Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_09252111471051055482e-73
PITG_13739111471051055048e-67
PHYSO_315017111471091065012e-66
PHYCA_535380111471081064882e-64
PHYRA_81675111471061064771e-62
PHYKE_5841111471211004391e-56
HYAP_08499111471081043753e-47
PHALS_11564111471071043745e-47
HYAP_08500652601721083752e-46
PYVX_20854111471041073451e-42
PYIR_15186111471091072991e-35
PYIW_14743111471051022982e-35
PYU1_G005963111471031002894e-34
PYAP_22846111471041012763e-32
PYAR_2320711147112822462e-27
CCA1752111147104952419e-27
CCI4423211147105802244e-24
SPRG_1288311147105882174e-23
SDRG_1491211147105882174e-23
H310_075671114798852095e-22
H257_073581114798852079e-22
PHALS_0647914755136621072e-06
PYVX_1818014755135721047e-06
PPTG_171261475513666961e-04
PYIR_224351561313967952e-04
PHYSO_3211551475513650933e-04
PHYCA_118341475513461933e-04
PYIW_199701475513056890.001
PYU1_G013186793911476880.001
PHYRA_959031475513446850.004
PYU1_G0017361475512356840.005
HYAP_071031475516456840.007
PHYKE_83921475513866830.007
PITG_1155594928844800.008
PYU1_G00921817518645800.010
PYIW_2750217518645800.010
PITG_184551475513260810.012
CCA175421475512065770.040
SDRG_0076394928543750.048
PYAP_177471475513463760.063
PHYSO_28898317518864740.069
PYAP_138941561312467740.098
H310_0091894928447710.16
PITG_0199217518844710.18
PYIW_18388593711458700.38
HYAP_11236793911266690.47
HYAP_11542797211266690.47
PYAP_2084717518664680.48
SDRG_0542012501211869690.50
PYU1_G00402732274072710.51
SPRG_0586412501211869690.51
PYU1_G011200593711467680.73
CCA201021340311468680.76
PPTG_194622470938333691.0
PPTG_194692471338333691.0
PYIW_205171561313467671.0
PHYRA_825765279814451671.2
SPRG_171331561311869661.2
SDRG_088921274488268651.3
SPRG_063351475512355661.4
H310_08324793911649661.5
PYVX_22540175110158651.6
PPTG_1958817518844641.7
H257_0403012501212167651.8
CCI4886815613109103651.8
SPRG_0294594928539641.9
PYIR_13291593710670652.0
H257_1621194928540642.1
CCI448201475512365652.3
PPTG_148282294911037642.3
PYIR_1688079399651632.9
H310_054801222849150623.7
H257_163191222849318624.1
CCA224011561310965624.2
PHYSO_355016793911165624.3
SPRG_00840254346537644.7
PHYSO_5143231416310467615.7
PYU1_G010655888053932636.8
SPRG_0270212339796254627.2
PPTG_09915527989651607.4
PHYKE_106771416240867627.4
PHYCA_101566793911265608.1
H310_0223565269943608.3
CCA26168210647568628.3
PHYSO_341187527989251599.0
PHYCA_55379217518844599.1
PYIW_16190933290656629.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_09252

Length=105
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPTG_09252                                                            215     2e-73
PITG_13739                                                            198     8e-67
PHYSO_315017                                                          197     2e-66
PHYCA_535380                                                          192     2e-64
PHYRA_81675                                                           188     1e-62
PHYKE_5841                                                            173     1e-56
HYAP_08499                                                            149     3e-47
PHALS_11564                                                           148     5e-47
HYAP_08500                                                            149     2e-46
PYVX_20854                                                            137     1e-42
PYIR_15186                                                            119     1e-35
PYIW_14743                                                            119     2e-35
PYU1_G005963                                                          115     4e-34
PYAP_22846                                                            110     3e-32
PYAR_23207                                                            99.4    2e-27
CCA17521                                                              97.4    9e-27
CCI44232                                                              90.9    4e-24
SPRG_12883                                                            88.2    4e-23
SDRG_14912                                                            88.2    4e-23
H310_07567                                                            85.1    5e-22
H257_07358                                                            84.3    9e-22
PHALS_06479                                                           45.8    2e-06
PYVX_18180                                                            44.7    7e-06
PPTG_17126                                                            41.6    1e-04
PYIR_22435                                                            41.2    2e-04
PHYSO_321155                                                          40.4    3e-04
PHYCA_11834                                                           40.4    3e-04
PYIW_19970                                                            38.9    0.001
PYU1_G013186                                                          38.5    0.001
PHYRA_95903                                                           37.4    0.004
PYU1_G001736                                                          37.0    0.005
HYAP_07103                                                            37.0    0.007
PHYKE_8392                                                            36.6    0.007
PITG_11555                                                            35.4    0.008
PYU1_G009218                                                          35.4    0.010
PYIW_27502                                                            35.4    0.010
PITG_18455                                                            35.8    0.012
CCA17542                                                              34.3    0.040
SDRG_00763                                                            33.5    0.048
PYAP_17747                                                            33.9    0.063
PHYSO_288983                                                          33.1    0.069
PYAP_13894                                                            33.1    0.098
H310_00918                                                            32.0    0.16 
PITG_01992                                                            32.0    0.18 
PYIW_18388                                                            31.6    0.38 
HYAP_11236                                                            31.2    0.47 
HYAP_11542                                                            31.2    0.47 
PYAP_20847                                                            30.8    0.48 
SDRG_05420                                                            31.2    0.50 
PYU1_G004027                                                          32.0    0.51 
SPRG_05864                                                            31.2    0.51 
PYU1_G011200                                                          30.8    0.73 
CCA20102                                                              30.8    0.76 
PPTG_19462                                                            31.2    1.0  
PPTG_19469                                                            31.2    1.0  
PYIW_20517                                                            30.4    1.0  
PHYRA_82576                                                           30.4    1.2  
SPRG_17133                                                            30.0    1.2  
SDRG_08892                                                            29.6    1.3  
SPRG_06335                                                            30.0    1.4  
H310_08324                                                            30.0    1.5  
PYVX_22540                                                            29.6    1.6  
PPTG_19588                                                            29.3    1.7  
H257_04030                                                            29.6    1.8  
CCI48868                                                              29.6    1.8  
SPRG_02945                                                            29.3    1.9  
PYIR_13291                                                            29.6    2.0  
H257_16211                                                            29.3    2.1  
CCI44820                                                              29.6    2.3  
PPTG_14828                                                            29.3    2.3  
PYIR_16880                                                            28.9    2.9  
H310_05480                                                            28.5    3.7  
H257_16319                                                            28.5    4.1  
CCA22401                                                              28.5    4.2  
PHYSO_355016                                                          28.5    4.3  
SPRG_00840                                                            29.3    4.7  
PHYSO_514323                                                          28.1    5.7  
PYU1_G010655                                                          28.9    6.8  
SPRG_02702                                                            28.5    7.2  
PPTG_09915                                                            27.7    7.4  
PHYKE_10677                                                           28.5    7.4  
PHYCA_101566                                                          27.7    8.1  
H310_02235                                                            27.7    8.3  
CCA26168                                                              28.5    8.3  
PHYSO_341187                                                          27.3    9.0  
PHYCA_553792                                                          27.3    9.1  
PYIW_16190                                                            28.5    9.9  

>PPTG_09252
Length=105

 Score = 215 bits (548),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%), Gaps = 0/105 (0%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI
Sbjct  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRDAIQPPPVHGGVNAKIISGGKKE  105
            TELSMYASLHPSLPNWSVEVGRDAIQPPPVHGGVNAKIISGGKKE
Sbjct  61   TELSMYASLHPSLPNWSVEVGRDAIQPPPVHGGVNAKIISGGKKE  105

>PITG_13739
Length=105

 Score = 198 bits (504),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 100/105 (95%), Gaps = 0/105 (0%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAET+EVLR+YRRILKLAQRYPS+KRESIIRDIKTEFHANK+LTDAQKIREELASVRAGI
Sbjct  1    MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRDAIQPPPVHGGVNAKIISGGKKE  105
            TELSMYASLHPSLPNWSVEVGRDAI PPP+HGGV  K++S  KKE
Sbjct  61   TELSMYASLHPSLPNWSVEVGRDAIHPPPMHGGVKTKVVSADKKE  105

>PHYSO_315017
Length=109

 Score = 197 bits (501),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 101/106 (95%), Gaps = 1/106 (1%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAETKEVLR+YRRILKLAQRYPSVKRESIIRDIKTEFHANK+LTDAQKIREELASVRAGI
Sbjct  1    MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRDAIQ-PPPVHGGVNAKIISGGKKE  105
             ELSMYASLHPSLPNWSVEVGRDAIQ PPPVHGGVNAK++  G K+
Sbjct  61   KELSMYASLHPSLPNWSVEVGRDAIQPPPPVHGGVNAKVVGDGNKD  106

>PHYCA_535380
Length=108

 Score = 192 bits (488),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 101/106 (95%), Gaps = 1/106 (1%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAETKEVLR+YRRILKLA RYPS+KRESIIRDIKTEFHANK+LTDAQ+IREELASVRAGI
Sbjct  1    MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRDAIQ-PPPVHGGVNAKIISGGKKE  105
             ELSMYA+LHPSLPNWSVEVGRDAIQ PPPVHGGV+AK++  GKKE
Sbjct  61   KELSMYANLHPSLPNWSVEVGRDAIQPPPPVHGGVSAKVVGDGKKE  106

>PHYRA_81675
Length=106

 Score = 188 bits (477),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 1/106 (1%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAETKEV+R+YRRILKLAQRYPS+KR SIIRDIKTEFHANK+LTDAQKIREELASVRAGI
Sbjct  1    MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRDAIQ-PPPVHGGVNAKIISGGKKE  105
             ELSMYASLHPSLPNWSVEVGRDAIQ PPPVHGGV+AK++   K E
Sbjct  61   KELSMYASLHPSLPNWSVEVGRDAIQPPPPVHGGVSAKVVGDDKLE  106

>PHYKE_5841
Length=121

 Score = 173 bits (439),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 91/100 (91%), Gaps = 1/100 (1%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           MAE KEV R+YRRILKLAQRYPSVKR+SIIRDIKTEFHA+K LTDAQKIREELAS RAGI
Sbjct  1   MAEVKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

Query  61  TELSMYASLHPSLPNWSVEVGRDAIQ-PPPVHGGVNAKII  99
            ELS YASLHPS  NWS+EVGRDAIQ PPPVHGGVNAK++
Sbjct  61  KELSQYASLHPSSVNWSIEVGRDAIQSPPPVHGGVNAKVV  100

>HYAP_08499
Length=108

 Score = 149 bits (375),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 1/104 (1%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAE  EVLR+YRRILKLAQRYPS+KR+SII DIK+EF AN+NL+DAQK+R+ELA V+AGI
Sbjct  1    MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRD-AIQPPPVHGGVNAKIISGGK  103
             ELSMYASLHPSLPNW++EVG D A  P  V  G + K I GG+
Sbjct  61   KELSMYASLHPSLPNWNIEVGHDVAPMPFDVQSGDDVKDIGGGE  104

>PHALS_11564
Length=107

 Score = 148 bits (374),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 83/104 (80%), Gaps = 1/104 (1%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAETK+VLR+YRR+LKLAQ YPS+KRE+IIRDIK EFHAN  +TDAQKI E +AS  AGI
Sbjct  1    MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRDAIQPPPVHGGVNAKIISGGKK  104
             ELSMYASLHPS PNWSVEVGRDAIQ   +  G   K++  G K
Sbjct  61   KELSMYASLHPSQPNWSVEVGRDAIQ-SQLREGSQVKVVRDGNK  103

>HYAP_08500
Length=172

 Score = 149 bits (375),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 88/108 (81%), Gaps = 3/108 (3%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAE  EVLR+YRRILKLAQRYPS+KR+SII DIK+EF AN+NL+DAQK+R+ELA V+AGI
Sbjct  65   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  124

Query  61   TELSMYASLHPSLPNWSVEVGRD-AIQPPPVHGGVNAKIISGG--KKE  105
             ELSMYASLHPSLPNW++EVG D A  P  V  G + K I GG  KKE
Sbjct  125  KELSMYASLHPSLPNWNIEVGHDVAPMPFDVQSGDDVKDIGGGEMKKE  172

>PYVX_20854
Length=104

 Score = 137 bits (345),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 5/107 (5%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MA+  EV+RLYRRILKLAQRYPSVKR+SI+RDIKTEFH NK L+DAQ++RE++ + RAGI
Sbjct  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRDAI--QPPPVHGGVNAKIISGGKKE  105
             ELS YA+LHPS  +W+VEVGRDA+    PP   G+      GGK+E
Sbjct  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKT---VGGKRE  104

>PYIR_15186
Length=109

 Score = 119 bits (299),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 2/107 (2%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAE KEV+R+YRRILKLA +YPS+KR +IIR+IK EFHANK+LTD  KI +++ S R GI
Sbjct  1    MAEAKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRDA--IQPPPVHGGVNAKIISGGKKE  105
             ELS Y +L+PS   W V+VGR+      P V  GV+AK++  G K+
Sbjct  61   VELSQYTNLNPSSMTWKVDVGREVGLGAGPAVSQGVSAKVVGSGGKD  107

>PYIW_14743
Length=105

 Score = 119 bits (298),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 1/102 (1%)

Query  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
            MAE KEV+RLYRRILKLA +YPS+KR +IIR+IK EFH NK LTD+ KI +++ S R GI
Sbjct  1    MAEAKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGI  60

Query  61   TELSMYASLHPSLPNWSVEVGRD-AIQPPPVHGGVNAKIISG  101
             ELS Y +L+PS   W V+VGR+  +  P +  GV+ K++ G
Sbjct  61   VELSQYTNLNPSSMTWKVDVGREVGVGGPAIGQGVSTKVVGG  102

>PYU1_G005963
Length=103

 Score = 115 bits (289),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 1/100 (1%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           M E KEV+R+YRRILKLA +YPS+KR +IIRDIK EF  NK+LTDA  I  ++ S R GI
Sbjct  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

Query  61  TELSMYASLHPSLPNWSVEVGRDAIQPPPVHGG-VNAKII  99
            ELS Y +L+PS   W V+VGR+  Q PP  G  VNAK++
Sbjct  61  VELSQYTNLNPSSMTWKVDVGREVGQGPPAGGPVVNAKVV  100

>PYAP_22846
Length=104

 Score = 110 bits (276),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 76/101 (75%), Gaps = 3/101 (3%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           MA+ ++VLRLYR ILKLA++YPSVKR++II+DIK EFH  K+ TDA+ I+ ++A+ +AGI
Sbjct  1   MADKQKVLRLYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGI  60

Query  61  TELSMYASLHPSLPNWSVEVGRDAIQPPPVH--GGVNAKII  99
            ELSMYA+L+PS   W+V VGR+ + P      G  N K++
Sbjct  61  KELSMYATLNPSSTAWTVGVGRE-VSPEATQAAGDTNTKVV  100

>PYAR_23207
Length=112

 Score = 99.4 bits (246),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 65/82 (79%), Gaps = 0/82 (0%)

Query  2   AETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGIT  61
           A ++EV+RLYRR+L+LA++YPS+KR++++ DIK EFH  K+LTDA  I  ++A+ +AGI 
Sbjct  5   ATSREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIK  64

Query  62  ELSMYASLHPSLPNWSVEVGRD  83
           ELS YASL     +W+V+VGR+
Sbjct  65  ELSQYASLRSDAMSWTVDVGRE  86

>CCA17521
Length=104

 Score = 97.4 bits (241),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (71%), Gaps = 0/95 (0%)

Query  3   ETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITE  62
           E  ++  LYRRIL+LA+RYPS+KR++II DI+ EF  ++++T A  I  ++AS  AGI E
Sbjct  2   ERTQIFGLYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKE  61

Query  63  LSMYASLHPSLPNWSVEVGRDAIQPPPVHGGVNAK  97
           L MYA+L+P  PNW+VE+GR + +P  +   V  K
Sbjct  62  LLMYANLNPVDPNWTVEIGRPSEKPADMDRDVKIK  96

>CCI44232
Length=105

 Score = 90.9 bits (224),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 59/80 (74%), Gaps = 0/80 (0%)

Query  3   ETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITE  62
           E  ++  LYRRIL+LA+RYPS+KR++I+ DI+ EF  ++N+     I +++AS  AGI E
Sbjct  2   ERAQIFGLYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKE  61

Query  63  LSMYASLHPSLPNWSVEVGR  82
           L MYA+L+P   NW+VE+GR
Sbjct  62  LMMYANLNPVEANWTVEIGR  81

>SPRG_12883
Length=105

 Score = 88.2 bits (217),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 3/88 (3%)

Query  5   KEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELS  64
           + V ++YRR+LKLAQR+PS+K++ ++ DIK EFH N +LTDA KI+E++A    GI +L 
Sbjct  4   RSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQLG  63

Query  65  MYASLHPSLPNWSVEVGRDAI---QPPP  89
            Y  L P+  +W+VE+ +D     QP P
Sbjct  64  QYVHLDPTAHSWTVEMEKDPFGQNQPRP  91

>SDRG_14912
Length=105

 Score = 88.2 bits (217),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 3/88 (3%)

Query  5   KEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELS  64
           + V ++YRR+LKLAQR+PS+K++ ++ DIK EFH N +LTDA KI+E++A    GI +L 
Sbjct  4   RSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQLG  63

Query  65  MYASLHPSLPNWSVEVGRDAI---QPPP  89
            Y  L P+  +W+VE+ +D     QP P
Sbjct  64  QYVHLDPTAHSWTVEMEKDPFGQNQPRP  91

>H310_07567
Length=98

 Score = 85.1 bits (209),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 60/85 (71%), Gaps = 0/85 (0%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           M+ +  V ++YRR+L+LA+++PS+KR+ ++ DIK EFH NK LTD  KI+E++     GI
Sbjct  1   MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGI  60

Query  61  TELSMYASLHPSLPNWSVEVGRDAI  85
            +L+ Y SL P+  +WSV++ +D  
Sbjct  61  QQLNQYVSLDPNAQHWSVDMEKDPF  85

>H257_07358
Length=98

 Score = 84.3 bits (207),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 60/85 (71%), Gaps = 0/85 (0%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           M+ +  V ++YRR+L+LA ++PS+K++ +++DIK EFH NK LTD  KI+E++     GI
Sbjct  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGI  60

Query  61  TELSMYASLHPSLPNWSVEVGRDAI  85
            +L+ Y +L P+  +WSV++ +D  
Sbjct  61  QQLNQYVALDPNAQSWSVDMDKDPF  85

>PHALS_06479
Length=136

 Score = 45.8 bits (107),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 41/62 (66%), Gaps = 0/62 (0%)

Query  4   TKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITEL  63
           T+E+  LY+++L+LAQ  P  KR+S I  I+ EF  +++LTD +++ E +   ++ ++ L
Sbjct  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64

Query  64  SM  65
            +
Sbjct  65  KI  66

>PYVX_18180
Length=135

 Score = 44.7 bits (104),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (57%), Gaps = 0/72 (0%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           MA   E+  LY+++L+LAQ  P  KR S +  I+TEF ++  +TDA ++ + L   ++ +
Sbjct  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60

Query  61  TELSMYASLHPS  72
             L +     PS
Sbjct  61  GYLKIVTPRGPS  72

>PPTG_17126
Length=136

 Score = 41.6 bits (96),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 40/66 (61%), Gaps = 1/66 (2%)

Query  1   MAETKEVLR-LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAG  59
           MAE    LR LY+++L+LAQ  P  KR+S I  I+ +F  + +LTD Q++   +   ++ 
Sbjct  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60

Query  60  ITELSM  65
           ++ L +
Sbjct  61  LSYLKI  66

>PYIR_22435
Length=139

 Score = 41.2 bits (95),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (60%), Gaps = 1/67 (1%)

Query  5   KEVLRLYRRILKLAQRYPSVKRESIIRD-IKTEFHANKNLTDAQKIREELASVRAGITEL  63
           +EVL LY + L+ A+R P+ ++  ++R  +K +FH + ++ D  +IR  LA  R  +  +
Sbjct  12  REVLGLYAQCLRSARRCPAWEQREMMRAYVKMKFHHDADVQDPARIRSLLADAREELERM  71

Query  64  SMYASLH  70
             Y S++
Sbjct  72  DYYHSVY  78

>PHYSO_321155
Length=136

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query  1   MAETKEVLR-LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKI  49
           MAE    LR LY+++L+LAQ  P  KRE  +  I+ EF ++ +LTD + +
Sbjct  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGV  50

>PHYCA_11834
Length=134

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 40/61 (66%), Gaps = 0/61 (0%)

Query  5   KEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELS  64
           +E+  LY+++L+LAQ  P  KR++ I  I+ EF ++++LTD +++ + L   ++ +  L 
Sbjct  4   RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63

Query  65  M  65
           +
Sbjct  64  I  64

>PYIW_19970
Length=130

 Score = 38.9 bits (89),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 37/56 (66%), Gaps = 0/56 (0%)

Query  10  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
           +Y+++L+LA+  P  KRE+  + I++EF + K L+D +++   LA  ++ I+ L +
Sbjct  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

>PYU1_G013186
Length=114

 Score = 38.5 bits (88),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 47/76 (62%), Gaps = 10/76 (13%)

Query  1   MAETKEVLRLYRRILKLAQRYPS--VKRESIIRDIKTEFHANKNLTDAQKIREELASVRA  58
           MAE +    LYRR+L++A+ +    V+++ I R+ +T F   + +TDA++IRE    V+A
Sbjct  1   MAEARA---LYRRVLRVARTWEGGYVEQQWIRREARTRFEEQRAITDARRIRE---LVQA  54

Query  59  GITELSMYASLHPSLP  74
           G  ++ +  +LH  +P
Sbjct  55  GHDQVDV--ALHYQIP  68

>PHYRA_95903
Length=134

 Score = 37.4 bits (85),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 31/46 (67%), Gaps = 0/46 (0%)

Query  4   TKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKI  49
            +E+  LY+++L+LAQ  P  KR+  +  I+ EF +++ LTD +++
Sbjct  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEV  48

>PYU1_G001736
Length=123

 Score = 37.0 bits (84),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  10  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
           +Y+++LKLAQ  P+ KR++ +  I+ EF  +    D ++I   LA  ++ I  L +
Sbjct  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64

>HYAP_07103
Length=164

 Score = 37.0 bits (84),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  10  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
           LY+++L+LAQ  P  KR+  +  I+ EF  + +LTD +++   L   ++ I  L +
Sbjct  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59

>PHYKE_8392
Length=138

 Score = 36.6 bits (83),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 1/66 (2%)

Query  1   MAETKEVLR-LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAG  59
           MAE    LR LY+++L++AQ  P  KR   +  I+ EF  + +L+D +++ + L   ++ 
Sbjct  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSS  60

Query  60  ITELSM  65
           ++ L +
Sbjct  61  LSYLKI  66

>PITG_11555
Length=88

 Score = 35.4 bits (80),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNL  43
           MA +  VLRLYR +L+ A ++ +   R    R IK +FH NK L
Sbjct  1   MASSSSVLRLYREMLRNAAKFETYNFRAYATRRIKEDFHKNKTL  44

>PYU1_G009218
Length=86

 Score = 35.4 bits (80),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNLT  44
           MA  ++VLRLY+ +L+ A ++ S   R+   R +K +FH NK L 
Sbjct  1   MASKQQVLRLYKEMLRNASKFESYNYRKYAERRVKEDFHKNKQLA  45

>PYIW_27502
Length=86

 Score = 35.4 bits (80),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNLT  44
           MA  ++VLRLY+ +L+ A ++ S   R+   R +K +FHAN  L 
Sbjct  1   MASKQQVLRLYKEMLRNASKFESYNYRKYAERRVKEDFHANAGLA  45

>PITG_18455
Length=132

 Score = 35.8 bits (81),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 37/60 (62%), Gaps = 0/60 (0%)

Query  6   EVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
           E+  LY+++L+LAQ  P  KR+S I  I+ +F ++ + TD +++   +   ++ ++ L +
Sbjct  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62

>CCA17542
Length=120

 Score = 34.3 bits (77),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 42/65 (65%), Gaps = 3/65 (5%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           M++T+ +   Y+R+++LA+  P+ K+ + + +I+TEF  +++++D  ++ + L   ++ I
Sbjct  1   MSDTRSI---YKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57

Query  61  TELSM  65
             L +
Sbjct  58  GYLKI  62

>SDRG_00763
Length=85

 Score = 33.5 bits (75),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKN  42
           MA+ ++VL LYR +L+ A +Y +   R    R IK++FHA K+
Sbjct  1   MAQQQKVLSLYRTMLRQAAQYENYTFRSYAQRRIKSDFHAKKS  43

>PYAP_17747
Length=134

 Score = 33.9 bits (76),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 38/63 (60%), Gaps = 1/63 (2%)

Query  4   TKEVLRLYRRILKLAQRYPSV-KRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITE  62
           T E+  LY+R+L+LA+  P   KRE+ ++ I++EF + K+  D +++   +   +A I  
Sbjct  3   TSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGY  62

Query  63  LSM  65
           L +
Sbjct  63  LKI  65

>PHYSO_288983
Length=88

 Score = 33.1 bits (74),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (52%), Gaps = 4/64 (6%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNLTDAQKIRE---ELASV  56
           MA +  VLRLYR +L+ A ++ +   R    R +K +F  NK L      +E   E A  
Sbjct  1   MASSSSVLRLYREMLRNAAKFETYNFRSYATRRVKEDFRKNKTLQAGSPEQEKALEFARE  60

Query  57  RAGI  60
           +AG+
Sbjct  61  QAGV  64

>PYAP_13894
Length=124

 Score = 33.1 bits (74),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query  5   KEVLRLYRRILKLAQRYPSV-KRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITEL  63
           KEVL LYR  L+ A++ P   +RE +   ++ +F       D  +I+  LA  R  + ++
Sbjct  7   KEVLGLYRACLRSARKCPEWEQREMMKTYVRMKFRHEMYTKDTTRIKRMLADAREELEQM  66

Query  64  SMYASLH  70
             Y S++
Sbjct  67  EYYHSVY  73

>H310_00918
Length=84

 Score = 32.0 bits (71),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (60%), Gaps = 1/47 (2%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNLTDA  46
           MA   EVLRLY+ +L  A ++ +   R   +R IK +F AN +L D+
Sbjct  1   MARRSEVLRLYKDLLLEAAQFQNYTFRTYSLRRIKADFRANASLRDS  47

>PITG_01992
Length=88

 Score = 32.0 bits (71),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 1/44 (2%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNL  43
           M  +  VLRLYR +L+ A  + +   R    R +K EFH NK L
Sbjct  1   MVSSSSVLRLYREMLRNAANFENYNFRAYATRRVKEEFHKNKVL  44

>PYIW_18388
Length=114

 Score = 31.6 bits (70),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (52%), Gaps = 1/58 (2%)

Query  6   EVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITEL  63
           +V  LYRR L + + YP +    +    KT F  NKNLTD  +I+  +   R  + E+
Sbjct  4   KVRDLYRRFLHVGKDYP-LGLAYVREKAKTAFFKNKNLTDPVEIKRAVKKGRWMVQEM  60

>HYAP_11236
Length=112

 Score = 31.2 bits (69),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 7/66 (11%)

Query  7   VLRLYRRILKLAQRYP--SVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELS  64
            L LYRRIL++A+ +    V+++ I  + +  F  N++L+DA  I E   +VR G  ++ 
Sbjct  2   ALSLYRRILRVARTWEGGCVEQKWIRDEARRRFEDNRSLSDAAAIEE---AVREGHNQVD  58

Query  65  MYASLH  70
           +  +LH
Sbjct  59  V--ALH  62

>HYAP_11542
Length=112

 Score = 31.2 bits (69),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 7/66 (11%)

Query  7   VLRLYRRILKLAQRYP--SVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELS  64
            L LYRRIL++A+ +    V+++ I  + +  F  N++L+DA  I E   +VR G  ++ 
Sbjct  2   ALSLYRRILRVARTWEGGCVEQKWIRDEARRRFEDNRSLSDAAAIEE---AVREGHNQVD  58

Query  65  MYASLH  70
           +  +LH
Sbjct  59  V--ALH  62

>PYAP_20847
Length=86

 Score = 30.8 bits (68),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNL---TDAQKIREELASV  56
           MA  + VLRLY+ +L+ A  + S   R   +R ++T+F  NK L   +  Q+   E+A  
Sbjct  1   MATKQAVLRLYKDMLRDAVTFESYNYRSYAVRRVRTDFRKNKALVVGSAEQQKALEVAME  60

Query  57  RAGI  60
           +AG+
Sbjct  61  QAGV  64

>SDRG_05420
Length=118

 Score = 31.2 bits (69),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 37/69 (54%), Gaps = 1/69 (1%)

Query  5   KEVLRLYRRILKLAQRYPSVKRESIIRD-IKTEFHANKNLTDAQKIREELASVRAGITEL  63
           +EV+++YR  L+ A R P     + +R  ++ +F    ++ DA+ I   LA  +  +  +
Sbjct  6   REVVQVYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLADAKEELERM  65

Query  64  SMYASLHPS  72
           + Y S++ S
Sbjct  66  NYYHSMYQS  74

>PYU1_G004027
Length=740

 Score = 32.0 bits (71),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 10/72 (14%)

Query  41   KNLTDA-QKIREELASVRAGITELSMYASLHPSLPNWSVE---------VGRDAIQPPPV  90
            KN+TD  Q ++E++ASVR       M+A +   +  W  E         VG   +   P 
Sbjct  572  KNVTDELQHLQEQIASVRKQFVTAEMFADIVRQMETWKTEHDKKQPAVVVGHRYMTGAPS  631

Query  91   HGGVNAKIISGG  102
             G +N+ I  G 
Sbjct  632  SGVLNSPITPGS  643

>SPRG_05864
Length=118

 Score = 31.2 bits (69),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 37/69 (54%), Gaps = 1/69 (1%)

Query  5   KEVLRLYRRILKLAQRYPSVKRESIIRD-IKTEFHANKNLTDAQKIREELASVRAGITEL  63
           +EVL++YR  L+ A R P     + +R  ++ +F    ++ DA+ I   L+  +  +  +
Sbjct  6   REVLQVYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLSDAKEELERM  65

Query  64  SMYASLHPS  72
           + Y S++ S
Sbjct  66  NYYHSMYKS  74

>PYU1_G011200
Length=114

 Score = 30.8 bits (68),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query  10  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVR------AGITEL  63
           LYRR L + + YP +    +   +KT F  N++LTD  +I++ +   R       G+ +L
Sbjct  8   LYRRFLHVGKDYP-LGLPYVREKVKTAFLKNRDLTDPLEIKKAIHKGRWMVQEMIGVIQL  66

Query  64  SMYASLH  70
             Y +L+
Sbjct  67  KKYRTLN  73

>CCA20102
Length=114

 Score = 30.8 bits (68),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 19/68 (28%), Positives = 36/68 (53%), Gaps = 4/68 (6%)

Query  8   LRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSMYA  67
           L+ +R   ++    P+  R  I R I+TEF   + + D ++++  L   R G+ +L   +
Sbjct  18  LKQFRDFQRVTAALPTSTRSDIRRQIRTEFEKCRFVEDDEQVQSLL---RYGMEQLKHVS  74

Query  68  SL-HPSLP  74
           SL H ++P
Sbjct  75  SLVHTAVP  82

>PPTG_19462
Length=383

 Score = 31.2 bits (69),  Expect = 1.0, Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 24/33 (73%), Gaps = 0/33 (0%)

Query  5    KEVLRLYRRILKLAQRYPSVKRESIIRDIKTEF  37
            + V R+ RRI +LA+R+P++K + +  D+KT F
Sbjct  244  ESVRRIARRIEELAERHPTLKIKLLKGDVKTAF  276

>PPTG_19469
Length=383

 Score = 31.2 bits (69),  Expect = 1.0, Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 24/33 (73%), Gaps = 0/33 (0%)

Query  5    KEVLRLYRRILKLAQRYPSVKRESIIRDIKTEF  37
            + V R+ RRI +LA+R+P++K + +  D+KT F
Sbjct  244  ESVRRIARRIEELAERHPTLKIKLLKGDVKTAF  276

>PYIW_20517
Length=134

 Score = 30.4 bits (67),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 36/67 (54%), Gaps = 1/67 (1%)

Query  5   KEVLRLYRRILKLAQRYPSV-KRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITEL  63
           ++VL LY + L+ A+R P+  +RE +   +K +F  +  + D  +IR  LA     +  +
Sbjct  9   RQVLGLYAQCLRSARRCPAWEQREMMKAYVKMKFRHDAGVQDPARIRSLLADASEELERM  68

Query  64  SMYASLH  70
             Y +++
Sbjct  69  DYYHTVY  75

>PHYRA_82576
Length=144

 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (53%), Gaps = 6/51 (12%)

Query  5    KEVLRLYRRILKLAQRYPSVKRES------IIRDIKTEFHANKNLTDAQKI  49
            KEVLRLYR IL+  + +P +  +       + ++ + E   N+  TD + I
Sbjct  60   KEVLRLYREILRTTRMFPHLNEQGQPWSTVLHKNARMEIEQNRYETDGETI  110

>SPRG_17133
Length=118

 Score = 30.0 bits (66),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 17/69 (25%), Positives = 37/69 (54%), Gaps = 1/69 (1%)

Query  5   KEVLRLYRRILKLAQRYPSVKRESIIRD-IKTEFHANKNLTDAQKIREELASVRAGITEL  63
           +EVL++YR  L+ A R P     + +R  ++ +F    ++ DA+ I   L+  +  +  +
Sbjct  6   REVLQVYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLSDAKEELERM  65

Query  64  SMYASLHPS  72
           + Y S++ +
Sbjct  66  NYYHSMYKT  74

>SDRG_08892
Length=82

 Score = 29.6 bits (65),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           M      LRLYR I + + R+P +  + I  + +  F   ++ T+A + +  +A   A +
Sbjct  1   MMAGSHALRLYRAIFETSARFPPLMAKKIRFNARELFRLRRHETNAARCKRFVADGWADV  60

Query  61  TELSMYAS  68
             L   AS
Sbjct  61  ATLETIAS  68

>SPRG_06335
Length=123

 Score = 30.0 bits (66),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 0/55 (0%)

Query  11  YRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
           Y+++LKLA+  P  +R   +  ++TEF A+      +++ + L   ++ I+ L +
Sbjct  9   YKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKI  63

>H310_08324
Length=116

 Score = 30.0 bits (66),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query  7   VLRLYRRILKLAQRY--PSVKRESIIRDIKTEFHANKNLTDAQKIREEL  53
            L LYRRIL++A+ +  P  +RE I ++ +  F AN++L     I   L
Sbjct  8   ALALYRRILRVARTWEGPEKEREYIKQEGRRAFEANRHLKRVDDIEHAL  56

>PYVX_22540
Length=101

 Score = 29.6 bits (65),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 15/58 (26%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK---------------RESIIRDIKTEFHANKNL  43
           M+ ++ VLRLYR +L+ A ++   +               R   +R +K +FH NK L
Sbjct  1   MSSSQNVLRLYREMLRNASKFEPYRELTTCFTRCKQSYNFRSYAVRRVKEDFHKNKAL  58

>PPTG_19588
Length=88

 Score = 29.3 bits (64),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 1/44 (2%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNL  43
           MA +  VLRLYR +L+ A ++ +   R    R ++ +F  NK L
Sbjct  1   MASSSSVLRLYREMLRNAAKFETYNFRAYATRRVREDFRKNKAL  44

>H257_04030
Length=121

 Score = 29.6 bits (65),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 34/67 (51%), Gaps = 1/67 (1%)

Query  5   KEVLRLYRRILKLAQRYPS-VKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITEL  63
           +EVL +Y+  L  A + P  V RE++    + +F    +L D Q ++  LA  +  +  +
Sbjct  6   REVLHVYKACLVSASKCPQHVHRETMRAYARLKFRDKMHLRDVQAVKLCLADAKEELERM  65

Query  64  SMYASLH  70
             Y S++
Sbjct  66  DYYHSMY  72

>CCI48868
Length=109

 Score = 29.6 bits (65),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (46%), Gaps = 5/103 (5%)

Query  7    VLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
            VLRLYR  L+ A++ P  + RE +   I  +F   KNL DA  I+  L      +  +  
Sbjct  5    VLRLYRDCLRSARKCPEWQHREMMKTYIALKFRDQKNLRDAGAIKLLLREGNEELDRMRY  64

Query  66   YASLHP-SLPNWSVEVGRDAIQPPPVHGGVNAKIIS--GGKKE  105
            Y  ++   + N      R  +    V+  ++AK  +  G K+E
Sbjct  65   YHKMYQIKIQNKEQHQDR-CLNCNLVYEPIHAKFCAQCGSKRE  106

>SPRG_02945
Length=85

 Score = 29.3 bits (64),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (62%), Gaps = 1/39 (3%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFH  38
           MA+ ++VL LYR +L+ A +Y +   R    R IK +FH
Sbjct  1   MAQQQKVLSLYRTMLRQAAQYENYTFRSYAQRRIKADFH  39

>PYIR_13291
Length=106

 Score = 29.6 bits (65),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (49%), Gaps = 13/70 (19%)

Query  10  LYRRILKLAQRYP---SVKRESIIRDIKTEFHANKNLTDAQKIREELASVR------AGI  60
           LY+R L + + YP   +  RE +    K  F  NK+LTD  +I+  +   R       G+
Sbjct  4   LYKRFLYVGRDYPLGLAYVREKV----KIAFFKNKDLTDQTEIKRAIKKGRWMVQEMIGV  59

Query  61  TELSMYASLH  70
            +L  Y +L+
Sbjct  60  IQLKKYRTLN  69

>H257_16211
Length=85

 Score = 29.3 bits (64),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 1/40 (3%)

Query  2   AETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHAN  40
           A + EVLRLYR +L+ A ++ +   R    R IK +F AN
Sbjct  3   ARSTEVLRLYRDLLREAAQFQNYTFRTYSQRRIKADFRAN  42

>CCI44820
Length=123

 Score = 29.6 bits (65),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 36/65 (55%), Gaps = 0/65 (0%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60
           M    E  R++++++KLA+  P  K+   + +I+ EF  ++++ D  ++ + L   ++ I
Sbjct  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60

Query  61  TELSM  65
             L +
Sbjct  61  GYLKI  65

>PPTG_14828
Length=110

 Score = 29.3 bits (64),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  2   AETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFH  38
           A   + + + RR+L+  +RYP     ++I DI   FH
Sbjct  55  ATWNQFVSIARRVLEFRRRYPGYTIYAMIADIADAFH  91

>PYIR_16880
Length=96

 Score = 28.9 bits (63),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (55%), Gaps = 5/51 (10%)

Query  24  VKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSMYASLHPSLP  74
           V+++ I R+ +T F  N+ L DA+KIRE + +    +       +LH  +P
Sbjct  5   VEQQWIKREARTRFEENRKLRDARKIRELVQAAHDQVD-----VALHYQIP  50

>H310_05480
Length=91

 Score = 28.5 bits (62),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 6/50 (12%)

Query  6   EVLRLYRRILKLAQRY--PSVKRESIIRDIKT----EFHANKNLTDAQKI  49
           EVLRLYR IL+ A+R+  P+ K ES  + + T    E   ++  TD++ I
Sbjct  10  EVLRLYREILRTARRFQWPNEKGESWAKILSTNARMEIEQSRLDTDSEVI  59

>H257_16319
Length=93

 Score = 28.5 bits (62),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)

Query  4   TKEVLRLYRRILKLAQRY  21
           T EVLRLYR IL+ A+R+
Sbjct  8   TSEVLRLYREILRTARRF  25

>CCA22401
Length=109

 Score = 28.5 bits (62),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 33/65 (51%), Gaps = 4/65 (6%)

Query  7   VLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
           VLRLYR  L+ A++ P  + RE +   IK +F   ++L D + I+     +R G  EL  
Sbjct  5   VLRLYRDCLRSARKCPEWQNREMVKAYIKLKFREQQSLRDPRAIK---LLLREGNEELDR  61

Query  66  YASLH  70
               H
Sbjct  62  MQYYH  66

>PHYSO_355016
Length=111

 Score = 28.5 bits (62),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 7/65 (11%)

Query  8   LRLYRRILKLAQRYP--SVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
           L LYRRIL++A+ +   +V+++ I  + +  F  N++L D   I E   +VR G  ++ +
Sbjct  3   LSLYRRILRVARTWEGGAVEQDWIRAEARRRFEENRSLRDPTAIEE---AVRQGHNQVDV  59

Query  66  YASLH  70
             +LH
Sbjct  60  --ALH  62

>SPRG_00840
Length=465

 Score = 29.3 bits (64),  Expect = 4.7, Method: Composition-based stats.
 Identities = 14/37 (38%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  36   EFHANKNLTDAQKIREELASVRAGITELSMYASLHPS  72
            E+ ++K LTDA +I E + S    +TE+   A LH +
Sbjct  154  EYASSKRLTDAWRIYETIKSKSLDVTEIEFTALLHAA  190

>PHYSO_514323
Length=104

 Score = 28.1 bits (61),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (54%), Gaps = 2/67 (3%)

Query  4   TKEVLRLYRRILKLAQRY--PSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGIT  61
           T+  ++LYR  ++LA+     S K ++I   ++ EF   ++ TD +KI    A+   G++
Sbjct  8   TRTTIQLYRDCMRLAKHIGGNSKKGQAIKELVRREFEKGRSETDPEKIEALKANAVRGLS  67

Query  62  ELSMYAS  68
              M A+
Sbjct  68  NYLMLAN  74

>PYU1_G010655
Length=539

 Score = 28.9 bits (63),  Expect = 6.8, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 17/32 (53%), Gaps = 0/32 (0%)

Query  67   ASLHPSLPNWSVEVGRDAIQPPPVHGGVNAKI  98
            A +HP LP+W + +     Q P    GVNA I
Sbjct  127  AEIHPLLPHWKIGITFLGKQKPVTRLGVNATI  158

>SPRG_02702
Length=962

 Score = 28.5 bits (62),  Expect = 7.2, Method: Composition-based stats.
 Identities = 14/54 (26%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query  24   VKRESIIRDIKTEFHANK---NLTDAQKIREELAS--VRAGITELSMYASLHPS  72
            V+  +++R+I  E HAN     LT  + ++ E+ +  +R   T+  ++ ++HP+
Sbjct  359  VRAIALLREISLEVHANHTDLQLTQLRTLQAEMEALLIRFQATQTKLFLTMHPT  412

>PPTG_09915
Length=96

 Score = 27.7 bits (60),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (51%), Gaps = 6/51 (12%)

Query  5   KEVLRLYRRILKLAQRYPSVKRESII------RDIKTEFHANKNLTDAQKI  49
           KEVLRLYR IL+  + +P    +  +      ++ + E   N+  TD + I
Sbjct  8   KEVLRLYREILRTTRMFPHRNEQGQLWSDVLHKNARMEIEQNRYETDGETI  58

>PHYKE_10677
Length=408

 Score = 28.5 bits (62),  Expect = 7.4, Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 2/67 (3%)

Query  4   TKEVLRLYRRILKLAQRY--PSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGIT  61
           T+  ++LYR  ++LA+     S K  +I + ++ EF   +  TD +KI    A+   G++
Sbjct  8   TRTTIQLYRDCMRLAKHIGGSSKKGLAIKQLVRREFEKGRKETDPEKIEALKANAIRGLS  67

Query  62  ELSMYAS  68
              M A+
Sbjct  68  NYLMLAN  74

>PHYCA_101566
Length=112

 Score = 27.7 bits (60),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 7/65 (11%)

Query  8   LRLYRRILKLAQRYPS--VKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65
           L LYRRIL++A+ +    V++  I  + +  F  N+ LT+   I E   +VR G  ++ +
Sbjct  3   LALYRRILRVARTWEGGYVEQNWIRAEARRRFEENRTLTNPAAIEE---AVRQGHNQVDV  59

Query  66  YASLH  70
             +LH
Sbjct  60  --ALH  62

>H310_02235
Length=99

 Score = 27.7 bits (60),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  8   LRLYRRILKLAQRYPSVKR-ESIIRDIKTEFHANKNLTDAQKI  49
           L LYR+I + A R P+  R E + R +++E+   ++ TD ++I
Sbjct  24  LSLYRKIYRTAGRMPTKDRTEFVRRRLRSEYDKYRHETDPERI  66

>CCA26168
Length=475

 Score = 28.5 bits (62),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query  12   RRILKLAQRYPSVKRESIIR----DIKTEFHANKNLTDAQKIR-EELASVRAGITELSMY  66
            RRIL+   R    +RE  IR    D++ +  A   L   ++ R EELAS++A  T+    
Sbjct  270  RRILEENTRSIQARREQKIREQEQDVQLQHQAAALLDKQERQRQEELASIQAKQTQRVRL  329

Query  67   ASLHPSLP  74
            A LH   P
Sbjct  330  ALLHVKTP  337

>PHYSO_341187
Length=92

 Score = 27.3 bits (59),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (53%), Gaps = 6/51 (12%)

Query  5   KEVLRLYRRILKLAQRYP------SVKRESIIRDIKTEFHANKNLTDAQKI  49
           KEVLRLYR IL+  + +P       +  + + ++ + E   N+  TD + I
Sbjct  7   KEVLRLYREILRTTRMFPHRNEQGQLWSDVLQKNARMEIEQNRYETDGETI  57

>PHYCA_553792
Length=88

 Score = 27.3 bits (59),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 1/44 (2%)

Query  1   MAETKEVLRLYRRILKLAQRYPSVK-RESIIRDIKTEFHANKNL  43
           M+ +  VLRLYR +L+ A ++ +   R    R +K +F  N  L
Sbjct  1   MSSSSSVLRLYREMLRNAAKFETYNFRAYATRRVKEDFRKNSAL  44

>PYIW_16190
Length=2906

 Score = 28.5 bits (62),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (52%), Gaps = 0/56 (0%)

Query  6    EVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGIT  61
            +V+ +  R ++L QR  + KRE   +  + E        D Q +R ++A VRA +T
Sbjct  206  QVVEVKMRQVELFQRLETAKREGAAQMEQLEHDLRDAHDDNQNLRTQVAEVRAHVT  261

Lambda      K        H        a         alpha
   0.315    0.132    0.369    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3348558180

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40