Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAP_22844111481781789536e-133
PYU1_G005964111481761895952e-78
PYIR_15183111481871865745e-75
PYIW_14755111481691835665e-74
PHYCA_118037111481651825508e-72
PITG_13740111481661795431e-70
PHYSO_300767111481661795371e-69
PHYSO_300766485331661795371e-69
PPTG_09253111481661795317e-69
PHALS_11565111481621764511e-56
PYAR_26061111481141134182e-52
SDRG_04481111481861804149e-51
H310_10665111481651803945e-48
SPRG_13308111481871803922e-47
H257_07013111481661793841e-46
PHYRA_96081111481561083474e-41
SPRG_118791283231251172863e-32
PYVX_2085911148225902333e-23
PHYKE_259336139450770.34
PYIW_13202612449267685.2
PHALS_116279422171449669.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAP_22844

Length=178
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYAP_22844                                                            371     6e-133
PYU1_G005964                                                          233     2e-78 
PYIR_15183                                                            225     5e-75 
PYIW_14755                                                            222     5e-74 
PHYCA_118037                                                          216     8e-72 
PITG_13740                                                            213     1e-70 
PHYSO_300767                                                          211     1e-69 
PHYSO_300766                                                          211     1e-69 
PPTG_09253                                                            209     7e-69 
PHALS_11565                                                           178     1e-56 
PYAR_26061                                                            165     2e-52 
SDRG_04481                                                            164     9e-51 
H310_10665                                                            156     5e-48 
SPRG_13308                                                            155     2e-47 
H257_07013                                                            152     1e-46 
PHYRA_96081                                                           138     4e-41 
SPRG_11879                                                            114     3e-32 
PYVX_20859                                                            94.4    3e-23 
PHYKE_2593                                                            34.3    0.34  
PYIW_13202                                                            30.8    5.2   
PHALS_11627                                                           30.0    9.5   

>PYAP_22844
Length=178

 Score = 371 bits (953),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%), Gaps = 0/178 (0%)

Query  1    MVRVKVRVFTFPSNPREQNSYIGGLLPTVGALKLENDELTSITFSQLRPRIELRDDDGMI  60
            MVRVKVRVFTFPSNPREQNSYIGGLLPTVGALKLENDELTSITFSQLRPRIELRDDDGMI
Sbjct  1    MVRVKVRVFTFPSNPREQNSYIGGLLPTVGALKLENDELTSITFSQLRPRIELRDDDGMI  60

Query  61   RRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFAPLTKY  120
            RRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFAPLTKY
Sbjct  61   RRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFAPLTKY  120

Query  121  LATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVTKNP  178
            LATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVTKNP
Sbjct  121  LATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVTKNP  178

>PYU1_G005964
Length=176

 Score = 233 bits (595),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 135/189 (71%), Gaps = 27/189 (14%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            MV VK+RVFTFPSNPREQNSY+     GGLLPTVG LKLE DE  +ITF+QLRPRIEL++
Sbjct  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60

Query  56   DDGMIR--------RSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIE  107
            D+ MIR        RS MFQEVL+IIS SPNPH WP SALQTYWFGYF D++Q VP  + 
Sbjct  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120

Query  108  VCSTSIFAPLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQG  167
               T +               +ED PIS +L+MTTSK TGDLILIPQTQ GP+CE CCQG
Sbjct  121  ARETPV--------------ADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQG  166

Query  168  CERCPPVTK  176
            C RCPPV K
Sbjct  167  CARCPPVRK  175

>PYIR_15183
Length=187

 Score = 225 bits (574),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 11/186 (6%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            M  +KVRVFTFPS+PREQNSY+     GGLLPTVG LKL+N E   +TF+QLRPRIEL++
Sbjct  4    MAYLKVRVFTFPSSPREQNSYVVGTWEGGLLPTVGTLKLDNSE--CVTFAQLRPRIELQN  61

Query  56   DDGMIRRSP-MFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEV---CST  111
            D+ MIR+ P MFQEVL+II+ SPNPH+WP SALQTYWFG+F D++Q+VP  I V   C  
Sbjct  62   DNFMIRQVPLMFQEVLAIIATSPNPHQWPHSALQTYWFGFFEDLEQSVPTMISVRPSCGC  121

Query  112  SIFAPLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERC  171
                P T  +A     ++ED+P+S +L+MTTSK TGDLILIPQTQ GPVCE CC+GC  C
Sbjct  122  DCTNPSTIDIAQWLQVSDEDSPVSTFLNMTTSKQTGDLILIPQTQVGPVCEKCCKGCALC  181

Query  172  PPVTKN  177
            PP+ K 
Sbjct  182  PPIRKK  187

>PYIW_14755
Length=169

 Score = 222 bits (566),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 134/183 (73%), Gaps = 26/183 (14%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            MV VKVRVFTFPS+PR+QNSY+     GGLLPTVG LKL++ E  S+TF+QLRPRIEL++
Sbjct  1    MVHVKVRVFTFPSSPRKQNSYVVGTWEGGLLPTVGTLKLDDSE--SVTFAQLRPRIELQN  58

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
            D+ MIRR+ MFQEVL+II+ SPNPHRWP SALQTYWFG++ D++Q VP  + V       
Sbjct  59   DNFMIRRALMFQEVLAIIATSPNPHRWPHSALQTYWFGFYEDLEQRVPTVLPVAV-----  113

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVT  175
                          ED+P+S +L+M TSK TGDLILIPQTQ GPVCE CC+GC  CPP+ 
Sbjct  114  --------------EDSPVSAFLNMMTSKQTGDLILIPQTQVGPVCEKCCEGCALCPPIC  159

Query  176  KNP  178
            K P
Sbjct  160  KQP  162

>PHYCA_118037
Length=165

 Score = 216 bits (550),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 128/182 (70%), Gaps = 24/182 (13%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            MVRVKVRVFTFPS+PR+QNSY+     GGLLP VG L L+  E  ++TF+QLRPRIEL  
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTVEGGLLPVVGTLNLDEKETDTVTFAQLRPRIELLQ  60

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
               +IRRS MFQEVL++I+ASPNPH WP +A+QTYWFG+FTD +++ PH I         
Sbjct  61   SKDVIRRSVMFQEVLALIAASPNPHGWPPNAMQTYWFGHFTDENESAPHVITAA------  114

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVT  175
                         +E+ PIS++L+MTTSK TGDLIL+PQTQ GPVCE CC+GC  CP + 
Sbjct  115  -------------DENTPISQFLNMTTSKQTGDLILVPQTQLGPVCEQCCEGCSLCPSIN  161

Query  176  KN  177
             N
Sbjct  162  SN  163

>PITG_13740
Length=166

 Score = 213 bits (543),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 127/179 (71%), Gaps = 24/179 (13%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            MVRVKVRVFTFPS+PR+QNSY+     GGLLP VG L L++ E  ++TF+QLR RIEL  
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
             + +IRRS MFQEVL++++ S NPH+WP +A+QTYWFG+F D  ++VPH I         
Sbjct  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAA------  114

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174
                         +ED PIS+YL+MTTSKL GDLILIPQTQ GPVCE CC+GC  CPP+
Sbjct  115  -------------DEDCPISQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPI  160

>PHYSO_300767
Length=166

 Score = 211 bits (537),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 127/179 (71%), Gaps = 24/179 (13%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            MVRVKVRVFTFPS+PR+QNSY+     GGLLP VG L L++ E+ ++TF+QLRPRIEL  
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
               +IRRS MFQEVL++I+ S NPH WP +A+QTY FG+F D ++ VPH I         
Sbjct  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAA------  114

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174
                         +ED PIS++L+MTTSK TGDL+LIPQTQ GPVCE CC+GCE CPP+
Sbjct  115  -------------DEDCPISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPI  160

>PHYSO_300766
Length=166

 Score = 211 bits (537),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 127/179 (71%), Gaps = 24/179 (13%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            MVRVKVRVFTFPS+PR+QNSY+     GGLLP VG L L++ E+ ++TF+QLRPRIEL  
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
               +IRRS MFQEVL++I+ S NPH WP +A+QTY FG+F D ++ VPH I         
Sbjct  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAA------  114

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174
                         +ED PIS++L+MTTSK TGDL+LIPQTQ GPVCE CC+GCE CPP+
Sbjct  115  -------------DEDCPISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPI  160

>PPTG_09253
Length=166

 Score = 209 bits (531),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 127/179 (71%), Gaps = 24/179 (13%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            MVRVKVRVFTFP +PR+QNSY+     GGLLP VG L L++ E++++TF+QLR RIEL  
Sbjct  1    MVRVKVRVFTFPPDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVSTVTFTQLRVRIELLQ  60

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
               +IRRS MFQEVL++I+ SPNPH WP +A+QTYWFG+F D  +T+PH I         
Sbjct  61   VKDVIRRSVMFQEVLALIATSPNPHNWPPNAMQTYWFGHFIDESETIPHVIAA-------  113

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174
                        ++ED PI+++L+M TSK TGDLIL+PQTQ GPVCE CC+GC  CPP+
Sbjct  114  ------------SDEDCPINQFLNMITSKQTGDLILVPQTQLGPVCEQCCEGCTLCPPI  160

>PHALS_11565
Length=162

 Score = 178 bits (451),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 110/176 (63%), Gaps = 24/176 (14%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            M+ VKVRVFTFPS+P++QNSY+     GG LP VG + +++ E T+ITF+QLR RIEL  
Sbjct  1    MIHVKVRVFTFPSDPQKQNSYVVGSIEGGHLPVVGTILIDDKEATTITFTQLRQRIELLQ  60

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
                IRRS MFQEVL+ I+ SPN H WP   +QTYWFGYF D    VPH I         
Sbjct  61   VKDEIRRSAMFQEVLAFIATSPNSHSWPQKFMQTYWFGYFADEGACVPHIIT--------  112

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERC  171
                  A DE       P+S++ +M TSK   DLIL+PQTQ GPVC  CCQ C+ C
Sbjct  113  ------AADEI-----RPVSQFTNMATSKQICDLILVPQTQIGPVCHQCCQSCKVC  157

>PYAR_26061
Length=114

 Score = 165 bits (418),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 5/113 (4%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            ++RVKVRVFTFPS+PR QNSY+     GGLLPTVG L L++ E  ++TF+QLRPR+ELRD
Sbjct  2    VLRVKVRVFTFPSDPRLQNSYVVGTMEGGLLPTVGTLSLDDSEKDTVTFAQLRPRLELRD  61

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEV  108
            DDGMIRRS +FQEVL+I SAS NPH WP SALQTYWFG+F D  +TVPH+I V
Sbjct  62   DDGMIRRSALFQEVLAIASASRNPHGWPVSALQTYWFGFFQDPSETVPHAIPV  114

>SDRG_04481
Length=186

 Score = 164 bits (414),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 108/180 (60%), Gaps = 26/180 (14%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            +VR+KVRVF FP +P  ++SY+     GGL   +G + +E+DE   +TF  +RPRIEL+ 
Sbjct  2    VVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVVEDDE--DLTFQSVRPRIELQQ  59

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
            D  ++RR  M+QE L ++++  NPH+WP  ALQTYW GY+   D  VP  I         
Sbjct  60   DGSVLRRHIMYQEALFLMTSGANPHQWPVKALQTYWLGYYAHEDDLVPTIIPTA------  113

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVT  175
                         +E     ++LDM T+KLT DLILIPQ+Q GPVC ACCQGC  CPP+ 
Sbjct  114  -------------DEHQSFREFLDMKTTKLTADLILIPQSQIGPVCNACCQGCAACPPIA  160

>H310_10665
Length=165

 Score = 156 bits (394),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 111/180 (62%), Gaps = 28/180 (16%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            MVR+KVRVFTF  +P  ++SY+     GGL   +G + L++D+   +TF+ +RPRIEL++
Sbjct  1    MVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLDDDD--DLTFASVRPRIELKE  58

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
            ++G+IRR+ MFQE L  ++ + NPH+WP   LQTYW GY+ + D   P  I         
Sbjct  59   ENGLIRRNLMFQEALFQMTEARNPHQWPTHTLQTYWLGYYKNEDDMTPTII---------  109

Query  116  PLTKYLATDEYPNEEDA-PISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174
                       P E++A  +   LDM ++K+T DLI++PQ+Q GPVC  CCQGC  CP +
Sbjct  110  -----------PTEDEARSLRDVLDMKSTKVTADLIIVPQSQIGPVCAMCCQGCALCPAI  158

>SPRG_13308
Length=187

 Score = 155 bits (392),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 107/180 (59%), Gaps = 26/180 (14%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            +VR+KVRVF FP +P  ++SY+     GGL   +G + +++D    +TF  +RPRIEL+ 
Sbjct  2    VVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVMDDD--DDLTFESVRPRIELQQ  59

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
            D  + RR  M+QE L ++++S NPH+WP  ALQTYW GY+   D  VP  I         
Sbjct  60   DGSVQRRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIPTA------  113

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVT  175
                         +E  P+   LDM T+KLT DLILIPQ+Q GPVC ACCQGC  CPP+ 
Sbjct  114  -------------DEQKPLRAVLDMKTTKLTADLILIPQSQIGPVCTACCQGCAVCPPIA  160

>H257_07013
Length=166

 Score = 152 bits (384),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 106/179 (59%), Gaps = 25/179 (14%)

Query  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
            +VR+KVRVFTF  +P  ++SY+     GGL   +G + LE+DE   +TF  +RPRIEL++
Sbjct  2    VVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLEDDE--DLTFESVRPRIELKE  59

Query  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115
            ++G+IRR+PMFQE L  ++ + NPH+WP   LQTYW GY+   D   P  I    TS   
Sbjct  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTS---  116

Query  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174
                              +   LDM ++K+T DLI+IPQ+Q GPVC  CCQ C  CP +
Sbjct  117  ---------------SKCLRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSI  160

>PHYRA_96081
Length=156

 Score = 138 bits (347),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 5/108 (5%)

Query  6    VRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRDDDGMI  60
            VRVFTFPS+PR+QNSY+     GGLLP VG L L + E+ ++TF QLR RIEL  D  +I
Sbjct  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106

Query  61   RRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEV  108
            RRS MFQEVL++I+AS NPH WP +A+QTYWFG++TD + ++P  I V
Sbjct  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAV  154

>SPRG_11879
Length=125

 Score = 114 bits (286),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 67/117 (57%), Gaps = 19/117 (16%)

Query  59   MIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFAPLT  118
            M RR  M+QE L ++++S NPH+WP  ALQTYW GY+   D  VP  I            
Sbjct  1    MRRRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIPTA---------  51

Query  119  KYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVT  175
                      +E  P+   LDM ++KLT DLILIPQ+Q GPVC ACCQGC  CPP+ 
Sbjct  52   ----------DEQKPLRAVLDMKSTKLTADLILIPQSQIGPVCNACCQGCAECPPIA  98

>PYVX_20859
Length=225

 Score = 94.4 bits (233),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 11/90 (12%)

Query  1   MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55
           MVRVKVRVFTFPS+PREQNSY+     GGLLP VG L +E+ E  +I+FSQLRPRIEL++
Sbjct  1   MVRVKVRVFTFPSDPREQNSYLVGTSEGGLLPVVGTLNVEDAEQDTISFSQLRPRIELKN  60

Query  56  DDGMIR--RS---PMFQEVLSIISASPNPH  80
           D+ M+R  RS   P+   +++I++A P PH
Sbjct  61  DNNMVRCVRSAALPVSLIMMAILTA-PQPH  89

>PHYKE_2593
Length=394

 Score = 34.3 bits (77),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query  81   RWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFAPLTKYLATDEYPNEE  130
             +PA  L   WFG     D TV +SI + S  +  PLT YL   E+  EE
Sbjct  296  EYPAVYLSNSWFG----GDLTVLNSISLLSCLVLFPLTSYLRKYEHDREE  341

>PYIW_13202
Length=492

 Score = 30.8 bits (68),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (45%), Gaps = 1/67 (1%)

Query  93   GYFTDMDQTVPHSIEVCSTSIFAPLTKYLATDEYPNEEDAPISK-YLDMTTSKLTGDLIL  151
            GYF+D D+ +  +I V          ++ + D   +E D   +K  LD   S   GD   
Sbjct  247  GYFSDYDEVLEPAISVMQKEAARKEDQHWSLDNNIHEIDEDNAKEVLDAIMSNDNGDQYT  306

Query  152  IPQTQFG  158
            IP+ +F 
Sbjct  307  IPRQEFA  313

>PHALS_11627
Length=1714

 Score = 30.0 bits (66),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 15/49 (31%), Positives = 27/49 (55%), Gaps = 0/49 (0%)

Query  30   GALKLENDELTSITFSQLRPRIELRDDDGMIRRSPMFQEVLSIISASPN  78
            G  +LE+D+LT I        ++L + D  +RRS ++Q   + +  SP+
Sbjct  258  GVSRLESDQLTQIIAKIAAQALQLSNQDQQMRRSKVYQTFANRMLLSPS  306

Lambda      K        H        a         alpha
   0.320    0.136    0.422    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7074377310

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40