSCWDVETLTEWKSVEQVLLWYDELSPAT--CPICLDSFRAPKITRCGHIFC  133
             + +D + LTEW  +EQV++ +D    A   CPICLD+ RAPKITRCGH +C
Sbjct  90   RALYDPDALTEWDKIEQVIVAHDATVDADHRCPICLDTLRAPKITRCGHAYC  141

>H257_08759
Length=107

 Score = 39.3 bits (90),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (73%), Gaps = 0/22 (0%)

Query  112  TCPICLDSFRAPKITRCGHIFC  133
            TCP+CLD    P  TRCGHIFC
Sbjct  48   TCPVCLDPILHPIATRCGHIFC  69

>SDRG_08762
Length=109

 Score = 36.6 bits (83),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            CP+CLD+   P  T+CGH+FC E
Sbjct  57   CPVCLDAVCKPVATKCGHVFCDE  79

>H310_00284
Length=994

 Score = 36.2 bits (82),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            CP+CLD   AP +T CGH+ C E
Sbjct  749  CPVCLDVPTAPVLTPCGHLMCKE  771

>PHYKE_5842
Length=550

 Score = 36.2 bits (82),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  97   SVEQVLLWYDELSPATCPI  115
            SVEQVLLWYD+ S  TCPI
Sbjct  26   SVEQVLLWYDDESQQTCPI  44

>H310_05789
Length=223

 Score = 35.4 bits (80),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  112  TCPICLDSFRAPKITRCGHIFCIE  135
            TC ICLD+ R    T CGHIFC E
Sbjct  171  TCAICLDTLRDLTSTSCGHIFCRE  194

>SPRG_07002
Length=170

 Score = 35.4 bits (80),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  111  ATCPICLDSFRAPKITRCGHIFC  133
            A CPICLD F     T CGH+FC
Sbjct  119  AFCPICLDEFNELASTSCGHLFC  141

>H257_13532
Length=136

 Score = 34.3 bits (77),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD+ + P  T CGHI+C
Sbjct  84   CAICLDAVQVPTATTCGHIYC  104

>PHALS_09908
Length=499

 Score = 34.7 bits (78),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD+  +P +T CGH++C
Sbjct  332  CNICLDTVSSPVVTLCGHLYC  352

>H257_12393
Length=208

 Score = 34.3 bits (77),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CP+CLD+  +   TRCGH++C
Sbjct  157  CPLCLDTMVSITSTRCGHVYC  177

>PHYRA_93417
Length=332

 Score = 34.3 bits (77),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C +CLD+  +P +T CGH++C
Sbjct  25   CNVCLDTVSSPVVTLCGHLYC  45

>H310_06346
Length=139

 Score = 33.9 bits (76),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C +CLD+ + P  T CGHI+C
Sbjct  87   CAVCLDAVQVPTATTCGHIYC  107

>PYU1_G009434
Length=163

 Score = 33.9 bits (76),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD+  +P +T CGH++C
Sbjct  25   CNICLDTVSSPVVTLCGHLYC  45

>SDRG_07732
Length=159

 Score = 33.9 bits (76),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            CP+CLD ++    T CGH+FC E
Sbjct  108  CPLCLDPYQEMASTTCGHVFCKE  130

>H257_08184
Length=173

 Score = 33.9 bits (76),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  109  SPATCPICLDSFRAPKITRCGHIFC  133
            S   C IC D+F  P +T CGH FC
Sbjct  7    SAVECAICYDTFYFPFVTSCGHAFC  31

>SDRG_10961
Length=1005

 Score = 33.9 bits (76),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            CP+CLD  ++P +T C H+ C E
Sbjct  765  CPVCLDVPQSPVLTPCAHLLCHE  787

>PPTG_09629
Length=191

 Score = 33.5 bits (75),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD+  +P +T CGH++C
Sbjct  24   CNICLDTVSSPVVTLCGHLYC  44

>SPRG_02199
Length=1007

 Score = 33.9 bits (76),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            CP+CLD  ++P +T C H+ C E
Sbjct  767  CPVCLDVPQSPVLTPCAHLLCHE  789

>PYIR_13250
Length=214

 Score = 33.5 bits (75),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD+  +P +T CGH++C
Sbjct  50   CNICLDTVSSPVVTLCGHLYC  70

>PYIW_19474
Length=224

 Score = 33.5 bits (75),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD+  +P +T CGH++C
Sbjct  56   CNICLDTVSSPVVTLCGHLYC  76

>CCA26132
Length=266

 Score = 33.1 bits (74),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 17/29 (59%), Gaps = 1/29 (3%)

Query  106  DELSPATCPICLDSFRAPKITR-CGHIFC  133
            D L    CPICL    A  +T+ CGHIFC
Sbjct  39   DILDNELCPICLQKLDAAVMTQNCGHIFC  67

>PYAR_20520
Length=374

 Score = 33.1 bits (74),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  110  PATCPICLDSFRAPKITRCGHIFCIE  135
            P  C +CL    +P  T CGH+FC E
Sbjct  317  PKKCALCLGERTSPATTPCGHVFCWE  342

>PPTG_04005
Length=643

 Score = 33.1 bits (74),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 4/45 (9%)

Query  93   TEWKSVEQVLLWYDELSPA----TCPICLDSFRAPKITRCGHIFC  133
            + W  +E    ++ +L+P      CPICL + + P    CGH+ C
Sbjct  68   STWDGLETAYNFHLQLAPVPQSIACPICLRATQFPVRQDCGHVLC  112

>H257_06791
Length=1029

 Score = 33.1 bits (74),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CP+CLD   AP +T C H+ C
Sbjct  782  CPVCLDVPVAPVLTPCAHLMC  802

>SPRG_00527
Length=164

 Score = 32.3 bits (72),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            CP+CLD +     T CGH++C E
Sbjct  113  CPLCLDPYEEMASTTCGHVYCKE  135

>SPRG_01982
Length=175

 Score = 32.3 bits (72),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD  + P +T CGH++C
Sbjct  10   CNICLDRVKEPVVTLCGHLYC  30

>SDRG_08354
Length=174

 Score = 32.3 bits (72),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD  + P +T CGH++C
Sbjct  10   CNICLDRVKEPVVTLCGHLYC  30

>H310_01205
Length=186

 Score = 32.3 bits (72),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD  + P +T CGH++C
Sbjct  40   CNICLDHVKEPVVTLCGHLYC  60

>H257_00605
Length=186

 Score = 32.3 bits (72),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD  + P +T CGH++C
Sbjct  25   CNICLDHVKEPVVTLCGHLYC  45

>PYAP_18927
Length=1084

 Score = 32.7 bits (73),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 34/79 (43%), Gaps = 7/79 (9%)

Query  61   RTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQ----VLLWYDE--LSPATCP  114
            R   E + A ++ + A L  DTA S  D       K+  Q    VL    E  L    CP
Sbjct  772  RQPGESVEAYFKRISAQLLKDTAGSA-DAREAAAPKATSQYIQNVLTQIQEEGLDAQECP  830

Query  115  ICLDSFRAPKITRCGHIFC  133
            +CLD  +   +T C H+ C
Sbjct  831  VCLDPPQNGVLTPCAHLLC  849

>SDRG_10388
Length=629

 Score = 32.7 bits (73),  Expect = 0.61, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CPICL  F +P    C H FC
Sbjct  170  CPICLYHFTSPVTLSCSHTFC  190

>H310_01980
Length=479

 Score = 32.3 bits (72),  Expect = 0.70, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 16/29 (55%), Gaps = 0/29 (0%)

Query  107  ELSPATCPICLDSFRAPKITRCGHIFCIE  135
            E+    C IC D+ + P   +C H+FC E
Sbjct  406  EMCTPDCSICYDTMQTPVQLQCAHLFCEE  434

>PPTG_09547
Length=391

 Score = 32.3 bits (72),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL    +P +T CGH+FC E
Sbjct  337  CALCLGERVSPAVTPCGHVFCWE  359

>CCI45212
Length=267

 Score = 32.3 bits (72),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 17/30 (57%), Gaps = 1/30 (3%)

Query  105  YDELSPATCPICLDSFRAPKITR-CGHIFC  133
            +D L    CPICL       +T+ CGHIFC
Sbjct  39   HDTLENELCPICLQKVDLAVMTQDCGHIFC  68

>H310_13091
Length=662

 Score = 32.3 bits (72),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CPICL+S   P    C HIFC
Sbjct  26   CPICLESVTVPYSLPCNHIFC  46

>H310_06527
Length=243

 Score = 32.0 bits (71),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 34/73 (47%), Gaps = 6/73 (8%)

Query  65   EYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSP----ATCPICLDSF  120
            E + A   F+++  T   A   + V T T  K+  +  + + +  P    +TCPICL   
Sbjct  10   EVVLAAIVFLVS--TAGLAFLVFHVFTPTYEKATPKAAVVHAKTRPRHANSTCPICLTDV  67

Query  121  RAPKITRCGHIFC  133
            R    T CGH FC
Sbjct  68   RLACETNCGHGFC  80

>H310_05127
Length=206

 Score = 32.0 bits (71),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CP+CLD+      T+CGH++C
Sbjct  155  CPLCLDTMVTITSTKCGHVYC  175

>PITG_22857
Length=1036

 Score = 32.0 bits (71),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  106  DELSPATCPICLDSFRAPKITRCGHIFC  133
            D L    CPICLD  +   +T C H+ C
Sbjct  764  DGLDSQECPICLDPPQNAVLTPCAHVLC  791

>PITG_18751
Length=330

 Score = 32.0 bits (71),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 22/43 (51%), Gaps = 0/43 (0%)

Query  93   TEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHIFCIE  135
            T +   E+V     + S   C +CL    +P +T CGH+FC E
Sbjct  256  TPFSCSERVPTSLSQQSRRKCALCLGERVSPAVTPCGHVFCWE  298

>PPTG_19285
Length=1115

 Score = 32.0 bits (71),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  106  DELSPATCPICLDSFRAPKITRCGHIFC  133
            D L    CPICLD  +   +T C H+ C
Sbjct  839  DGLDSQECPICLDPPQDAVLTPCAHVLC  866

>HYAP_05343
Length=296

 Score = 32.0 bits (71),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 1/25 (4%)

Query  112  TCPICLDSFRAPKITR-CGHIFCIE  135
            TCPICL++   P + + C H++C+E
Sbjct  67   TCPICLETLDDPVMVKVCYHVYCLE  91

>SDRG_09580
Length=161

 Score = 31.6 bits (70),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  111  ATCPICLDSFRAPKITRCGHIFC  133
            A C ICLD F     T CGH+FC
Sbjct  110  AFCSICLDEFTELASTSCGHLFC  132

>PHYSO_317996
Length=1057

 Score = 32.0 bits (71),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  106  DELSPATCPICLDSFRAPKITRCGHIFC  133
            D L    CPICLD  +   +T C H+ C
Sbjct  773  DGLESQECPICLDPPQNAVLTPCAHVLC  800

>H310_08802
Length=190

 Score = 31.6 bits (70),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CPIC D+   P  TRCGH +C
Sbjct  6    CPICYDACYDPVRTRCGHAYC  26

>PYVX_17322
Length=385

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL    AP  T CGH+FC E
Sbjct  331  CALCLGERVAPAATPCGHVFCWE  353

>PHYSO_454028
Length=840

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  106  DELSPATCPICLDSFRAPKITRCGHIFC  133
            D L    CPICLD  +   +T C H+ C
Sbjct  791  DGLESQECPICLDPPQNAVLTPCAHVLC  818

>PHYCA_34102
Length=526

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  106  DELSPATCPICLDSFRAPKITRCGHIFC  133
            D L    CPICLD  +   +T C H+ C
Sbjct  296  DGLESQECPICLDPPQNAVLTPCAHVLC  323

>PHYRA_79594
Length=1068

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  106  DELSPATCPICLDSFRAPKITRCGHIFC  133
            D L    CPICLD  +   +T C H+ C
Sbjct  788  DGLESQECPICLDPPQHAVLTPCAHVLC  815

>SPRG_15736
Length=622

 Score = 32.0 bits (71),  Expect = 1.2, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  111  ATCPICLDSFRAPKITRCGHIFC  133
            A+CPICL    +P    C H FC
Sbjct  168  ASCPICLYHLTSPVTLSCSHSFC  190

>PYIW_23779
Length=346

 Score = 31.6 bits (70),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (49%), Gaps = 0/35 (0%)

Query  99   EQVLLWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            +Q ++  D+     C IC   FR    T CGH FC
Sbjct  231  DQYVIKSDDEEQFACTICRGPFRNAIETICGHFFC  265

>PYVX_16734
Length=277

 Score = 31.6 bits (70),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 1/22 (5%)

Query  113  CPICLDSFRAPKI-TRCGHIFC  133
            CPICL++FR P + T CG  FC
Sbjct  12   CPICLETFREPMLATCCGQSFC  33

>PYU1_G004976
Length=172

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 2/29 (7%)

Query  107  ELSPATCPICLDSFRAPKI--TRCGHIFC  133
            + S   CPICLD+  AP +  T CG  FC
Sbjct  3    DCSVLVCPICLDTLAAPVVLSTCCGQSFC  31

>PYU1_G010079
Length=92

 Score = 30.4 bits (67),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 8/38 (21%)

Query  106  DELSPAT--------CPICLDSFRAPKITRCGHIFCIE  135
            D L+P +        CPICL S  AP    CGH+ C++
Sbjct  9    DALAPPSFQHASGFHCPICLRSELAPIRQDCGHVLCLQ  46

>PYVX_21690
Length=302

 Score = 31.2 bits (69),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%)

Query  112  TCPICLDSFRAPKITR-CGHIFCIE  135
            TCPICL +   P + R C H++C E
Sbjct  72   TCPICLQTLAEPVMVRDCYHVYCFE  96

>PHALS_08991
Length=400

 Score = 31.2 bits (69),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL   + P  T CGH+FC E
Sbjct  346  CSLCLGERKVPSATPCGHVFCWE  368

>SDRG_11517
Length=356

 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL     P +T CGH+FC E
Sbjct  303  CALCLTERSHPAMTPCGHVFCWE  325

>CCI50606
Length=297

 Score = 31.2 bits (69),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 23/47 (49%), Gaps = 5/47 (11%)

Query  92   LTEWKSVEQV-----LLWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            + + K +++V     L+  D+     C IC   F+    T CGHIFC
Sbjct  205  IIQGKKIDEVDENEYLISDDDDEQFACTICRQPFQNAVKTICGHIFC  251

>PYAR_17590
Length=980

 Score = 31.2 bits (69),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query  81   DTAVSCWDVETLTEWKSVEQVLLWYDE--LSPATCPICLDSFRAPKITRCGHIFCIE  135
            D A S  D    +++  V+ VL    E  +    CP+CLD  R   +T C H+ C +
Sbjct  671  DGASSTGDAPLSSQY--VQNVLTQIQEEGIDAQECPVCLDPPRCGVLTPCAHLLCAD  725

>PYAR_13176
Length=621

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            CPICL ++ AP    C H FC E
Sbjct  54   CPICLCAYTAPASLPCNHCFCEE  76

>SPRG_00122
Length=355

 Score = 30.8 bits (68),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL     P +T CGH+FC E
Sbjct  302  CALCLTERSHPAMTPCGHVFCWE  324

>PHYRA_81091
Length=212

 Score = 30.8 bits (68),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C ICLD       T CGHIFC +
Sbjct  161  CSICLDVLEDMTSTLCGHIFCAQ  183

>PITG_18462
Length=220

 Score = 30.8 bits (68),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 23/52 (44%), Gaps = 12/52 (23%)

Query  82   TAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            T +S  + ET+ E+K   +            C ICLD       T CGHIFC
Sbjct  150  TNISIQNSETVEEFKRRLK------------CSICLDVLEDMTSTLCGHIFC  189

>PYU1_G000018
Length=1144

 Score = 31.2 bits (69),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 19/37 (51%), Gaps = 1/37 (3%)

Query  98   VEQVLLWYDE-LSPATCPICLDSFRAPKITRCGHIFC  133
            +E VL   +E L    CP+CLD      +T C H+ C
Sbjct  831  IENVLAQVEEGLESHECPVCLDPPVRGVLTACAHVLC  867

>PYIR_17283
Length=1109

 Score = 30.8 bits (68),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 19/37 (51%), Gaps = 1/37 (3%)

Query  98   VEQVLLWYDE-LSPATCPICLDSFRAPKITRCGHIFC  133
            +E VL   +E L    CP+CLD      +T C H+ C
Sbjct  812  IENVLAQVEEGLESHECPVCLDPPVNGVLTACAHVLC  848

>PYAP_21108
Length=237

 Score = 30.8 bits (68),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 0/20 (0%)

Query  113  CPICLDSFRAPKITRCGHIF  132
            C ICLD+  +P +T CGH++
Sbjct  34   CNICLDAVTSPVVTLCGHLY  53

>PHALS_07241
Length=290

 Score = 30.8 bits (68),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD       T CGHIFC
Sbjct  239  CSICLDVLEDMTSTLCGHIFC  259

>PHYSO_553932
Length=233

 Score = 30.4 bits (67),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 24/52 (46%), Gaps = 12/52 (23%)

Query  82   TAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            T+VS  + E L ++K+  +            C ICLD       T CGHIFC
Sbjct  163  TSVSMHNNEQLEKFKAALK------------CSICLDVIEDITSTTCGHIFC  202

>PHALS_01600
Length=470

 Score = 30.8 bits (68),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CP+CLD F +     C H FC
Sbjct  270  CPVCLDYFNSSATLPCSHTFC  290

>PHYCA_110463
Length=467

 Score = 30.8 bits (68),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CP+CLD F +     C H FC
Sbjct  269  CPVCLDYFHSSATLPCSHTFC  289

>PPTG_17132
Length=288

 Score = 30.4 bits (67),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD       T CGHIFC
Sbjct  237  CSICLDVLEDMTSTLCGHIFC  257

>PYAP_20783
Length=196

 Score = 30.4 bits (67),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 1/24 (4%)

Query  113  CPICLDSFRAPKITR-CGHIFCIE  135
            CPICLD+   P +T  CG  FC E
Sbjct  25   CPICLDTLHEPMLTTCCGQSFCRE  48

>PHYKE_7333
Length=376

 Score = 30.4 bits (67),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL    +P  T CGH+FC E
Sbjct  322  CALCLGERVSPAATPCGHVFCWE  344

>PYAP_15145
Length=381

 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/63 (27%), Positives = 27/63 (43%), Gaps = 10/63 (16%)

Query  78   LTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPA----------TCPICLDSFRAPKITR  127
            L DD +  C D + L   +S   ++   DE+             TCP+CL      +++ 
Sbjct  73   LADDNSNQCDDSDNLMNAESRRAIMERADEIMRGKHQVGVQVGETCPVCLTDDVDTQLSN  132

Query  128  CGH  130
            CGH
Sbjct  133  CGH  135

>H257_10380
Length=247

 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 25/55 (45%), Gaps = 11/55 (20%)

Query  82   TAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLD----SFRAPKITRCGHIF  132
            T V C+ +   +  K V + +L         C ICL+    S  +P I RCGHI 
Sbjct  107  TCVGCYPISGQSTHKCVSEAML-------KECCICLEDMFNSRESPSILRCGHIL  154

>PYAR_25212
Length=307

 Score = 30.4 bits (67),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +C D  +   I++C H+FC E
Sbjct  254  CSVCQDRHKDVIISKCSHLFCKE  276

>PYAP_17426
Length=369

 Score = 30.4 bits (67),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL    +P  T CGH+FC E
Sbjct  315  CALCLGERISPATTPCGHVFCWE  337

>PYAP_19190
Length=1248

 Score = 30.4 bits (67),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 24/49 (49%), Gaps = 2/49 (4%)

Query  89   VETLTEWKSVEQVLLWYDE--LSPATCPICLDSFRAPKITRCGHIFCIE  135
            V  + E K +  V+   D+  LS  +C IC +    P    CGH+FC E
Sbjct  952  VRPVVEEKPLVSVVDEDDDNVLSDQSCVICHEDVEDPVEATCGHVFCRE  1000

>PYVX_18030
Length=665

 Score = 30.4 bits (67),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%)

Query  112  TCPICLDSFRAPKITRCGHIFCIE  135
            TCPICL ++  P    C H FC E
Sbjct  36   TCPICLCAYDNPTSLPCNHCFCEE  59

>PYU1_G008514
Length=531

 Score = 30.4 bits (67),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 3/58 (5%)

Query  78   LTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHIFCIE  135
            + DD A +  D   + EW+         D  +   C IC D F  P +  C H FC E
Sbjct  4    VGDDGAAAAED---MHEWEWPRHCAELRDIENLLRCQICGDFFHGPVLLPCSHAFCSE  58

>CCA14023
Length=396

 Score = 30.4 bits (67),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  108  LSPATCPICLDSFRAPKITRCGHIFC  133
            L P++C +CL +   P     GH+FC
Sbjct  332  LHPSSCSLCLKTRTNPAAASSGHVFC  357

>PITG_00025
Length=535

 Score = 30.4 bits (67),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 3/38 (8%)

Query  101  VLLWYDELSPA---TCPICLDSFRAPKITRCGHIFCIE  135
            V + +DEL  A    C IC ++ R P    C H+FC E
Sbjct  453  VYVTHDELVEAGSPDCSICYETMRQPVKLACSHMFCEE  490

>PHYCA_530915
Length=186

 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD       T CGH+FC
Sbjct  135  CSICLDVLENMTSTICGHVFC  155

>PYIR_18571
Length=403

 Score = 30.4 bits (67),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL    +P  T CGH+FC E
Sbjct  349  CALCLGERISPAATPCGHVFCWE  371

>PHYCA_104912
Length=347

 Score = 30.4 bits (67),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL    +P  T CGH+FC E
Sbjct  293  CALCLGERVSPAATPCGHVFCWE  315

>H257_06038
Length=684

 Score = 30.4 bits (67),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CPICL+S   P    C H FC
Sbjct  24   CPICLESVTVPYSLPCNHCFC  44

>PPTG_16653
Length=617

 Score = 30.4 bits (67),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 3/38 (8%)

Query  101  VLLWYDELSPA---TCPICLDSFRAPKITRCGHIFCIE  135
            V + +DEL  A    C IC ++ R P    C H+FC E
Sbjct  535  VYVTHDELVEAGSPDCSICYETMRQPVKLACSHMFCEE  572

>PHYKE_8396
Length=160

 Score = 29.6 bits (65),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C +CLD       T CGHIFC
Sbjct  109  CSVCLDVLENMTSTLCGHIFC  129

>H257_08183
Length=193

 Score = 30.0 bits (66),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CPIC D    P  TRCGH +C
Sbjct  6    CPICYDPCYDPVQTRCGHKYC  26

>PHYSO_498950
Length=424

 Score = 30.0 bits (66),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query  78   LTDDTAVSCWDVETLTEWKSVEQVLLWY-DELSPATCPICLDSFRA-PKI  125
            LT  T    WD+  +  WK+V QV L    EL P    +C + FR  PK+
Sbjct  101  LTIPTLTRVWDLFFMDGWKTVYQVALAITSELRPKLLDMCSEFFRKNPKL  150

>SDRG_04254
Length=506

 Score = 30.0 bits (66),  Expect = 4.0, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CPICL++   P    C H FC
Sbjct  20   CPICLEALSRPFSLPCNHFFC  40

>PHYSO_288411
Length=187

 Score = 30.0 bits (66),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL    +P  T CGH+FC E
Sbjct  133  CALCLGERVSPAATPCGHVFCWE  155

>PYAR_21118
Length=414

 Score = 30.0 bits (66),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 11/21 (52%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CP+CLD F       C H FC
Sbjct  238  CPVCLDYFSNSATLACSHTFC  258

>PYAR_20706
Length=530

 Score = 30.0 bits (66),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 25/66 (38%), Gaps = 25/66 (38%)

Query  82   TAVSCWDVETLTEWKSVEQVLLWYDELSPATCP------------ICLDSFRAPKITRCG  129
            TA +  D E + EW       LW     PA CP            IC D F  P +  C 
Sbjct  6    TATAMLD-EAMDEW-------LW-----PAACPELRQMESALRCQICGDFFHGPVLLPCT  52

Query  130  HIFCIE  135
            H FC E
Sbjct  53   HTFCSE  58

>H310_04140
Length=368

 Score = 30.0 bits (66),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL     P +T CGH+FC E
Sbjct  315  CVLCLAERTHPSVTPCGHLFCWE  337

>H310_14008
Length=342

 Score = 30.0 bits (66),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query  95   WKSVEQVLLWYDELSPA---TCPICLDS-FRAPKITRCGHIFC  133
            W++V++V    D  + A    CPIC+ +  + P  T CGH++C
Sbjct  259  WRAVKRVGYVTDSQAGARATGCPICMTTQAKTPYRTSCGHVYC  301

>SPRG_04746
Length=745

 Score = 30.0 bits (66),  Expect = 4.4, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 5/42 (12%)

Query  97   SVEQVLLWYDELSPATCPICLDSFRAPK---ITRCGHIFCIE  135
            SV  + L+ D LSPAT P      R P    + R GH FC +
Sbjct  64   SVADLKLFVDHLSPATTPS--HGMRPPSMALVDRAGHAFCFQ  103

>H310_12571
Length=784

 Score = 30.0 bits (66),  Expect = 4.6, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  111  ATCPICLDSFRAPKITRCGHIFC  133
            A+CPICL    +P    C H FC
Sbjct  192  ASCPICLYPHTSPVTLGCHHTFC  214

>PYAR_20140
Length=284

 Score = 30.0 bits (66),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 1/23 (4%)

Query  112  TCPICLDSFRAPKI-TRCGHIFC  133
             CPICLD+   P + T CG  FC
Sbjct  12   ACPICLDTMETPMLATCCGRSFC  34

>PHYCA_104632
Length=569

 Score = 30.0 bits (66),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 3/38 (8%)

Query  101  VLLWYDELSPA---TCPICLDSFRAPKITRCGHIFCIE  135
            V + +DEL  A    C IC ++ R P    C H+FC E
Sbjct  488  VYVSHDELVEAGSPDCSICYETMRQPVKLVCSHMFCEE  525

>PYIW_20853
Length=224

 Score = 29.6 bits (65),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL    +P  T CGH+FC E
Sbjct  170  CALCLGDRISPAATPCGHVFCWE  192

>SPRG_02871
Length=422

 Score = 29.6 bits (65),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C IC D+   P   RC H+FC E
Sbjct  352  CSICYDAMHTPVQLRCSHMFCEE  374

>PYIW_13128
Length=425

 Score = 29.6 bits (65),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 27/70 (39%), Gaps = 16/70 (23%)

Query  67   LHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKIT  126
            L+  YR   AP+TD  A     V  L                +  TCPICL   R+  + 
Sbjct  51   LYDIYRQPRAPITDPRATKTLPVRVLN---------------AELTCPICLGVIRSTMVV  95

Query  127  -RCGHIFCIE  135
              C H FC E
Sbjct  96   MECLHRFCGE  105

>SDRG_13137
Length=424

 Score = 29.6 bits (65),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C IC D+   P   RC H+FC E
Sbjct  350  CSICYDAMHTPVQLRCSHMFCEE  372

>PYIR_14154
Length=617

 Score = 30.0 bits (66),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 9/24 (38%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  110  PATCPICLDSFRAPKITRCGHIFC  133
            P+TCP+C  +   P ++  G++FC
Sbjct  318  PSTCPVCRQTRVNPAMSVSGYVFC  341

>PYAR_18714
Length=984

 Score = 30.0 bits (66),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 15/35 (43%), Gaps = 13/35 (37%)

Query  112  TCPICLDSFRAP-------------KITRCGHIFC  133
            TCPICLD    P             K+ RC H FC
Sbjct  85   TCPICLDKIAPPAPSKSQEVPEHSIKLARCVHTFC  119

>SPRG_07296
Length=505

 Score = 29.6 bits (65),  Expect = 5.4, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CPICL++   P    C H FC
Sbjct  20   CPICLEALERPFSLPCNHCFC  40

>HYAP_07106
Length=291

 Score = 29.6 bits (65),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD       T CGHIFC
Sbjct  240  CAICLDVLEDITSTVCGHIFC  260

>PYIW_22999
Length=219

 Score = 29.3 bits (64),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 14/22 (64%), Gaps = 1/22 (5%)

Query  113  CPICLDSFRAPKITR-CGHIFC  133
            CPICLD+   P +T  CG  FC
Sbjct  27   CPICLDTLERPVLTTCCGQSFC  48

>PHALS_08957
Length=1066

 Score = 29.6 bits (65),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CPICLD      +T C H+ C
Sbjct  803  CPICLDPPHDAVLTPCAHVLC  823

>CCI39998
Length=396

 Score = 29.6 bits (65),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  108  LSPATCPICLDSFRAPKITRCGHIFC  133
            L P+ C +CL +   P  +  GH+FC
Sbjct  332  LHPSLCSLCLKTRTNPAASSSGHVFC  357

>H257_11542
Length=244

 Score = 29.3 bits (64),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 13/22 (59%), Gaps = 0/22 (0%)

Query  112  TCPICLDSFRAPKITRCGHIFC  133
            TCPICL   +    T CGH FC
Sbjct  59   TCPICLSDVQLACETNCGHSFC  80

>H310_10009
Length=972

 Score = 29.6 bits (65),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C IC+D  +   IT C H FC
Sbjct  728  CAICMDPLKDAVITMCRHFFC  748

>PPTG_17684
Length=374

 Score = 29.6 bits (65),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%)

Query  2    RNNGSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPER  43
            R  G   GG K++ D    +GG   ++G S  +  NF  PE+
Sbjct  201  RRQGKEHGGGKQKTDKSGKQGGNSGKSGNSKGNNKNFKTPEK  242

>CCI45120
Length=270

 Score = 29.3 bits (64),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD       T CGH+FC
Sbjct  219  CSICLDLIDRMTSTICGHVFC  239

>PYU1_G009058
Length=389

 Score = 29.6 bits (65),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C +CL     P  T CGH+FC E
Sbjct  335  CALCLGDRITPAATPCGHVFCWE  357

>H257_03456
Length=501

 Score = 29.6 bits (65),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C IC D+  AP    C H+FC E
Sbjct  413  CSICYDAMHAPVQLACAHMFCEE  435

>PYIW_13425
Length=257

 Score = 29.3 bits (64),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 36/74 (49%), Gaps = 11/74 (15%)

Query  66   YLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKI  125
            ++ +  R+++  L   +  +   +E L + K+           S A+C +C+D+ ++P +
Sbjct  31   WVQSIIRYIMPQLNSVSPAAVHVIEALKKRKAAPHA-------SGASCVVCMDALKSPCV  83

Query  126  -TRCGHIF---CIE  135
               CGH F   CIE
Sbjct  84   ELPCGHQFHERCIE  97

>PYAP_13371
Length=482

 Score = 29.6 bits (65),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 23/55 (42%), Gaps = 14/55 (25%)

Query  88   DVETLTEWKSVEQVLLWYD---EL----SPATCPICLDSFRAPKITRCGHIFCIE  135
            D + + EW       LW D   EL    S   C IC D F  P +  C H FC E
Sbjct  2    DADDMDEW-------LWPDACPELRQMESTLRCLICGDFFHGPVLLPCTHTFCSE  49

>PYIR_22040
Length=457

 Score = 29.6 bits (65),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 12/23 (52%), Gaps = 0/23 (0%)

Query  113  CPICLDSFRAPKITRCGHIFCIE  135
            C IC D F  P +  C H FC E
Sbjct  22   CQICGDFFHGPVLLPCSHAFCSE  44

>PYVX_24209
Length=513

 Score = 29.3 bits (64),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            CP+CL+ F A     C H FC
Sbjct  332  CPVCLEYFYASATLPCSHTFC  352

>H257_16246
Length=419

 Score = 29.3 bits (64),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 20/39 (51%), Gaps = 1/39 (3%)

Query  95   WKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            ++S+E     +DE SP  CP+C + F       C H FC
Sbjct  216  FRSLEADPANHDE-SPLKCPVCFEFFVDSLTLACSHTFC  253

>PYVX_16402
Length=1588

 Score = 29.6 bits (65),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 14/28 (50%), Gaps = 0/28 (0%)

Query  106  DELSPATCPICLDSFRAPKITRCGHIFC  133
            D L    CPICLD      +T C H+ C
Sbjct  831  DGLESQECPICLDPPVNGVLTPCAHLMC  858

>CCA17183
Length=10704

 Score = 29.6 bits (65),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 19/80 (24%), Positives = 33/80 (41%), Gaps = 3/80 (4%)

Query  7    RRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAhhhgkkkkNAPTRTQMEY  66
            R     ++ +   YE    T         +  S+P R++ Q        ++     Q+ Y
Sbjct  892  RAQAMSRQSEMSGYEIDYATSQSFDEVQEIRLSVPVRKEVQQIQTLTSSRD---EVQLLY  948

Query  67   LHANYRFVIAPLTDDTAVSC  86
            L +NY + + PLT+   VSC
Sbjct  949  LTSNYDYTLGPLTEIQRVSC  968

>PHALS_10597
Length=562

 Score = 29.3 bits (64),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 32/82 (39%), Gaps = 18/82 (22%)

Query  67   LHANYRFVIAPLTDDTAVSC--------WDVETLTEWKSVEQVLLWYDELSPATCPICLD  118
            LH   R +  P  D + V+         W +E    +   E    W  + + + C ICL 
Sbjct  84   LHLWKRLIPQPKNDVSQVAVMYSISFYPWKMEPHCYYSHPEAAANWVPDTASSRCQICLI  143

Query  119  SFRAPKITR-------CGHIFC  133
            SF    +TR       CGH+ C
Sbjct  144  SF---TLTRRRHHCRLCGHLVC  162

>PYU1_G001730
Length=358

 Score = 29.3 bits (64),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD+      T CGH++C
Sbjct  307  CSICLDTIDEMTSTMCGHVYC  327

>H310_04698
Length=188

 Score = 28.9 bits (63),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  112  TCPICLDSFRAPKITRCGHIF  132
            TC +CL+ F +P    CGH F
Sbjct  17   TCAVCLEPFASPVTLYCGHTF  37

>PYIR_25281
Length=356

 Score = 29.3 bits (64),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 0/34 (0%)

Query  100  QVLLWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            + ++  D+     C IC   FR    T CGH FC
Sbjct  239  KYVIKSDDEEQFACTICRGPFRNAIETICGHFFC  272

>PYAR_20457
Length=133

 Score = 28.5 bits (62),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 14/22 (64%), Gaps = 1/22 (5%)

Query  113  CPICLDSFRAPKITR-CGHIFC  133
            CPICLD+   P +T  CG  FC
Sbjct  28   CPICLDTMSEPMLTTCCGQSFC  49

>PYIW_14664
Length=426

 Score = 29.3 bits (64),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD       T CGHI+C
Sbjct  375  CSICLDVIEEMTSTICGHIYC  395

>SDRG_15919
Length=561

 Score = 29.3 bits (64),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 18/37 (49%), Gaps = 0/37 (0%)

Query  99   EQVLLWYDELSPATCPICLDSFRAPKITRCGHIFCIE  135
            E+V   Y  L    C I L  F  P  TR GH+F IE
Sbjct  27   EEVRRAYRRLPFDCCSISLKPFENPVCTREGHLFDIE  63

>CCA26695
Length=297

 Score = 29.3 bits (64),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 0/34 (0%)

Query  100  QVLLWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            + L+  D      C IC   F+    T CGHIFC
Sbjct  218  EYLVSDDADEQFACTICRQPFQDAVKTICGHIFC  251

>CCA23479
Length=297

 Score = 29.3 bits (64),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 0/34 (0%)

Query  100  QVLLWYDELSPATCPICLDSFRAPKITRCGHIFC  133
            + L+  D      C IC   F+    T CGHIFC
Sbjct  218  EYLVSDDADEQFACTICRQPFQDAVKTICGHIFC  251

>PYIW_23387
Length=591

 Score = 29.3 bits (64),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 9/24 (38%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  110  PATCPICLDSFRAPKITRCGHIFC  133
            P+TCP+C  +   P ++  G++FC
Sbjct  309  PSTCPVCRQTRVNPAMSVSGYVFC  332

>CCA18895
Length=274

 Score = 28.9 bits (63),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  113  CPICLDSFRAPKITRCGHIFC  133
            C ICLD       T CGH+FC
Sbjct  223  CSICLDLIDRMTSTICGHVFC  243

Lambda      K        H        a         alpha
   0.320    0.134    0.426    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3398400027

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40