Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_092541114930730712514e-174
PHYSO_315015111492061074165e-49
PHYCA_60964111491771064013e-47
PYIW_14749111493142554108e-47
PITG_13744111491781053753e-43
PHYRA_8167711149173943432e-38
PYIR_15197111492842553224e-34
PYAP_24882111491791012439e-24
SDRG_14093111492871392491e-23
H310_11728111492911482351e-21
H257_12786111492782362341e-21
PYAR_22689111493041172088e-18
CCA17990111492831462061e-17
SPRG_0328111149153551312e-08
H310_043861423352361732.8
H257_166121423352158733.1
PYAP_2149610012155458724.5
PHALS_019113844122789715.5
PPTG_03363754943146715.6
PYAR_1576610012154458715.8
SPRG_081921423352861707.6
SDRG_048961423352761707.8
CCA186821423353558699.6
PYU1_G01409981841433106699.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_09254

Length=307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPTG_09254                                                            486     4e-174
PHYSO_315015                                                          164     5e-49 
PHYCA_60964                                                           159     3e-47 
PYIW_14749                                                            162     8e-47 
PITG_13744                                                            149     3e-43 
PHYRA_81677                                                           136     2e-38 
PYIR_15197                                                            128     4e-34 
PYAP_24882                                                            98.2    9e-24 
SDRG_14093                                                            100     1e-23 
H310_11728                                                            95.1    1e-21 
H257_12786                                                            94.7    1e-21 
PYAR_22689                                                            84.7    8e-18 
CCA17990                                                              84.0    1e-17 
SPRG_03281                                                            55.1    2e-08 
H310_04386                                                            32.7    2.8   
H257_16612                                                            32.7    3.1   
PYAP_21496                                                            32.3    4.5   
PHALS_01911                                                           32.0    5.5   
PPTG_03363                                                            32.0    5.6   
PYAR_15766                                                            32.0    5.8   
SPRG_08192                                                            31.6    7.6   
SDRG_04896                                                            31.6    7.8   
CCA18682                                                              31.2    9.6   
PYU1_G014099                                                          31.2    9.9   

>PPTG_09254
Length=307

 Score = 486 bits (1251),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 307/307 (100%), Positives = 307/307 (100%), Gaps = 0/307 (0%)

Query  1    MSDDVVRHHrgqgagaaaaaragpappgafgrgrVTDPDSQTLPRSATARVFPERWRSAG  60
            MSDDVVRHHRGQGAGAAAAARAGPAPPGAFGRGRVTDPDSQTLPRSATARVFPERWRSAG
Sbjct  1    MSDDVVRHHRGQGAGAAAAARAGPAPPGAFGRGRVTDPDSQTLPRSATARVFPERWRSAG  60

Query  61   HEREPRRQNLRPLPKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEM  120
            HEREPRRQNLRPLPKRTPKSFYPYEALLETLLHELTHMVHGPHNEAFYKYLDELKHEMEM
Sbjct  61   HEREPRRQNLRPLPKRTPKSFYPYEALLETLLHELTHMVHGPHNEAFYKYLDELKHEMEM  120

Query  121  LMVRGLVGEEGVRFAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLGS  180
            LMVRGLVGEEGVRFAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLGS
Sbjct  121  LMVRGLVGEEGVRFAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLGS  180

Query  181  LSAASNEIFNPQALRRKILEAAERRRRDNEHCRNVLHPGASHEVLGIessdddedstsNG  240
            LSAASNEIFNPQALRRKILEAAERRRRDNEHCRNVLHPGASHEVLGIESSDDDEDSTSNG
Sbjct  181  LSAASNEIFNPQALRRKILEAAERRRRDNEHCRNVLHPGASHEVLGIESSDDDEDSTSNG  240

Query  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRGDT  300
            ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRGDT
Sbjct  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRGDT  300

Query  301  VDIIDLT  307
            VDIIDLT
Sbjct  301  VDIIDLT  307

>PHYSO_315015
Length=206

 Score = 164 bits (416),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)

Query  74   PKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGEEGVR  133
            P+R+P+SF PYEALLETLLHELTHMVHGPHN+AFY+YLDELK EME LMVRGLVGEEG +
Sbjct  76   PQRSPQSFLPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMESLMVRGLVGEEGAK  135

Query  134  FAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLGS  180
            FA AG GQRLGG++  VPIRVAAVLAAKRREQY+SLLGGETSRRLGS
Sbjct  136  FADAGAGQRLGGNSAGVPIRVAAVLAAKRREQYHSLLGGETSRRLGS  182

>PHYCA_60964
Length=177

 Score = 159 bits (401),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 95/106 (90%), Gaps = 0/106 (0%)

Query  74   PKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGEEGVR  133
            P+R P+SFY YE LL TLLHELTHMVHGPHN+AFYKYLDELKH+ME LMVRGLVGEEG +
Sbjct  72   PQRNPESFYSYEELLGTLLHELTHMVHGPHNQAFYKYLDELKHDMESLMVRGLVGEEGAK  131

Query  134  FAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLG  179
            F+ AG G RLGG ++ VPIRVAAVLAAKRREQY+SLLGGETSRRLG
Sbjct  132  FSEAGEGHRLGGSSVGVPIRVAAVLAAKRREQYHSLLGGETSRRLG  177

>PYIW_14749
Length=314

 Score = 162 bits (410),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 153/255 (60%), Gaps = 28/255 (11%)

Query  70   LRPLPKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129
            LR  P   P +FYP+EALLET+LHELTHMVHGPHN+AFYKYLDELK EME LM++GL+G 
Sbjct  68   LRLRPAAQPAAFYPFEALLETMLHELTHMVHGPHNQAFYKYLDELKTEMEALMIQGLIGA  127

Query  130  EGVRFAAAGTGQRLGGD-NISVPIR---VAAVLAAKRREQYNSLLGGETSRRLGS---LS  182
            EG +F +AG G+ +    +ISV  +    AAVL AKRR QY  LLG +TS+RLGS   + 
Sbjct  128  EGAKFHSAGEGRVIKASRSISVRFQNDNAAAVLVAKRRAQYQQLLGDQTSQRLGSRTGVD  187

Query  183  AASNEIFNPQALRRKILEAAERRRRDNEHCRNVLHPGASHEVLGIessdddedstsNGAR  242
               + +  P  LRRK+LEAAERRR+DNE C        S EVLGI           +   
Sbjct  188  LTPSSLMPPDELRRKMLEAAERRRQDNERCSIAEAITQSIEVLGI----------DDSDD  237

Query  243  QQAPDPSASDIIVLEEEDDAH---ETIA-NVPAVIDLLDDDGEEK----HDDVPR--RAG  292
            +     +  D+I      D H   E  A + P VIDL++DD E++     D+V R  R  
Sbjct  238  EDVQAIAVIDLIDCASPLDHHVKPEVAAGDEPVVIDLVEDDDEQEAKTDEDEVVRLHRTT  297

Query  293  RKRKRGDTVDIIDLT  307
            RKR+  D V  IDLT
Sbjct  298  RKRRLSDEV-TIDLT  311

>PITG_13744
Length=178

 Score = 149 bits (375),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 90/105 (86%), Gaps = 0/105 (0%)

Query  75   KRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGEEGVRF  134
            K  P +FYPYEALLETLLHELTHMVHGPHNEAFY YL+ELK EME LMVRGLVGEEG +F
Sbjct  74   KHAPDTFYPYEALLETLLHELTHMVHGPHNEAFYTYLEELKAEMESLMVRGLVGEEGAKF  133

Query  135  AAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLG  179
            A AGTGQRLGG  +S P RVAAVLAAKRREQY SLLGG+ + RLG
Sbjct  134  ADAGTGQRLGGSRVSAPARVAAVLAAKRREQYTSLLGGKINHRLG  178

>PHYRA_81677
Length=173

 Score = 136 bits (343),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 84/94 (89%), Gaps = 0/94 (0%)

Query  74   PKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGEEGVR  133
            PKRTP+SFYPYEALLETLLHELTHMVHGPHN+AFY+YLDELK EME LMVRGL G+E V+
Sbjct  74   PKRTPESFYPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMESLMVRGLEGQEAVK  133

Query  134  FAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYN  167
            FA AG GQRLGGD+  VPI VAAVLAAKRREQ +
Sbjct  134  FADAGAGQRLGGDSARVPICVAAVLAAKRREQVS  167

>PYIR_15197
Length=284

 Score = 128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 140/255 (55%), Gaps = 58/255 (23%)

Query  70   LRPLPKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129
            LR  P   P+SF P+EALLET+LHELTHMVHGPHN+AFY YLDELK EME LM+R L+G 
Sbjct  68   LRLRPAARPESFLPFEALLETMLHELTHMVHGPHNQAFYNYLDELKMEMEALMIRDLLGT  127

Query  130  EGVRFAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLGSLSAASNEIF  189
            EG +F +AG G+    DN       AAVLAAK REQ                        
Sbjct  128  EGAKFHSAGEGR---NDN------AAAVLAAKHREQ------------------------  154

Query  190  NPQALRRKILEAAERRRRDNEHCRNVLHPGASHEVLGIessdddedstsNGARQQAP---  246
                LRRK+LEAAERRR+DNE C        S EVLGI     D+     G ++  P   
Sbjct  155  --DQLRRKMLEAAERRRQDNECCTTTEAITQSIEVLGI-----DDSDEEEGNKELIPIAV  207

Query  247  ----DPSASDIIVLEEEDDAHETIANVPAVIDLLDDD---GEEKHDDV-----PRR-AGR  293
                + S  D + +  E+DA +T  +V  VI+L+D++    EE  ++V     P+R   R
Sbjct  208  VDLVESSPPDALCVVLEEDAAQTAGDV-VVINLIDEEEKVTEEFDNEVVDVASPQRPTTR  266

Query  294  KRKRGD-TVDIIDLT  307
            KRK  D T D IDLT
Sbjct  267  KRKIEDATTDTIDLT  281

>PYAP_24882
Length=179

 Score = 98.2 bits (243),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 5/101 (5%)

Query  70   LRPLPKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129
            +R  P   P SF+PYEALLET+LHELTHMVHGPHN+AFYKYLDELK EME LM RGLVG 
Sbjct  74   IRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLMTRGLVGH  133

Query  130  EGVRFAAAGTGQRLGGDNISVPIR-----VAAVLAAKRREQ  165
            EG RF  AG    +  ++  + +R      AAVLAA+RRE+
Sbjct  134  EGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREK  174

>SDRG_14093
Length=287

 Score = 100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 86/139 (62%), Gaps = 1/139 (1%)

Query  74   PKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGEEGVR  133
            P   P SF P+E LL T+LHEL HM  GPHN AFYK LDEL  EME LM +GL+G  G +
Sbjct  72   PAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQGLIGITGAQ  131

Query  134  FAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLGSLSAASNEIFNPQA  193
            F  AG G  LGG N +  +  AA  AA +R ++ +L+G   S RLG  ++A+     P  
Sbjct  132  FQNAGQGHALGGAN-ARNVAKAAADAAIQRMRHQALVGANGSCRLGGDASATAASLTPAM  190

Query  194  LRRKILEAAERRRRDNEHC  212
            LR+K L+AAERRR D   C
Sbjct  191  LRQKALKAAERRRHDQLTC  209

>H310_11728
Length=291

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 92/148 (62%), Gaps = 12/148 (8%)

Query  70   LRPLPKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129
            LR  P   P +F P+E +L T+LHEL HM  GPHN +FYK LDEL  EME L+ RGL+G 
Sbjct  72   LRLRPASQPTTFLPFEDILGTMLHELVHMKIGPHNASFYKMLDELTREMENLLERGLLGA  131

Query  130  EGVRFAAAGTGQRLGGDNISVPIRVAAV--LAAKRREQYNSLLGGETSRRLGSLSAASNE  187
             G  F  AG GQ LGG ++ +P +V+ V   AA  R+++ +++   T+R  GS  AAS+ 
Sbjct  132  AGAAFQDAGNGQSLGGMHV-LPSQVSRVRASAALNRQKHQAIMS--TNRLGGSAVAASD-  187

Query  188  IFNPQALRRKILEAAERRRRDNEHCRNV  215
                  LR K+LEAAE+R  D+  C N+
Sbjct  188  ------LRAKMLEAAEKRLLDSRACANI  209

>H257_12786
Length=278

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 117/236 (50%), Gaps = 28/236 (12%)

Query  70   LRPLPKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129
            LR  P   P +F P+E +L T+LHEL HM  GPH+ +FYK LDEL  +ME LM RGL+G 
Sbjct  68   LRLRPASHPTTFLPFEEILGTMLHELVHMKIGPHDASFYKMLDELTEDMENLMARGLLGA  127

Query  130  EGVRFAAAGTGQRLGGDNISVPIRVAAV--LAAKRREQYNSLLGGETSRRLGSLSAASNE  187
             G  F   G GQ LGG  + +P ++A+V   AA +R Q+ +++   ++ RLG  S     
Sbjct  128  TGAAFQDTGDGQSLGGTRV-LPSQLASVRAAAAAKRIQHQAIM---STNRLGGAS-----  178

Query  188  IFNPQALRRKILEAAERRRRDNEHCRNVLHPGASHEVLGIessdddedstsNGARQQAPD  247
              +P  LR K+LEAAE+R RD   C  V     +H+V              + ++  AP+
Sbjct  179  -ISPSQLRGKVLEAAEKRLRDAVACATV---TCTHDV-------------PSSSQTHAPN  221

Query  248  PSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRGDTVDI  303
                 + + EE D+        P   +          D V R+  R   +  T+D+
Sbjct  222  HIKPIVCIQEEYDEQDAIQWQCPTCSEWHSTSRLHICDSVLRKRKRPPSQHVTIDL  277

>PYAR_22689
Length=304

 Score = 84.7 bits (208),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 11/117 (9%)

Query  70   LRPLPKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129
            +R  P+  P+SF PYEALLET+LHELTHMVHGPHN+AFY      K E+E LM+RGL G 
Sbjct  68   IRLRPQHRPESFLPYEALLETMLHELTHMVHGPHNQAFY------KDEVESLMLRGLTGH  121

Query  130  EGVRFAAAGTGQRLGGDNISVPIR-----VAAVLAAKRREQYNSLLGGETSRRLGSL  181
            EG RF  AG G  +     ++ +R     +AAVLAA RRE+Y  LLGG TS+RLG++
Sbjct  122  EGARFQDAGDGYSIQTQTTAIAVRHTNDNLAAVLAAARREKYQRLLGGITSQRLGTV  178

>CCA17990
Length=283

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 83/146 (57%), Gaps = 4/146 (3%)

Query  70   LRPLPKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129
            +R  P R P +FYPYEALLETLLHELTH V+G H+EAFYK+  +LK E E LM+ GL G 
Sbjct  69   IRLRPSRKPDTFYPYEALLETLLHELTHNVYGQHDEAFYKFFAQLKKEAEDLMMNGLSGR  128

Query  130  EGVRFAAAGTGQRLGGDNISV-PIRVAAVLAAKRREQYNSLLGGETSRRLGSL--SAASN  186
             G  F  +G G  L  ++ S    R  A LAA  R +  +LL   ++  L  L   A   
Sbjct  129  SGALFMGSGRGHVLQPNSTSAGDYRHKAALAADIRAK-RTLLTKRSAHFLQGLDGQARKQ  187

Query  187  EIFNPQALRRKILEAAERRRRDNEHC  212
              F P  LR K  EAA++RR D   C
Sbjct  188  PKFTPSQLREKAYEAAKKRRLDAMQC  213

>SPRG_03281
Length=153

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)

Query  74   PKRTPKSFYPYEAlletllhelthMVHGPHNEAFYKYLDELKHEMEMLMVRGLVG  128
            P   P SF P+E LL T+LHEL HM  GPHN AFYK LDEL  EME LM +GL+G
Sbjct  72   PAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLMAQGLIG  126

>H310_04386
Length=523

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 28/61 (46%), Gaps = 0/61 (0%)

Query  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRGDT  300
            A+ +A DP+A  +I+ E  +    T+A + A+ DL D  G     D     G    RG  
Sbjct  268  AKLKAADPNAPKLILFESVNSMEGTVAPMHAICDLADKYGAMTFCDEVHAVGLYGNRGAG  327

Query  301  V  301
            +
Sbjct  328  I  328

>H257_16612
Length=521

 Score = 32.7 bits (73),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (47%), Gaps = 0/58 (0%)

Query  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRG  298
            A+ +A DP+A  +I+ E  +    T+A + A+ DL D  G     D     G    RG
Sbjct  266  AKLKAADPNAPKLILFESVNSMEGTVAPMHAICDLADKYGAMTFCDEVHAVGLYGNRG  323

>PYAP_21496
Length=554

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (47%), Gaps = 0/58 (0%)

Query  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRG  298
            A+ +A DP+A  +I+ E  +    TIA +  + DL D  G    +D     G    RG
Sbjct  277  AKLKAADPNAPKLILFESVNSMEGTIAPLHEICDLADKYGAMTFNDEVHAVGLYGNRG  334

>PHALS_01911
Length=1227

 Score = 32.0 bits (71),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 40/89 (45%), Gaps = 8/89 (9%)

Query  104  NEAFYKYLDELKHEMEMLMVRGLVGEEGVRFAAAGTGQRLGGDNISVPIRVAAVLAAKRR  163
            ++AFY     LK   E+     L+G     F  +     LG   + + I+   +   K  
Sbjct  714  HKAFY-----LKPGQELTFSMDLLGGLTTEFCLSQFWSALGDSIVKIEIQFHGI---KPD  765

Query  164  EQYNSLLGGETSRRLGSLSAASNEIFNPQ  192
            ++   ++GGE S ++   S+ SNEI  PQ
Sbjct  766  QEKIVIVGGEESHKVLVSSSVSNEILAPQ  794

>PPTG_03363
Length=431

 Score = 32.0 bits (71),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 0/46 (0%)

Query  103  HNEAFYKYLDELKHEMEMLMVRGLVGEEGVRFAAAGTGQRLGGDNI  148
            H EA YK ++EL  ++  LM +    +EG+    A   + L   N+
Sbjct  108  HKEALYKQVNELSSQLSTLMKKKEAAKEGMSVTQAAVWKALANRNL  153

>PYAR_15766
Length=544

 Score = 32.0 bits (71),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (47%), Gaps = 0/58 (0%)

Query  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRG  298
            A+ +A DP+A  +I+ E  +    TIA +  + DL D  G    +D     G    RG
Sbjct  266  AKLKAADPNAPKLILFESVNSMEGTIAPLHEICDLADKYGAMTFNDEVHAVGLYGNRG  323

>SPRG_08192
Length=528

 Score = 31.6 bits (70),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 0/61 (0%)

Query  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRGDT  300
            A+ +A DP+A  +I+ E  +    TIA +  + DL D  G     D     G    RG  
Sbjct  270  AKLKAADPNAPKLILFESVNSMEGTIAPMNEICDLADKYGAMTFCDEVHAVGLYGNRGAG  329

Query  301  V  301
            V
Sbjct  330  V  330

>SDRG_04896
Length=527

 Score = 31.6 bits (70),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 0/61 (0%)

Query  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRGDT  300
            A+ +A DP+A  +I+ E  +    TIA +  + DL D  G     D     G    RG  
Sbjct  269  AKLKAADPNAPKLILFESVNSMEGTIAPMNEICDLADKYGAMTFCDEVHAVGLYGNRGAG  328

Query  301  V  301
            V
Sbjct  329  V  329

>CCA18682
Length=535

 Score = 31.2 bits (69),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 0/58 (0%)

Query  241  ARQQAPDPSASDIIVLEEEDDAHETIANVPAVIDLLDDDGEEKHDDVPRRAGRKRKRG  298
            A+ +  DPS   +I+ E  +    TIA + A+ DL D  G     D     G    RG
Sbjct  262  AKLKKADPSTPKLILFESVNSMEGTIAPLHAICDLADKYGAMTFCDEVHAVGLYGNRG  319

>PYU1_G014099
Length=433

 Score = 31.2 bits (69),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 42/106 (40%), Gaps = 30/106 (28%)

Query  211  HCRNVLHPG---ASHEVLGIessdddedstsNGARQQAPDPSASDIIVLEEEDDAHETIA  267
            H RN L+ G   +SHE++                   AP P+ ++I+ L+      ET+ 
Sbjct  41   HKRNALYAGFHPSSHEII-----------------PSAPIPALAEIVDLDTAVRLMETLT  83

Query  268  NVPAVIDLLD----------DDGEEKHDDVPRRAGRKRKRGDTVDI  303
              P  ID  D             +E HD +P  +G  R R +  DI
Sbjct  84   ATPLTIDHADGTSAVVAVSYSKNQELHDRIPPPSGHGRHRRNHADI  129

Lambda      K        H        a         alpha
   0.316    0.134    0.389    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 18974086272

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40