Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_001334587022422411353e-159
PPTG_13715226065182285491e-66
PPTG_20797255314182225108e-62
PHYSO_284721471993202265002e-61
PPTG_16521236144022285021e-60
PHYSO_253880462503732204878e-59
PHYSO_340857527445272264978e-59
PHYRA_82588595554492204902e-58
PHYSO_288643476362702264754e-58
PHYSO_520761595554842094887e-58
PHYSO_287026200132912164749e-58
PPTG_03030187994582194851e-57
PPTG_21726263924532264832e-57
PHYSO_286678475033252314725e-57
PHYSO_286888237683202264715e-57
PHYSO_288834476933112264662e-56
PHYSO_285295209434042194723e-56
PHYSO_286047473903202264593e-55
PHYSO_292782478023202264584e-55
PHYSO_258511466516662094786e-55
PHYSO_289169477483282344561e-54
PHYSO_260754467995012194653e-54
PHYSO_286161474203202264524e-54
PHYSO_245860456254772164554e-53
PPTG_02862187254562234545e-53
PHYSO_334653404046102194573e-52
PHYSO_288799476813142384375e-52
PHYSO_284516471743462524396e-52
PHYSO_285754473474022294411e-51
PPTG_14654229174802454442e-51
PPTG_01146182053451584335e-51
PPTG_17033593051911624121e-49
PPTG_00493578492201624071e-48
PHYSO_248221458254782164232e-48
PPTG_13610566633071624123e-48
PPTG_12744473471601623977e-48
PPTG_05227195815072264219e-48
PHYSO_326975507254722164181e-47
PHYSO_288514476202471623978e-47
PHYCA_100643404042141403922e-46
PHYCA_123222425712521273927e-46
PPTG_03398177954982264051e-45
PPTG_16734236653462343943e-45
PHYSO_284383471473002263843e-44
PHYSO_254622463234052193731e-41
PHYSO_286113474083791913694e-41
PHYSO_260684467914512193716e-41
PPTG_15227231105182283642e-39
PPTG_17803240852332233411e-38
H257_098251424714622263533e-38
PPTG_18543243583352233421e-37
PPTG_08830209434052263346e-36
PPTG_12757222774202263341e-35
PHYSO_337039521744502153289e-35
PPTG_10216213773271473221e-34
PHYCA_120756456252361253151e-34
PHYSO_475994890132481253161e-34
PPTG_13171224532882173172e-34
PHYCA_109215413422451253142e-34
PHYCA_114634419032461253125e-34
PHYSO_471883565272621253126e-34
PHYCA_130818432861881253068e-34
PHYSO_254669463282821623138e-34
H257_025261393532881593121e-33
PPTG_13659225965302143222e-33
PHYSO_477890222772501383082e-33
PHYSO_516015592532091253034e-33
PHYSO_337571522564301623148e-33
PPTG_12396134062881833042e-32
PPTG_04998195132382162951e-31
PHYSO_41361555025118972824e-31
PPTG_0493019493971222762e-30
PPTG_04453471994521472884e-29
PHYSO_289239240852531072717e-28
PPTG_24302287213592122767e-28
PHYSO_250686460014842242809e-28
PYAP_24840958292141632652e-27
PPTG_114261424713732242723e-27
PPTG_05891197903371482695e-27
PHYSO_474251566632551252646e-27
PPTG_08674208854772292693e-26
PHYSO_511059589192681462579e-26
PHYSO_496273579142961462599e-26
PPTG_23390278993091372545e-25
PPTG_20277251944042202569e-25
PHYSO_510021208852701462482e-24
PHYRA_78526593052602152472e-24
PHYCA_129211431202701462463e-24
PHYSO_521288198922581322454e-24
PHYSO_254667463274731432525e-24
PHYRA_77331597564092162507e-24
PPTG_20312252222051362408e-24
PHYSO_516986593052371322402e-23
PHYSO_533107604082531512402e-23
PHYSO_532826603962531512402e-23
PHYSO_510733588902731532412e-23
PHYCA_105692409642431252392e-23
PPTG_05879197823441432424e-23
PHYCA_115203419361481452314e-23
H257_098451424883892342435e-23
PPTG_06186198924462232421e-22
PHYCA_119960423292651422351e-22
PHYSO_525589598521311402261e-22
PHYCA_1284251393531871422301e-22
PHYSO_249073458704371512412e-22
PHYSO_503930584402381532313e-22
PHYSO_246570456903641512373e-22
PHYSO_481325570541531532253e-22
PYIW_275971669711841542274e-22
PHYRA_83936719382792162324e-22
PHYCA_131927434032331102295e-22
PHYSO_505181585164102292341e-21
PPTG_10612215165552292352e-21
PHYCA_115609419771311402182e-21
H257_182721469372572112253e-21
PHYSO_255876464134692192323e-21
PHYSO_523900597564102292304e-21
PHYSO_499950452282562072245e-21
PHYSO_526629599513322212275e-21
PHYCA_114284418782811342255e-21
PYAR_18806958292431252227e-21
PPTG_02049404041991572181e-20
PHYCA_112478416662701512212e-20
PPTG_19934249741731592142e-20
PHYCA_133604438022751462202e-20
H257_113751432454581622253e-20
PHYCA_131982434093252262214e-20
PHYCA_77523395161711102124e-20
PHYCA_128089598522781222194e-20
H257_098981425303892112216e-20
PHYSO_251327460443622042207e-20
PHYSO_495083578493262042188e-20
PPTG_2063825386122842068e-20
PHYSO_407182547661081372041e-19
PHYSO_527104599963182172162e-19
PHYCA_105488409403192132152e-19
H257_153741453115172182173e-19
PHYSO_501313253861311402033e-19
PHYCA_79170395451491472044e-19
PPTG_23412622937511262165e-19
PPTG_24770291591581022045e-19
PPTG_20946572062841472115e-19
PHYCA_51822386771581162036e-19
PHYCA_104102408163102002101e-18
PHYRA_81096458703642142121e-18
H257_017831277313291532101e-18
PHYCA_59647388992151472051e-18
PPTG_22261268886632242095e-18
PPTG_06264199232001012005e-18
PPTG_12864223322101202006e-18
PYIW_196021674051671601977e-18
PYIW_262801656162912022021e-17
PHALS_01004177825092432052e-17
PHYSO_5302231277311521401932e-17
PHYSO_254072462694261622032e-17
PHYCA_11654842036230991963e-17
PHYCA_98973402761081371883e-17
PPTG_03236598523121181993e-17
PHYSO_4108945492987681864e-17
H257_109101429965262262015e-17
PHYCA_124924427112532011956e-17
PYIW_254971650593141401978e-17
PHYCA_106411410392301111938e-17
PHYCA_108979412922561281931e-16
PHYCA_119644515753012011951e-16
PHYSO_340757527265272221963e-16
H257_106621428884072281934e-16
PHYCA_113307478022231321876e-16
PPTG_0626352256821041768e-16
PPTG_08850473903011401898e-16
PPTG_22045266834312271919e-16
PYIW_204571627302181621851e-15
PHYCA_103032406782901201871e-15
PPTG_24278287022251381842e-15
PHYRA_75115598903021221862e-15
PHYRA_78224566633331491872e-15
PPTG_09187210572132121822e-15
PHYSO_248863458573151421853e-15
H257_050421403712041521796e-15
PPTG_079632068296901718e-15
PPTG_02934187552291361799e-15
PHYCA_822002366582811681e-14
PYIW_273141666331901521742e-14
PPTG_0498919508253951772e-14
PHYCA_113633417872341261762e-14
PHYCA_114426418872791381782e-14
PPTG_11113216973181191783e-14
PPTG_01731475031771571723e-14
PHYSO_333013515755022081794e-14
PHYSO_525912598903191081774e-14
PYAR_187891034483011221764e-14
PPTG_19011245031311391667e-14
PHYSO_506404586054661971777e-14
PPTG_19362246672581141738e-14
PPTG_0492947748212871701e-13
PPTG_05887197881301181651e-13
PPTG_0916321048177841671e-13
PPTG_14142597563161201722e-13
PHYSO_466615562172361571702e-13
PHYSO_482107434092861411678e-13
PHYSO_255233463644181491698e-13
PPTG_078642062165471549e-13
PPTG_0291718743279941661e-12
H257_073261413313781231671e-12
H257_18698147206122771571e-12
PHYSO_247318457534711491671e-12
PPTG_1961224785369931661e-12
PPTG_05214195741741041602e-12
PHYRA_87231481494932191662e-12
PPTG_19620247893201211652e-12
PHYRA_83838582942801551642e-12
PHYRA_74522586054302091652e-12
PPTG_16263235214542281652e-12
PPTG_12513221803402121642e-12
H257_138161444654221341653e-12
PHYCA_117495421172361331613e-12
PPTG_1381522651148901573e-12
PPTG_0498819507971101523e-12
H257_032661396673691591626e-12
PHYCA_12651642872159491556e-12
PHYRA_73997255314462181627e-12
PHYCA_106819411051091351517e-12
PHYRA_86021727513672181601e-11
H257_19348147737110941491e-11
PPTG_01499183205042261592e-11
PHYSO_498673580663681971582e-11
PHYCA_101734405092501131562e-11
SDRG_14117417003351261572e-11
SDRG_114361368983351261572e-11
PHYCA_1046454086061531442e-11
PHYSO_33559574524742181573e-11
PPTG_21829264851271141483e-11
PPTG_1840224302255951519e-11
PHYCA_7915122277165471461e-10
PHYCA_11276241700224911491e-10
PHYSO_501688582943331521502e-10
PHYCA_130457432551481111432e-10
PPTG_12207220691711031443e-10
PHYCA_590743888084681375e-10
PHYSO_505306585262861451465e-10
H257_07778572065102331485e-10
PPTG_09982212994372201476e-10
H257_019906581451221406e-10
PPTG_14199227534291401467e-10
PHYRA_80859224531611331391e-09
PHYCA_12071842391101711351e-09
H257_147571449572882141431e-09
PHYCA_10557174523351921432e-09
PPTG_0055918017125451352e-09
PPTG_2007425055227921375e-09
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_00133

Length=224
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPTG_00133                                                            441     3e-159
PPTG_13715                                                            216     1e-66 
PPTG_20797                                                            201     8e-62 
PHYSO_284721                                                          197     2e-61 
PPTG_16521                                                            197     1e-60 
PHYSO_253880                                                          192     8e-59 
PHYSO_340857                                                          196     8e-59 
PHYRA_82588                                                           193     2e-58 
PHYSO_288643                                                          187     4e-58 
PHYSO_520761                                                          192     7e-58 
PHYSO_287026                                                          187     9e-58 
PPTG_03030                                                            191     1e-57 
PPTG_21726                                                            190     2e-57 
PHYSO_286678                                                          186     5e-57 
PHYSO_286888                                                          186     5e-57 
PHYSO_288834                                                          184     2e-56 
PHYSO_285295                                                          186     3e-56 
PHYSO_286047                                                          181     3e-55 
PHYSO_292782                                                          181     4e-55 
PHYSO_258511                                                          188     6e-55 
PHYSO_289169                                                          180     1e-54 
PHYSO_260754                                                          183     3e-54 
PHYSO_286161                                                          178     4e-54 
PHYSO_245860                                                          179     4e-53 
PPTG_02862                                                            179     5e-53 
PHYSO_334653                                                          180     3e-52 
PHYSO_288799                                                          172     5e-52 
PHYSO_284516                                                          173     6e-52 
PHYSO_285754                                                          174     1e-51 
PPTG_14654                                                            175     2e-51 
PPTG_01146                                                            171     5e-51 
PPTG_17033                                                            163     1e-49 
PPTG_00493                                                            161     1e-48 
PHYSO_248221                                                          167     2e-48 
PPTG_13610                                                            163     3e-48 
PPTG_12744                                                            157     7e-48 
PPTG_05227                                                            166     9e-48 
PHYSO_326975                                                          165     1e-47 
PHYSO_288514                                                          157     8e-47 
PHYCA_100643                                                          155     2e-46 
PHYCA_123222                                                          155     7e-46 
PPTG_03398                                                            160     1e-45 
PPTG_16734                                                            156     3e-45 
PHYSO_284383                                                          152     3e-44 
PHYSO_254622                                                          148     1e-41 
PHYSO_286113                                                          146     4e-41 
PHYSO_260684                                                          147     6e-41 
PPTG_15227                                                            144     2e-39 
PPTG_17803                                                            135     1e-38 
H257_09825                                                            140     3e-38 
PPTG_18543                                                            136     1e-37 
PPTG_08830                                                            133     6e-36 
PPTG_12757                                                            133     1e-35 
PHYSO_337039                                                          130     9e-35 
PPTG_10216                                                            128     1e-34 
PHYCA_120756                                                          125     1e-34 
PHYSO_475994                                                          126     1e-34 
PPTG_13171                                                            126     2e-34 
PHYCA_109215                                                          125     2e-34 
PHYCA_114634                                                          124     5e-34 
PHYSO_471883                                                          124     6e-34 
PHYCA_130818                                                          122     8e-34 
PHYSO_254669                                                          125     8e-34 
H257_02526                                                            124     1e-33 
PPTG_13659                                                            128     2e-33 
PHYSO_477890                                                          123     2e-33 
PHYSO_516015                                                          121     4e-33 
PHYSO_337571                                                          125     8e-33 
PPTG_12396                                                            121     2e-32 
PPTG_04998                                                            118     1e-31 
PHYSO_413615                                                          113     4e-31 
PPTG_04930                                                            110     2e-30 
PPTG_04453                                                            115     4e-29 
PHYSO_289239                                                          108     7e-28 
PPTG_24302                                                            110     7e-28 
PHYSO_250686                                                          112     9e-28 
PYAP_24840                                                            106     2e-27 
PPTG_11426                                                            109     3e-27 
PPTG_05891                                                            108     5e-27 
PHYSO_474251                                                          106     6e-27 
PPTG_08674                                                            108     3e-26 
PHYSO_511059                                                          103     9e-26 
PHYSO_496273                                                          104     9e-26 
PPTG_23390                                                            102     5e-25 
PPTG_20277                                                            103     9e-25 
PHYSO_510021                                                          100     2e-24 
PHYRA_78526                                                           99.8    2e-24 
PHYCA_129211                                                          99.4    3e-24 
PHYSO_521288                                                          99.0    4e-24 
PHYSO_254667                                                          101     5e-24 
PHYRA_77331                                                           100     7e-24 
PPTG_20312                                                            97.1    8e-24 
PHYSO_516986                                                          97.1    2e-23 
PHYSO_533107                                                          97.1    2e-23 
PHYSO_532826                                                          97.1    2e-23 
PHYSO_510733                                                          97.4    2e-23 
PHYCA_105692                                                          96.7    2e-23 
PPTG_05879                                                            97.8    4e-23 
PHYCA_115203                                                          93.6    4e-23 
H257_09845                                                            98.2    5e-23 
PPTG_06186                                                            97.8    1e-22 
PHYCA_119960                                                          95.1    1e-22 
PHYSO_525589                                                          91.7    1e-22 
PHYCA_128425                                                          93.2    1e-22 
PHYSO_249073                                                          97.4    2e-22 
PHYSO_503930                                                          93.6    3e-22 
PHYSO_246570                                                          95.9    3e-22 
PHYSO_481325                                                          91.3    3e-22 
PYIW_27597                                                            92.0    4e-22 
PHYRA_83936                                                           94.0    4e-22 
PHYCA_131927                                                          92.8    5e-22 
PHYSO_505181                                                          94.7    1e-21 
PPTG_10612                                                            95.1    2e-21 
PHYCA_115609                                                          88.6    2e-21 
H257_18272                                                            91.3    3e-21 
PHYSO_255876                                                          94.0    3e-21 
PHYSO_523900                                                          93.2    4e-21 
PHYSO_499950                                                          90.9    5e-21 
PHYSO_526629                                                          92.0    5e-21 
PHYCA_114284                                                          91.3    5e-21 
PYAR_18806                                                            90.1    7e-21 
PPTG_02049                                                            88.6    1e-20 
PHYCA_112478                                                          89.7    2e-20 
PPTG_19934                                                            87.0    2e-20 
PHYCA_133604                                                          89.4    2e-20 
H257_11375                                                            91.3    3e-20 
PHYCA_131982                                                          89.7    4e-20 
PHYCA_77523                                                           86.3    4e-20 
PHYCA_128089                                                          89.0    4e-20 
H257_09898                                                            89.7    6e-20 
PHYSO_251327                                                          89.4    7e-20 
PHYSO_495083                                                          88.6    8e-20 
PPTG_20638                                                            84.0    8e-20 
PHYSO_407182                                                          83.2    1e-19 
PHYSO_527104                                                          87.8    2e-19 
PHYCA_105488                                                          87.4    2e-19 
H257_15374                                                            88.2    3e-19 
PHYSO_501313                                                          82.8    3e-19 
PHYCA_79170                                                           83.2    4e-19 
PPTG_23412                                                            87.8    5e-19 
PPTG_24770                                                            83.2    5e-19 
PPTG_20946                                                            85.9    5e-19 
PHYCA_51822                                                           82.8    6e-19 
PHYCA_104102                                                          85.5    1e-18 
PHYRA_81096                                                           86.3    1e-18 
H257_01783                                                            85.5    1e-18 
PHYCA_59647                                                           83.6    1e-18 
PPTG_22261                                                            85.1    5e-18 
PPTG_06264                                                            81.6    5e-18 
PPTG_12864                                                            81.6    6e-18 
PYIW_19602                                                            80.5    7e-18 
PYIW_26280                                                            82.4    1e-17 
PHALS_01004                                                           83.6    2e-17 
PHYSO_530223                                                          79.0    2e-17 
PHYSO_254072                                                          82.8    2e-17 
PHYCA_116548                                                          80.1    3e-17 
PHYCA_98973                                                           77.0    3e-17 
PPTG_03236                                                            81.3    3e-17 
PHYSO_410894                                                          76.3    4e-17 
H257_10910                                                            82.0    5e-17 
PHYCA_124924                                                          79.7    6e-17 
PYIW_25497                                                            80.5    8e-17 
PHYCA_106411                                                          79.0    8e-17 
PHYCA_108979                                                          79.0    1e-16 
PHYCA_119644                                                          79.7    1e-16 
PHYSO_340757                                                          80.1    3e-16 
H257_10662                                                            79.0    4e-16 
PHYCA_113307                                                          76.6    6e-16 
PPTG_06263                                                            72.4    8e-16 
PPTG_08850                                                            77.4    8e-16 
PPTG_22045                                                            78.2    9e-16 
PYIW_20457                                                            75.9    1e-15 
PHYCA_103032                                                          76.6    1e-15 
PPTG_24278                                                            75.5    2e-15 
PHYRA_75115                                                           76.3    2e-15 
PHYRA_78224                                                           76.6    2e-15 
PPTG_09187                                                            74.7    2e-15 
PHYSO_248863                                                          75.9    3e-15 
H257_05042                                                            73.6    6e-15 
PPTG_07963                                                            70.5    8e-15 
PPTG_02934                                                            73.6    9e-15 
PHYCA_82200                                                           69.3    1e-14 
PYIW_27314                                                            71.6    2e-14 
PPTG_04989                                                            72.8    2e-14 
PHYCA_113633                                                          72.4    2e-14 
PHYCA_114426                                                          73.2    2e-14 
PPTG_11113                                                            73.2    3e-14 
PPTG_01731                                                            70.9    3e-14 
PHYSO_333013                                                          73.6    4e-14 
PHYSO_525912                                                          72.8    4e-14 
PYAR_18789                                                            72.4    4e-14 
PPTG_19011                                                            68.6    7e-14 
PHYSO_506404                                                          72.8    7e-14 
PPTG_19362                                                            71.2    8e-14 
PPTG_04929                                                            70.1    1e-13 
PPTG_05887                                                            68.2    1e-13 
PPTG_09163                                                            68.9    1e-13 
PPTG_14142                                                            70.9    2e-13 
PHYSO_466615                                                          70.1    2e-13 
PHYSO_482107                                                          68.9    8e-13 
PHYSO_255233                                                          69.7    8e-13 
PPTG_07864                                                            63.9    9e-13 
PPTG_02917                                                            68.6    1e-12 
H257_07326                                                            68.9    1e-12 
H257_18698                                                            65.1    1e-12 
PHYSO_247318                                                          68.9    1e-12 
PPTG_19612                                                            68.6    1e-12 
PPTG_05214                                                            66.2    2e-12 
PHYRA_87231                                                           68.6    2e-12 
PPTG_19620                                                            68.2    2e-12 
PHYRA_83838                                                           67.8    2e-12 
PHYRA_74522                                                           68.2    2e-12 
PPTG_16263                                                            68.2    2e-12 
PPTG_12513                                                            67.8    2e-12 
H257_13816                                                            68.2    3e-12 
PHYCA_117495                                                          66.6    3e-12 
PPTG_13815                                                            65.1    3e-12 
PPTG_04988                                                            63.2    3e-12 
H257_03266                                                            67.0    6e-12 
PHYCA_126516                                                          64.3    6e-12 
PHYRA_73997                                                           67.0    7e-12 
PHYCA_106819                                                          62.8    7e-12 
PHYRA_86021                                                           66.2    1e-11 
H257_19348                                                            62.0    1e-11 
PPTG_01499                                                            65.9    2e-11 
PHYSO_498673                                                          65.5    2e-11 
PHYCA_101734                                                          64.7    2e-11 
SDRG_14117                                                            65.1    2e-11 
SDRG_11436                                                            65.1    2e-11 
PHYCA_104645                                                          60.1    2e-11 
PHYSO_335595                                                          65.1    3e-11 
PPTG_21829                                                            61.6    3e-11 
PPTG_18402                                                            62.8    9e-11 
PHYCA_79151                                                           60.8    1e-10 
PHYCA_112762                                                          62.0    1e-10 
PHYSO_501688                                                          62.4    2e-10 
PHYCA_130457                                                          59.7    2e-10 
PPTG_12207                                                            60.1    3e-10 
PHYCA_59074                                                           57.4    5e-10 
PHYSO_505306                                                          60.8    5e-10 
H257_07778                                                            61.6    5e-10 
PPTG_09982                                                            61.2    6e-10 
H257_01990                                                            58.5    6e-10 
PPTG_14199                                                            60.8    7e-10 
PHYRA_80859                                                           58.2    1e-09 
PHYCA_120718                                                          56.6    1e-09 
H257_14757                                                            59.7    1e-09 
PHYCA_105571                                                          59.7    2e-09 
PPTG_00559                                                            56.6    2e-09 
PPTG_20074                                                            57.4    5e-09 
PHYSO_338525                                                          58.5    5e-09 
PHYCA_68902                                                           54.3    8e-09 
PYIW_26058                                                            57.0    1e-08 
PHYCA_53005                                                           53.5    1e-08 
PPTG_20292                                                            55.5    1e-08 
PHYSO_435116                                                          54.7    1e-08 
PHYSO_475146                                                          56.6    2e-08 
H257_18147                                                            57.0    2e-08 
PPTG_23637                                                            52.8    2e-08 
PHYSO_296297                                                          56.2    2e-08 
PPTG_02916                                                            55.5    2e-08 
PHYCA_116274                                                          55.8    2e-08 
PPTG_12208                                                            52.8    3e-08 
PHYSO_532032                                                          55.8    3e-08 
PHYCA_59350                                                           53.5    3e-08 
PYAR_25699                                                            55.8    3e-08 
PPTG_24649                                                            52.4    4e-08 
H257_14742                                                            55.5    4e-08 
PYAP_25221                                                            55.5    5e-08 
PPTG_22634                                                            55.5    5e-08 
PYIW_18134                                                            55.5    5e-08 
PHYCA_82192                                                           51.2    8e-08 
PPTG_09713                                                            53.5    8e-08 
PPTG_17463                                                            52.4    1e-07 
PPTG_00225                                                            54.3    1e-07 
PHYCA_543671                                                          53.1    2e-07 
PPTG_20755                                                            53.1    3e-07 
PHYSO_536448                                                          52.4    3e-07 
PHYSO_375103                                                          52.4    4e-07 
PHYSO_507496                                                          51.6    6e-07 
PHYCA_551860                                                          52.0    6e-07 
PHYSO_388845                                                          50.8    8e-07 
PHYRA_87540                                                           50.8    1e-06 
H257_01991                                                            48.9    1e-06 
PHYRA_81139                                                           48.5    1e-06 
H257_10811                                                            51.2    1e-06 
PHYSO_506204                                                          47.8    1e-06 
PPTG_22811                                                            48.9    1e-06 
PPTG_03099                                                            50.8    2e-06 
PHYSO_435085                                                          50.4    2e-06 
PPTG_06255                                                            50.1    2e-06 
PHYRA_77190                                                           50.4    2e-06 
PPTG_19874                                                            50.1    2e-06 
PHYCA_62524                                                           47.8    3e-06 
PPTG_02929                                                            47.8    3e-06 
H257_04208                                                            49.3    4e-06 
H310_12489                                                            48.9    4e-06 
PHYSO_473627                                                          48.1    4e-06 
CCA20358                                                              47.0    4e-06 
PHYCA_96957                                                           47.4    5e-06 
PYIW_23231                                                            48.1    5e-06 
CCA15683                                                              48.5    6e-06 
PYIW_21759                                                            48.9    7e-06 
PYU1_G009661                                                          46.6    1e-05 
H257_03430                                                            48.1    1e-05 
PHYCA_68835                                                           47.8    1e-05 
PPTG_03293                                                            46.6    2e-05 
PPTG_22179                                                            45.1    2e-05 
PHYSO_334361                                                          47.4    3e-05 
PPTG_08716                                                            47.0    3e-05 
PPTG_06071                                                            46.6    3e-05 
PPTG_15627                                                            46.6    3e-05 
PPTG_23636                                                            46.2    4e-05 
PPTG_24015                                                            46.6    4e-05 
PYIW_24769                                                            46.2    4e-05 
PPTG_02028                                                            46.6    4e-05 
PPTG_18002                                                            43.1    4e-05 
PHYSO_498289                                                          46.2    5e-05 
PPTG_14192                                                            45.8    6e-05 
PPTG_05107                                                            45.8    6e-05 
PHYCA_564059                                                          43.1    6e-05 
PYAR_18790                                                            44.7    8e-05 
PPTG_23002                                                            44.3    8e-05 
PPTG_23115                                                            45.8    1e-04 
PHYSO_331847                                                          45.4    1e-04 
PPTG_24697                                                            42.4    1e-04 
PITG_21274                                                            43.1    1e-04 
PHYCA_111050                                                          44.3    2e-04 
H257_10905                                                            44.3    2e-04 
PHYSO_415282                                                          42.0    2e-04 
PPTG_12863                                                            42.0    2e-04 
PHYRA_86502                                                           43.5    3e-04 
PHYSO_447395                                                          41.2    4e-04 
PHYSO_374897                                                          41.2    4e-04 
PYAR_18805                                                            42.7    4e-04 
PHYCA_125562                                                          41.6    5e-04 
H257_14670                                                            42.7    6e-04 
PPTG_05215                                                            42.4    8e-04 
PPTG_23113                                                            39.3    8e-04 
PYAR_23947                                                            42.7    8e-04 
PPTG_03237                                                            42.0    8e-04 
PHYSO_404030                                                          40.0    0.001 
PYIW_24840                                                            42.0    0.001 
PPTG_15353                                                            41.6    0.001 
PHYSO_484147                                                          41.6    0.002 
PHYSO_475960                                                          41.2    0.002 
PITG_23307                                                            41.2    0.002 
PHYRA_86756                                                           40.0    0.002 
PYIW_24859                                                            40.4    0.002 
PPTG_19875                                                            38.5    0.002 
PHYSO_490391                                                          40.8    0.002 
PPTG_11867                                                            40.0    0.003 
PHYSO_511250                                                          40.4    0.003 
PPTG_11114                                                            39.7    0.004 
PYAR_26509                                                            40.0    0.004 
PPTG_19922                                                            40.4    0.004 
PPTG_07865                                                            39.7    0.004 
PPTG_03867                                                            39.7    0.005 
PPTG_12302                                                            40.0    0.005 
PPTG_24604                                                            39.3    0.006 
PPTG_19718                                                            39.3    0.006 
PHYSO_490851                                                          38.9    0.008 
PPTG_05418                                                            39.7    0.009 
PPTG_08690                                                            39.3    0.009 
PPTG_23367                                                            37.4    0.009 
PPTG_17034                                                            37.4    0.010 
PPTG_05419                                                            38.9    0.010 
PYAR_26840                                                            37.4    0.012 
PHYCA_107572                                                          37.4    0.029 
PHYCA_132771                                                          37.7    0.030 
PPTG_24976                                                            34.7    0.030 
PPTG_21567                                                            37.4    0.031 
PHYRA_86157                                                           36.6    0.043 
PPTG_12442                                                            37.0    0.048 
PHYRA_76989                                                           37.4    0.050 
PPTG_24549                                                            35.0    0.051 
PYAR_24033                                                            37.4    0.052 
H257_12857                                                            37.0    0.063 
PPTG_20669                                                            35.8    0.077 
PPTG_12653                                                            35.0    0.14  
PPTG_19597                                                            35.8    0.18  
PHYRA_80047                                                           34.3    0.21  
PHYRA_75779                                                           34.7    0.22  
PHYCA_72312                                                           33.5    0.23  
PHYCA_133515                                                          35.0    0.27  
PHYRA_73618                                                           34.3    0.28  
PPTG_21261                                                            32.7    0.28  
PPTG_19797                                                            34.7    0.34  
PPTG_12281                                                            33.5    0.39  
PPTG_24553                                                            32.7    0.41  
H257_06455                                                            34.3    0.43  
PPTG_12282                                                            33.9    0.48  
PHYSO_246329                                                          33.1    0.50  
H257_01989                                                            32.0    0.54  
PHYRA_87600                                                           33.5    0.55  
SDRG_04689                                                            33.9    0.83  
PPTG_19537                                                            33.1    0.89  
PPTG_20641                                                            30.8    1.4   
PHYCA_109141                                                          32.7    1.4   
PHYSO_326704                                                          32.7    1.5   
PHYCA_534782                                                          32.7    2.1   
PPTG_07608                                                            31.6    2.3   
H257_04156                                                            30.8    2.7   
PPTG_07166                                                            32.0    3.0   
PHYSO_472272                                                          30.8    3.3   
PPTG_02219                                                            31.2    3.5   
PYIW_27118                                                            31.2    3.5   
PHYSO_528666                                                          30.8    4.4   
PITG_02334                                                            30.0    4.4   
SPRG_10877                                                            31.2    5.2   
PPTG_22985                                                            29.3    5.3   
PPTG_23089                                                            30.8    5.9   
PHYSO_510666                                                          30.4    8.8   
PHYSO_471825                                                          30.0    9.3   

>PPTG_00133
Length=224

 Score = 441 bits (1135),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 224/224 (100%), Positives = 224/224 (100%), Gaps = 0/224 (0%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA
Sbjct  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
            KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD
Sbjct  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
            ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVQKLMLKLQQKLNCDRSSA
Sbjct  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVQKLMLKLQQKLNCDRSSA  180

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQTAVCELC  224
            KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQTAVCELC
Sbjct  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQTAVCELC  224

>PPTG_13715
Length=518

 Score = 216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 147/228 (64%), Gaps = 37/228 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M SLTR V++ IAAE+P+RFGLI DGW+HASEH++AV+  YEV                 
Sbjct  133  MESLTRIVERCIAAELPERFGLILDGWSHASEHFLAVFACYEVR----------------  176

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                      V KTPLL MA LLN+ +E LSARGHMEFLA MLPRD+GKQL  C F+V D
Sbjct  177  ---------GVTKTPLLSMAPLLNEHDEDLSARGHMEFLAEMLPRDFGKQLSDCLFVVGD  227

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDR---  177
             CSVNR LATLMGVPLVGCASHRLNRAVQ+++  Y ++LD VQ LM++L+      +   
Sbjct  228  NCSVNRLLATLMGVPLVGCASHRLNRAVQVDMEQYADDLDLVQALMVRLRTLKQSAKLRY  287

Query  178  ---------SSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                     +   TR  STF MI RYF LLE ID  DD L D++P+PA
Sbjct  288  MSKTTLRPVTRQDTRWSSTFDMINRYFKLLEHIDPTDDALVDVLPAPA  335

>PPTG_20797
Length=418

 Score = 201 bits (510),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 143/222 (64%), Gaps = 29/222 (13%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +TR V++ IAAE+P RFG++FDGWTHASEHY+A +  YEV+                
Sbjct  43   MEGVTREVERKIAAELPARFGVMFDGWTHASEHYVAWFACYEVN----------------  86

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                      V  TPLL MA L+N+ ++ LSAR H EFLATMLPRDYG Q+  C F+V D
Sbjct  87   ---------GVLVTPLLAMAPLINEPDDNLSARSHYEFLATMLPRDYGVQIDQCRFVVGD  137

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             CSVNR LATLM VPLVGCASHRLNRAVQ  L  +E++L  VQ LM+KL+      +   
Sbjct  138  NCSVNRSLATLMRVPLVGCASHRLNRAVQHYLLQHEKDLAAVQALMIKLKTLTQSTKLRY  197

Query  181  K----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQT  218
            +    TR  S+F M+ RYF LLEF+DA DD++ +++PSPA  
Sbjct  198  EIIFTTRWSSSFDMVKRYFELLEFLDADDDDIMELLPSPASN  239

>PHYSO_284721
Length=320

 Score = 197 bits (500),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 142/226 (63%), Gaps = 35/226 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+ +++ LSA+GH+EFLAT LPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDAQDDDLSAQGHLEFLATTLPRDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  VQ LM+KL+      +   
Sbjct  115  NCAVNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLVVVQALMVKLRTLTQSAKLRL  174

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  175  KTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  220

>PPTG_16521
Length=402

 Score = 197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 133/228 (58%), Gaps = 69/228 (30%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            MGSL R V++VIAAEMPDRFGLIFDG THASEHYIAVY RYEV                 
Sbjct  58   MGSLARSVERVIAAEMPDRFGLIFDGMTHASEHYIAVYARYEV-----------------  100

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                    D VAKTPLLCMA LL+DEEE LSARGHMEFLATMLPR Y             
Sbjct  101  --------DGVAKTPLLCMAPLLSDEEEDLSARGHMEFLATMLPRGYWG-----------  141

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
                                   LNR+VQLELADYEEELDTVQKLMLKL       +  A
Sbjct  142  -----------------------LNRSVQLELADYEEELDTVQKLMLKLHTLTQLAKLRA  178

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQT  218
            K          TR  STF MI  YF LLEFIDAIDDELED+MPSPAQ 
Sbjct  179  KTQLRPVIRQDTRWRSTFSMIKHYFDLLEFIDAIDDELEDLMPSPAQN  226

>PHYSO_253880
Length=373

 Score = 192 bits (487),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 134/220 (61%), Gaps = 36/220 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++TR V+  IAAEMP+ FGLI DGW+H SEHYIAV+  YEVD   V RC         
Sbjct  1    MDAVTRCVEHAIAAEMPEEFGLIVDGWSHDSEHYIAVFACYEVDG--VLRC---------  49

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                          PLLCMA L+NDE +   A  H  FLATML RDY K+L    FLV D
Sbjct  50   --------------PLLCMAPLVNDETDDFFAASHQTFLATMLARDYQKRLDQVLFLVGD  95

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C VNRRL TLM VPLVGCASHRLNRAV   L++  E++D VQ LM++       DR   
Sbjct  96   NCGVNRRLPTLMDVPLVGCASHRLNRAVAARLSECAEDVDMVQALMVQ-------DRPRP  148

Query  181  ----KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                +TR GSTF MI RYF LL FIDA DDEL +++P  A
Sbjct  149  IIRQQTRWGSTFAMINRYFELLPFIDAEDDELAELLPPAA  188

>PHYSO_340857
Length=527

 Score = 196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 139/226 (62%), Gaps = 35/226 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++TR V+  IAAEMP+ FG+IFDGW+H SEHYIAV+  YEVD   V RC         
Sbjct  142  MDAVTRCVEHAIAAEMPEEFGIIFDGWSHDSEHYIAVFACYEVDG--VLRC---------  190

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                          PLLCMA L+NDE +  SA  H   LATML RDY K+L    FLV D
Sbjct  191  --------------PLLCMAPLVNDETDDFSAASHQASLATMLARDYQKRLDQVLFLVGD  236

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C VNRRLATLMGVPLVGCASHRLNRAV   L++  E++D VQ LM+KL+   +  +   
Sbjct  237  NCGVNRRLATLMGVPLVGCASHRLNRAVAARLSECAEDVDMVQALMVKLRTLHHSAKLRF  296

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR GSTF MI RYF LL FIDA DDEL +++P  A
Sbjct  297  KTDLRPIIRQQTRWGSTFAMINRYFELLPFIDAEDDELTELLPPAA  342

>PHYRA_82588
Length=449

 Score = 193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 137/220 (62%), Gaps = 44/220 (20%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +TR V+++IAAEMP  FGLIFDGW+HASEH+IAV+  YEVD                
Sbjct  105  MEGVTRVVERLIAAEMPASFGLIFDGWSHASEHFIAVFACYEVD----------------  148

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                      V KTPLLCMA LL+  +E LSARGH EFLA MLPRD+          V D
Sbjct  149  ---------GVMKTPLLCMAPLLDTLDEDLSARGHYEFLADMLPRDF----------VGD  189

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNR LAT MGVPLVGCASHRLNRAVQ ++  +EE+L TVQ LM +       D +S+
Sbjct  190  NCAVNRLLATRMGVPLVGCASHRLNRAVQADMQQHEEDLATVQALMAE-------DHASS  242

Query  181  K--TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQT  218
            +   R  STF M+ RYF LLE ID  DD + D++P+PA  
Sbjct  243  RDSARWSSTFLMVHRYFRLLEHIDTTDDAVMDVLPTPASN  282

>PHYSO_288643
Length=270

 Score = 187 bits (475),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 140/226 (62%), Gaps = 35/226 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ I +E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIPSELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATMLPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLPRDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM VPLVGCASHRLN AVQ ++  +EE+L  VQ LM+KL+      +   
Sbjct  115  NCAVNRRLATLMSVPLVGCASHRLNLAVQADMVSHEEDLAAVQALMVKLRTLTQSAKLRL  174

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  175  KTPLRPVIRQNTRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  220

>PHYSO_520761
Length=484

 Score = 192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 138/209 (66%), Gaps = 31/209 (15%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                       
Sbjct  140  VERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN-----------------------  176

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                 KT LL MA LL+   + LSA+GH+EFLATMLPRDYG QL  C FLVAD C+VNRR
Sbjct  177  --GCPKTTLLSMAPLLDALGDDLSAQGHLEFLATMLPRDYGVQLMQCRFLVADNCAVNRR  234

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRGGST  187
            LATLM VPLVGCASHRLN AVQ  +A +EE+L  VQ LM+KL+        SAK R  ST
Sbjct  235  LATLMSVPLVGCASHRLNLAVQAGMASHEEDLAAVQTLMIKLRTLTQ----SAKLR--ST  288

Query  188  FFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            F M+ R+  LLEF+DA DD+L D++P PA
Sbjct  289  FEMVRRHLQLLEFLDAKDDDLMDLLPPPA  317

>PHYSO_287026
Length=291

 Score = 187 bits (474),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 133/216 (62%), Gaps = 44/216 (20%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATMLPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLPRDYGVQLVQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM VPLVGCASHRLN AVQ  +A +EE+L                   +A
Sbjct  115  NCAVNRRLATLMSVPLVGCASHRLNLAVQAGMASHEEDL-------------------AA  155

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  156  DTRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  191

>PPTG_03030
Length=458

 Score = 191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 135/219 (62%), Gaps = 35/219 (16%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ IA+EMPD+FGLI DGWTH SEHY+ V+  YEV                        
Sbjct  84   VERSIASEMPDQFGLILDGWTHISEHYLGVFACYEVGGKV--------------------  123

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                 KTPL+CMA L+N+ ++ LSA  H EFLA MLPRD+GKQ+  C F+V D CSVN+R
Sbjct  124  -----KTPLICMAPLMNEADDDLSALAHREFLADMLPRDFGKQIDQCLFVVGDNCSVNQR  178

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
            LA+L+GVPL+GCASHRLNRAVQ +L  +E +L  V  LM+KL+      +   K      
Sbjct  179  LASLIGVPLIGCASHRLNRAVQQDLQSHEADLAAVHGLMIKLRTLTQSAKLRLKTSLRPV  238

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                TR  STF M+ RYF LLE +D  DD++ +++P PA
Sbjct  239  IRQDTRWSSTFAMLHRYFKLLEHLDKDDDDVAELLPGPA  277

>PPTG_21726
Length=453

 Score = 190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 137/226 (61%), Gaps = 35/226 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +T  V++ IA+EMP  FGLI DGWTH SEHYIAV+  YEV+                
Sbjct  125  MNGVTVAVERSIASEMPKIFGLILDGWTHLSEHYIAVFACYEVNGQ--------------  170

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KTP+LCM  L+N+ ++ LSA  H EFLA +L RD+GKQL  C FLV D
Sbjct  171  -----------VKTPILCMTPLMNEPDDDLSAVAHREFLANILSRDFGKQLDQCVFLVGD  219

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             CSVN+RLATL+GV L+GCASHRLNRAVQ EL +++ +L  VQ LM+KL+      +   
Sbjct  220  NCSVNKRLATLIGVLLIGCASHRLNRAVQHELHEHKADLAEVQALMIKLRTLTQSAKLRL  279

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR  STF M+ RYF LLE +D  DDE+ D++PS +
Sbjct  280  KMDLRPVIRQDTRWSSTFMMLHRYFELLEHLDTTDDEIADLLPSAS  325

>PHYSO_286678
Length=325

 Score = 186 bits (472),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 139/231 (60%), Gaps = 40/231 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATMLPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLPRDYGVQLTQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM +PLVGCASHRLN AVQ ++A +EE+L  VQ LM+      N      
Sbjct  115  NCAVNRRLATLMSMPLVGCASHRLNLAVQTDMASHEEDLAAVQALMVNCVLSPNLPNYGK  174

Query  181  K---------------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            +               TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  175  RQCVLKTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  225

>PHYSO_286888
Length=320

 Score = 186 bits (471),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 140/226 (62%), Gaps = 35/226 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATML RDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLQRDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  VQ LM+KL+      +   
Sbjct  115  NCAVNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLAAVQALMVKLRTLTQSAKLRL  174

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR  STF M+ RY  LLEF+DA DD L D++P PA
Sbjct  175  KTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLDAEDDALMDLLPPPA  220

>PHYSO_288834
Length=311

 Score = 184 bits (466),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 138/226 (61%), Gaps = 36/226 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  20   MDGIVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+E L TMLPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDVLSAQGHLESLTTMLPRDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  VQ LM+KL+      +   
Sbjct  115  NCAVNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLAAVQALMVKLRTLTQSAKLRL  174

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          T   STF M+ RY   LEF+DA DD+L D++P PA
Sbjct  175  KTPLRPVIRQDTHWSSTFEMVRRYLQ-LEFLDAEDDDLMDLLPPPA  219

>PHYSO_285295
Length=404

 Score = 186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 139/219 (63%), Gaps = 35/219 (16%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                       
Sbjct  27   VERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN-----------------------  63

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                 KT LL MA LL+  ++ LSA+GH+EFLATML RDYG QL  C FLVAD C+VNRR
Sbjct  64   --GCPKTALLSMAPLLDALDDDLSAQGHLEFLATMLQRDYGVQLAQCRFLVADNCAVNRR  121

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
            LATLM VPLVGCASHRLN AVQ ++A +E++L  VQ LM+KL+      +   K      
Sbjct  122  LATLMSVPLVGCASHRLNLAVQADMASHEDDLAAVQALMVKLRTLTQSAKLRLKTPLRPV  181

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  182  IRQDTRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  220

>PHYSO_286047
Length=320

 Score = 181 bits (459),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 142/226 (63%), Gaps = 35/226 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATMLPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMASLLDALDDDLSAQGHLEFLATMLPRDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM V LVGCASHRLN AVQ ++A +E++L  VQ LM+KL+      +  +
Sbjct  115  NCAVNRRLATLMSVLLVGCASHRLNLAVQADMASHEQDLTAVQALMVKLRTLTKSAKLRS  174

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  175  KTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  220

>PHYSO_292782
Length=320

 Score = 181 bits (458),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 139/226 (62%), Gaps = 35/226 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+   EV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACNEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH++FLAT LP DYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLQFLATKLPHDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  VQ LM+KL+      +   
Sbjct  115  NCTVNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLAAVQALMVKLRTLTKSAKLRL  174

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  175  KTPLRPVIRQDTRWSSTFEMVRRYHQLLEFLDAEDDDLMDLLPPPA  220

>PHYSO_258511
Length=666

 Score = 188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 132/209 (63%), Gaps = 39/209 (19%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ IA+E+P RFG++ DGWTHAS+HY+AV+  YEV+                       
Sbjct  336  VERSIASELPARFGIMLDGWTHASKHYVAVFACYEVN-----------------------  372

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                 KT LL +A LL+  ++ LSA+GH+EFLATMLPRDYG QL  C FLVAD C+VNRR
Sbjct  373  --GCPKTTLLSIAPLLDALDDDLSAQGHLEFLATMLPRDYGVQLAQCRFLVADNCAVNRR  430

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRGGST  187
            LATLM VPLVGCASHRLN AVQ ++A +EEEL  V              ++   TR  ST
Sbjct  431  LATLMSVPLVGCASHRLNLAVQADMASHEEELAAV--------------QALMDTRWSST  476

Query  188  FFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            F M+ RY  L EF+DA DD+L D++P PA
Sbjct  477  FEMVRRYLQLFEFLDAEDDDLMDLLPPPA  505

>PHYSO_289169
Length=328

 Score = 180 bits (456),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 136/234 (58%), Gaps = 43/234 (18%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASE+YIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEYYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLAT LPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDELSAQGHLEFLATTLPRDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqkl------mlklqqklN  174
             C+VNRRLATL+  PLVGCASHRLN AVQ ++A +EE+L  VQ L      M        
Sbjct  115  NCAVNRRLATLISAPLVGCASHRLNLAVQADMASHEEDLTVVQALMVWCVNMSLTHFVYF  174

Query  175  CDRSSAK------------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            C+    +            TR  STF M+ RY  LLEF+DA  D+L D++P PA
Sbjct  175  CNFLQHRLKTPLRPVIRQDTRWSSTFEMVQRYLQLLEFLDAEGDDLMDLLPPPA  228

>PHYSO_260754
Length=501

 Score = 183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 137/219 (63%), Gaps = 35/219 (16%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ IA+E+P RFG++ DGW HASEHYIAV+  YEV+                       
Sbjct  140  VERSIASELPARFGIMLDGWAHASEHYIAVFACYEVN-----------------------  176

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                 KT LL MA LL+  ++ LSA+GH+EFLATMLPRDYG Q+  C FLVAD C+VNRR
Sbjct  177  --GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLPRDYGVQMAQCRFLVADNCAVNRR  234

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
            LATLM VPLVGCASHRLN AVQ ++A +EE L  VQ LM+KL+      +   K      
Sbjct  235  LATLMSVPLVGCASHRLNLAVQADMASHEENLAAVQALMVKLRTLTQSAKLRLKTPLRPV  294

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                TR  STF M+ R+  LL F+DA DD+L D++P PA
Sbjct  295  IRQYTRWSSTFEMVRRHLQLLAFLDAKDDDLMDLLPPPA  333

>PHYSO_286161
Length=320

 Score = 178 bits (452),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 138/226 (61%), Gaps = 35/226 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATML RDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLQRDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM V LVGCASHRLN AVQ ++A +EE+L  VQ LM+KL+      +   
Sbjct  115  NCAVNRRLATLMSVSLVGCASHRLNLAVQADMASHEEDLAAVQALMVKLRTLTQSAKLRL  174

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          T   STF M+ RY  LLEF+DA  D+L D++P PA
Sbjct  175  KTPLRPVIRQDTGWSSTFEMVQRYLQLLEFLDAEGDDLMDLLPPPA  220

>PHYSO_245860
Length=477

 Score = 179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 139/216 (64%), Gaps = 32/216 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  130  MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVN----------------  173

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFL TMLPRDYG QL  C FLVAD
Sbjct  174  ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFL-TMLPRDYGVQLAQCRFLVAD  223

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM VPLVGCASHRLN AVQ  +A +EE+L  VQ LM+KL+        SA
Sbjct  224  NCAVNRRLATLMSVPLVGCASHRLNLAVQAGMASHEEDLAAVQTLMIKLRTLTQ----SA  279

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K R  STF M+ RY  LLE +DA DD+L D++P PA
Sbjct  280  KLR--STFEMVRRYLQLLELLDAEDDDLMDLLPPPA  313

>PPTG_02862
Length=456

 Score = 179 bits (454),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 134/223 (60%), Gaps = 35/223 (16%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            +TR V+  +AAE+PD FG++FDGW H+SEH++AV+  YE                     
Sbjct  112  VTRSVEAAVAAELPDAFGIMFDGWAHSSEHFVAVFAYYE---------------------  150

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
                 + +AK+ LL MA ++N+ +E LSA  H + LA ML RD+GK L  C +LV D CS
Sbjct  151  ----GNGIAKSVLLSMAPVINEPDEDLSAHTHRDVLAEMLERDFGKDLSCCKYLVGDNCS  206

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK--  181
            +NRRLAT+M VPLVGCASHRL RAVQ  LA  E++L  VQ LM KL+      +   K  
Sbjct  207  MNRRLATIMQVPLVGCASHRLYRAVQQHLAQNEDDLAVVQALMAKLRTIKQSTKLRFKTT  266

Query  182  --------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                    T  GSTF M+ RYF LLEF+D  D+EL D++P PA
Sbjct  267  LWPAIRQDTHWGSTFSMVHRYFALLEFLDLDDEELMDLLPPPA  309

>PHYSO_334653
Length=610

 Score = 180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 131/219 (60%), Gaps = 35/219 (16%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            +++V+ A     FGLIFDGW+H SEHYIAV+  YEVD   V RC                
Sbjct  250  LRRVMDAVTRCEFGLIFDGWSHDSEHYIAVFACYEVDG--VLRC----------------  291

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                   PLLCMA L+NDE +  SA  H  FLATML RDY K+L    FLV D C VNRR
Sbjct  292  -------PLLCMAPLVNDETDDFSAASHQAFLATMLARDYQKRLDQVLFLVGDNCGVNRR  344

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
            LATLMGVPLVGCASHRLNRAV   L++  E++D VQ LM+KL+      +   K      
Sbjct  345  LATLMGVPLVGCASHRLNRAVAARLSECAEDVDMVQALMVKLRTLHQSAKPRFKTDLRPI  404

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                TR GSTF MI RYF LL FIDA +DEL +++P  A
Sbjct  405  IRQQTRWGSTFAMINRYFELLPFIDAEEDELAELLPPAA  443

>PHYSO_288799
Length=314

 Score = 172 bits (437),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 136/238 (57%), Gaps = 44/238 (18%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGW HASEHYIAV+  YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWAHASEHYIAVFACYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATMLPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLPRDYGVQLAQCPFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRA---------VQLELADYEEELDTVqklmlklqq  171
             C+VNRRLATLM VPLVGCASHRLN A         V+L       +L     L   ++ 
Sbjct  115  NCAVNRRLATLMSVPLVGCASHRLNLADLAAVQALMVKLRTLTQSAKLHKAPMLKTPIRP  174

Query  172  klNCDRSSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA-----QTAVCELC  224
             +  D     TR  STF M+ RY  LLEF+DA DD+L D++P PA     +T   ELC
Sbjct  175  VIRQD-----TRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPAMNKRLRTLYQELC  227

>PHYSO_284516
Length=346

 Score = 173 bits (439),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 137/252 (54%), Gaps = 61/252 (24%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YEV                 
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYEVT----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLAT LPRDYG QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATTLPRDYGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C++NRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  VQ LM+      N      
Sbjct  115  NCALNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLAVVQALMINCVLSPNLPNYGK  174

Query  181  K------------------------------------TRGGSTFFMIMRYFYLLEFIDAI  204
            +                                    TR GSTF M+ RY  LLEF+DA 
Sbjct  175  RQCVCVVCQYVSNTFVYFCNFLQNRLKTPLRPVIRQDTRWGSTFEMVRRYLQLLEFLDAE  234

Query  205  DDELEDMMPSPA  216
            DD+L D++P  A
Sbjct  235  DDDLMDLLPPLA  246

>PHYSO_285754
Length=402

 Score = 174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 140/229 (61%), Gaps = 40/229 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+++P RFG++ DGWTHASEHYIAV+  YEV+                
Sbjct  1    MDGVVVAVERSIASKLPARFGIMLDGWTHASEHYIAVFACYEVN----------------  44

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATML RDYG QL  C FLVAD
Sbjct  45   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLQRDYGVQLAQCRFLVAD  95

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VNRRLATLM VPLVGCASHRLN   + ++A +EE+L  VQ LM+KL+  +     SA
Sbjct  96   NCAVNRRLATLMSVPLVGCASHRLNS--KADMASHEEDLAAVQALMVKLRTLICQTTVSA  153

Query  181  K-------------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                          TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  154  NVLKTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  202

>PPTG_14654
Length=480

 Score = 175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/245 (41%), Positives = 133/245 (54%), Gaps = 62/245 (25%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ IA+EMPD+FGLI DGWTH SEHY+ V+  YEV                        
Sbjct  137  VERSIASEMPDQFGLILDGWTHMSEHYLGVFACYEVGGKV--------------------  176

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                 KTPL+CMA L+N+ ++ LSA  H EFLA MLPRD+GKQ+  C F+V D CSVN+R
Sbjct  177  -----KTPLICMAPLMNEADDDLSALAHREFLADMLPRDFGKQIDQCLFVVGDNCSVNQR  231

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVq--------------------klml  167
            LA+L+GVPL+GCASHRLNR VQ +L  +E +L  V                       ++
Sbjct  232  LASLIGVPLIGCASHRLNRVVQQDLQSHEADLAAVHGLMIKLRTLTQSAKLRYPCCYSVV  291

Query  168  klqqklNCD-----------RSSAK------TRGGSTFFMIMRYFYLLEFIDAIDDELED  210
                  N D           ++S +      TR  STF M+ RYF LLE +D  DD++ +
Sbjct  292  LSIIPTNKDNVWCFMIIRRLKTSLRPVIRQDTRWSSTFAMLHRYFKLLEHLDKDDDDVAE  351

Query  211  MMPSP  215
            ++P P
Sbjct  352  LLPGP  356

>PPTG_01146
Length=345

 Score = 171 bits (433),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 107/158 (68%), Gaps = 25/158 (16%)

Query  3    SLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKT  62
            S+TR V++ IAA++P+RFG+IFDGW+HASEH+IAV+  YEVD     RC           
Sbjct  128  SVTRSVERAIAADLPERFGIIFDGWSHASEHFIAVFAWYEVDE--AIRC-----------  174

Query  63   VGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADIC  122
                        PLL MA L+N+E + LSA  H  FL TML RDY K+L  C FLV D C
Sbjct  175  ------------PLLSMAPLVNEETDDLSAATHQAFLRTMLLRDYNKRLEQCVFLVGDNC  222

Query  123  SVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELD  160
            SVNRRLATLMGVPLVGCASHRLNRAV  EL+++ E+LD
Sbjct  223  SVNRRLATLMGVPLVGCASHRLNRAVAAELSEHAEDLD  260

>PPTG_17033
Length=191

 Score = 163 bits (412),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 104/162 (64%), Gaps = 25/162 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +TR V++ IAAE+P RFG++FDGWTHASEHY+A +   EV+                
Sbjct  35   MEGVTREVERKIAAELPARFGVMFDGWTHASEHYVAWFACDEVN----------------  78

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                      V  TPLL MA L+N+ ++ LSAR H EFLATMLPRDYG Q+  C F+V D
Sbjct  79   ---------GVLVTPLLAMAPLINEPDDNLSARSHYEFLATMLPRDYGVQIDQCRFVVGD  129

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             CSVNR LA LM VPLVGCASHRLNRAVQ  L  +EE+L  V
Sbjct  130  NCSVNRSLAILMRVPLVGCASHRLNRAVQHYLLQHEEDLAAV  171

>PPTG_00493
Length=220

 Score = 161 bits (407),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 108/162 (67%), Gaps = 25/162 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M SLTR V++ IAAE+ +RF  +FDGWTHAS+H+IAV+  Y+                  
Sbjct  37   MDSLTRIVERAIAAELLERFEFLFDGWTHASQHFIAVFACYD------------------  78

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                   +  V KTPLL MA LL+  ++ LSAR HMEFLA MLPRDYGKQL  C FLVAD
Sbjct  79   -------AGGVRKTPLLSMAPLLDALDDDLSARDHMEFLANMLPRDYGKQLSQCLFLVAD  131

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             C+VNR LATLMGVPLVGCASHRLN AVQ ++ + + +LD V
Sbjct  132  NCAVNRLLATLMGVPLVGCASHRLNLAVQADMEESKTDLDVV  173

>PHYSO_248221
Length=478

 Score = 167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 118/216 (55%), Gaps = 56/216 (26%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++TR V+  IAAEMP+ FGLIFDGW+H SEHYIAV+  YEVD   V RC         
Sbjct  134  MDAVTRCVEHAIAAEMPEEFGLIFDGWSHDSEHYIAVFACYEVDG--VLRC---------  182

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                          PLLCMA L+NDE +  SA  H  FLATML RDY K+L    FLV D
Sbjct  183  --------------PLLCMAPLVNDETDDFSAASHQAFLATMLARDYQKRLDQVLFLVGD  228

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C VNRRLATLMGVPL+G                ++ +L  +                  
Sbjct  229  NCGVNRRLATLMGVPLIG----------------FKTDLRPII---------------RQ  257

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            +TR GSTF MI RYF LL FIDA DDEL +++P  A
Sbjct  258  QTRWGSTFAMINRYFELLPFIDAEDDELAELLPPAA  293

>PPTG_13610
Length=307

 Score = 163 bits (412),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 108/162 (67%), Gaps = 25/162 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M SLTR V++ IAAE+P+RFGL+FDGWTH+S+H+IA +  Y+                  
Sbjct  154  MDSLTRVVERAIAAELPERFGLLFDGWTHSSQHFIAAFACYD------------------  195

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                   +  V KT LL MA LL+  ++ LSARGHMEFLA MLPRDYGKQL  C FLVAD
Sbjct  196  -------AGGVRKTALLSMAPLLDALDDDLSARGHMEFLANMLPRDYGKQLSQCLFLVAD  248

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             C+VNR LATLMGVPL+GCASHRLN AVQ ++     +LD V
Sbjct  249  NCAVNRLLATLMGVPLLGCASHRLNLAVQADMEKSTTDLDVV  290

>PPTG_12744
Length=160

 Score = 157 bits (397),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 103/162 (64%), Gaps = 28/162 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  + R V++VIA+EMP+R GLI DGWTH S+HY+AV+  YE++  +             
Sbjct  1    MDGVARAVERVIASEMPERCGLILDGWTHCSKHYVAVFACYELNGKS-------------  47

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KTPL  M  LLNDE+  LSA  H EFLA MLPRD+G+Q+  C FLV D
Sbjct  48   ------------KTPLFSMTPLLNDEDNDLSAVAHREFLADMLPRDFGRQVHECVFLVGD  95

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             CSVNRRLATL+G   VGCASH+LNRAVQ EL ++E +L  V
Sbjct  96   NCSVNRRLATLVG---VGCASHQLNRAVQRELQEHENDLAAV  134

>PPTG_05227
Length=507

 Score = 166 bits (421),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 131/226 (58%), Gaps = 46/226 (20%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            + S+TR V++ IAA++P+RF           EH+IAV+  YEVD     RC         
Sbjct  125  LESVTRSVERAIAADLPERF-----------EHFIAVFAWYEVDE--AIRC---------  162

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                          PLL MA L+N+E + LSA  H  FL TML RDY K+L  C FLV D
Sbjct  163  --------------PLLSMAPLVNEETDDLSAATHQAFLRTMLLRDYNKRLEQCVFLVGD  208

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             CSVNRR ATLMGVPLVGCAS RLNRAV  EL+++ E+LD VQ LMLKL+      +   
Sbjct  209  NCSVNRRFATLMGVPLVGCASRRLNRAVAAELSEHAEDLDLVQTLMLKLRTLTQSAKLRL  268

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR GST  M+ R+F LL F+D  DDEL +++PSPA
Sbjct  269  KTILRPIIRQQTRWGSTVAMLNRFFELLPFLDTDDDELAELLPSPA  314

>PHYSO_326975
Length=472

 Score = 165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 127/216 (59%), Gaps = 34/216 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++TR V+  IAAEMP+ FG IFDGW+H SEH IAV+  YEVD   V RC         
Sbjct  119  MDAVTRCVEHAIAAEMPEEFGRIFDGWSHDSEHNIAVFACYEVDG--VLRC---------  167

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                          PLLCMA L+NDE +  SA  H  FLATML RDY K+L    FLV D
Sbjct  168  --------------PLLCMAPLVNDETDDFSAASHQAFLATMLARDYQKRLDQVLFLVGD  213

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C VNRRLATLMGVPL GCASHRLNRAV   L++  E++D VQ LM+KL+   +    SA
Sbjct  214  NCGVNRRLATLMGVPLFGCASHRLNRAVAARLSECAEDVDMVQALMVKLRTLHH----SA  269

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K R  +    I+R     E     DDEL +++P  A
Sbjct  270  KLRFKTDLRPIIRQQTRWE-----DDELAELLPPAA  300

>PHYSO_288514
Length=247

 Score = 157 bits (397),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 107/162 (66%), Gaps = 25/162 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+V YEV+                
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFVCYEVN----------------  63

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        KT LL MA LL+  ++ LSA+GH+EFLATMLPRD G QL  C FLVAD
Sbjct  64   ---------GCPKTTLLSMAPLLDALDDDLSAQGHLEFLATMLPRDSGVQLAQCRFLVAD  114

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             C+VNRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  V
Sbjct  115  NCAVNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLAAV  156

>PHYCA_100643
Length=214

 Score = 155 bits (392),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 90/140 (64%), Gaps = 25/140 (18%)

Query  16   MPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTP  75
            MPD FGLI  GWTH SEHYIAV+ RYEV                             KTP
Sbjct  100  MPDAFGLILVGWTHMSEHYIAVFARYEVKGK-------------------------VKTP  134

Query  76   LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVP  135
            LLCMA L+N+ ++ LSA  H EFL   LPRD+GKQLG C ++V D CSVNRRLATL+GVP
Sbjct  135  LLCMAPLMNEPDDDLSADAHREFLTYTLPRDFGKQLGQCVYIVGDNCSVNRRLATLVGVP  194

Query  136  LVGCASHRLNRAVQLELADY  155
            L+GCA HRLNRAVQ +L ++
Sbjct  195  LIGCAPHRLNRAVQHKLQEH  214

>PHYCA_123222
Length=252

 Score = 155 bits (392),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 100/127 (79%), Gaps = 10/127 (8%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            MLPRDYGKQLGMCCFLVAD CSVNRRLATLM VPLVGCASHRLNRAVQLEL  YEEELDT
Sbjct  1    MLPRDYGKQLGMCCFLVADNCSVNRRLATLMDVPLVGCASHRLNRAVQLELEGYEEELDT  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQKLMLKL+      +  AK          TR GSTF MI RYF LLEFIDAIDDELED+
Sbjct  61   VQKLMLKLRTLTQSAKLRAKTQLRPVIRQDTRWGSTFSMIKRYFDLLEFIDAIDDELEDL  120

Query  212  MPSPAQT  218
            MPSPAQ 
Sbjct  121  MPSPAQN  127

>PPTG_03398
Length=498

 Score = 160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 124/226 (55%), Gaps = 36/226 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +T+ V+  I  EMPD+FGL+ DGWTH +EHY+ V+  YE  S   +           
Sbjct  137  MEGVTKAVEIKIGNEMPDKFGLLLDGWTHGTEHYLGVFACYETPSGPQY-----------  185

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                          PLL +A ++ D      A  HM  LA  LP  +GK L  C FLV D
Sbjct  186  --------------PLLSLAPIVVDAAGRFDAETHMAALAAFLPY-FGKDLSNCIFLVGD  230

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VN+RLA LMG+PLVGCASHRLN AV+  L  +E +L+ VQ LM +L+      +   
Sbjct  231  NCAVNKRLARLMGIPLVGCASHRLNLAVRTLLEPHEADLEQVQSLMKRLRTLTQAAKLRL  290

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR GST+ M+ RYF L EFI A D++L D+MPSPA
Sbjct  291  KTSLKPKLRQETRWGSTYAMLARYFALREFISADDEDLADLMPSPA  336

>PPTG_16734
Length=346

 Score = 156 bits (394),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 130/234 (56%), Gaps = 36/234 (15%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++T+ V++ I  E+P+ FG++ DGWTH SEHY+AV+  YE++                
Sbjct  136  MENVTKAVERRIGDELPENFGIVLDGWTHGSEHYLAVFACYELN----------------  179

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                      V + PLL MA ++N  ++ L+A  HM  L+  LP  +GK L    FLV D
Sbjct  180  ---------GVRQAPLLSMAPIINGPDDSLNAESHMAALSAFLP-FFGKTLSNVIFLVGD  229

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C VN+RLA L+ +PLVGCASHRLN AVQ  +A YEEEL+ VQ LM +L+      +   
Sbjct  230  NCEVNKRLARLLVLPLVGCASHRLNLAVQSFIAPYEEELEQVQSLMKRLRTINQAAKLRL  289

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQTAVCELC  224
            K          TR GST+ M+ RYF L  FI A D+EL + MPS A     + C
Sbjct  290  KTRIRPKLRQVTRWGSTYTMLSRYFELRGFISADDEELAEEMPSLAVKRKLKRC  343

>PHYSO_284383
Length=300

 Score = 152 bits (384),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 125/226 (55%), Gaps = 55/226 (24%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  Y+V                 
Sbjct  20   MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYKV-----------------  62

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                    +   KT LL MA LL+ +++ LSA+GH+EFLAT LPRDYG QL         
Sbjct  63   --------NGCPKTTLLSMAPLLDAQDDDLSAQGHLEFLATTLPRDYGVQLA--------  106

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
                         VPLVGCASHRLN AVQ ++A +EE+L  VQ LM+KL+      +   
Sbjct  107  ------------HVPLVGCASHRLNLAVQADMASHEEDLAVVQALMVKLRTLTQSAKLRL  154

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR  STF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  155  KTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  200

>PHYSO_254622
Length=405

 Score = 148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 117/219 (53%), Gaps = 53/219 (24%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ IAAE+P +FGLI DGWTH  EHY+AV+ R+EV+   +                   
Sbjct  109  VERSIAAEIPPQFGLILDGWTHLGEHYLAVFARFEVNGQVM-------------------  149

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                  TPLLCMA LL +E++ LSA  H EFLA MLPRD+GKQL  C ++V   C  NRR
Sbjct  150  ------TPLLCMAPLLQEEDDDLSAVAHREFLANMLPRDFGKQLDQCVYIVGGNCRANRR  203

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
            LAT                    EL D+E +L  VQ LM KL+      +   K      
Sbjct  204  LAT------------------SKELEDHEADLSDVQNLMTKLRTLTQSVKLRLKTKLRPV  245

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                TR  STF M+ RYF LLE +DA DD++ D++P+PA
Sbjct  246  IRQDTRWSSTFTMLHRYFELLEHLDAHDDDIADLLPAPA  284

>PHYSO_286113
Length=379

 Score = 146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 115/191 (60%), Gaps = 35/191 (18%)

Query  33   HYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSA  92
            HYIAV+  YEV+                            KT LL MA LL+  ++ LSA
Sbjct  27   HYIAVFACYEVN-------------------------GCPKTTLLSMAPLLDALDDDLSA  61

Query  93   RGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLEL  152
            +GH+EFLATMLPRDYG QL  C FLVAD C+VNRRLATLM VPLVGCASHRLN  VQ ++
Sbjct  62   QGHLEFLATMLPRDYGVQLAQCRFLVADNCAVNRRLATLMSVPLVGCASHRLNSKVQADM  121

Query  153  ADYEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFID  202
            A +EE+L  VQ LM+KL+      +   K          TR  STF M+ RY  LLEF+D
Sbjct  122  ASHEEDLAAVQALMVKLRTLTQSAKLLLKTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLD  181

Query  203  AIDDELEDMMP  213
            A DD+L D++P
Sbjct  182  AEDDDLMDLLP  192

>PHYSO_260684
Length=451

 Score = 147 bits (371),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 117/219 (53%), Gaps = 53/219 (24%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ IAAE+  +FGLI DGW H  EHY+AV+  YEV+   +                   
Sbjct  140  VERSIAAEIRPQFGLILDGWIHLGEHYLAVFAPYEVNGQVM-------------------  180

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                  TPLLCMA LL +E++ LSA  H EFLA MLPRD+GKQL  C ++V D C VNRR
Sbjct  181  ------TPLLCMAPLLQEEDDDLSAVAHREFLANMLPRDFGKQLDQCVYIVGDNCRVNRR  234

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
            LATL                   EL D+E +L  VQ LM KL+      +   K      
Sbjct  235  LATLK------------------ELEDHEADLSDVQSLMTKLRTLAQSAKLRLKTKLRPV  276

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                TR  STF M+ RYF LLE +DA DD++ D++P+PA
Sbjct  277  IRQDTRWSSTFTMLHRYFELLEHLDAHDDDIADLLPAPA  315

>PPTG_15227
Length=518

 Score = 144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 127/228 (56%), Gaps = 44/228 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++T+ V++ + A MP+ FGLI DGWTH +EHY+AVY                      
Sbjct  136  MEAVTKAVEKKLGASMPEHFGLILDGWTHKTEHYMAVY----------------------  173

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
               G F + +  + PLL +A +++  ++ LSA GH+  +   LP  +GK +  C FLV D
Sbjct  174  ---GCFETASGPQYPLLSLAPVMDQPDDHLSADGHLTAIKRFLPF-FGKSISGCLFLVGD  229

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VN+RLA L+G+PL+GCASHRLN AV+    DY E  D + + + +L +KL   + +A
Sbjct  230  NCTVNKRLANLLGLPLIGCASHRLNLAVR----DYLEPHDIILEKVQQLMRKLRTLKQAA  285

Query  181  K--------------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
            K              TR  STF M+ RY  L E I A D+EL D++PS
Sbjct  286  KLRAKTPLVAVLRQDTRWSSTFAMLKRYCKLRECISADDEELADLLPS  333

>PPTG_17803
Length=233

 Score = 135 bits (341),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 121/223 (54%), Gaps = 35/223 (16%)

Query  3    SLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKT  62
            S+T+ V++ I  EMPD FGL+ D W+  +E ++A+Y                        
Sbjct  32   SVTKAVEKAIGEEMPDEFGLMLDDWSQDTEQFLAIY------------------------  67

Query  63   VGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADIC  122
             G + S    + PLL MA ++++ ++ L+A   M  +   LP  +GK +  C FLV D C
Sbjct  68   -GCYDSPGGPRYPLLSMAPVMDEPDDHLNAEERMRAIVRFLPF-FGKTINGCKFLVGDNC  125

Query  123  SVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRS----  178
            +VN+RLA LM VPLVGCA HRL+ AV+  L  +E  LD VQ+LM K + K +C       
Sbjct  126  AVNKRLANLMNVPLVGCARHRLSLAVREFLVPFETALDQVQQLMRKHRTKPSCKMRMKTP  185

Query  179  -----SAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                 S  TR  STF M+ RY  L EF+ A DD++ D++PS A
Sbjct  186  LMPILSQDTRWSSTFSMLERYIRLREFLSANDDDMMDLLPSRA  228

>H257_09825
Length=462

 Score = 140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 124/226 (55%), Gaps = 36/226 (16%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            LT  V++ I+ E+PDRFG+IFDGWTH SEHY+AV+  YE                     
Sbjct  139  LTEVVEKKISKEIPDRFGIIFDGWTHNSEHYLAVFASYE---------------------  177

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
                 D V   PLL +A ++++ ++  SA+ H   + ++L   + K +  C FLV D CS
Sbjct  178  ----KDGVLVQPLLSLAPIIHEPDDDHSAKTHYTAIKSVLAM-FKKTITQCVFLVGDNCS  232

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDR------  177
            VN+ LA LM VPL+GCASHRLN AV+     +E+EL  +Q+LM+KL+      +      
Sbjct  233  VNKTLAKLMSVPLIGCASHRLNLAVKAYTQQHEDELAKIQQLMIKLRTLNQASKLLFRTE  292

Query  178  ----SSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQTA  219
                    TR  STF M+ R+F L E +D  DD + +++P+   +A
Sbjct  293  LRPILRQDTRWSSTFAMLQRFFELREHLDHEDDTILEILPTLGGSA  338

>PPTG_18543
Length=335

 Score = 136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 121/223 (54%), Gaps = 35/223 (16%)

Query  3    SLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKT  62
            S+T+ V++ I  EMPD FGL+ D W+  +E ++A+Y                        
Sbjct  32   SVTKAVEKAIGEEMPDEFGLMLDDWSQDTEQFLAIY------------------------  67

Query  63   VGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADIC  122
             G + S    + PLL MA ++++ ++ L+A   M  +   LP  +GK +  C FLV D C
Sbjct  68   -GCYDSPGGPRYPLLSMAPVMDEPDDHLNAEERMRAIVRFLPF-FGKTINGCKFLVGDNC  125

Query  123  SVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRS----  178
            +VN+RLA LM VPLVGCA HRL+ AV+  L  +E  LD VQ+LM K + K +C       
Sbjct  126  AVNKRLANLMNVPLVGCARHRLSLAVREFLVPFETALDQVQQLMRKHRTKPSCKMRMKTP  185

Query  179  -----SAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                 S  TR  STF M+ RY  L EF+ A DD++ D++PS A
Sbjct  186  LMPILSQDTRWSSTFSMLERYIRLREFLSANDDDMMDLLPSRA  228

>PPTG_08830
Length=405

 Score = 133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 115/226 (51%), Gaps = 36/226 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            + S+ R V+  I  +MP R+GLI DGW+  SEHY+AV+                      
Sbjct  79   LESVMRHVEVAIKPDMPKRYGLITDGWSFNSEHYLAVF----------------------  116

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
               G F     A+ PL  MA L+N     LSA  H+ FL  ML RDY K++    F V D
Sbjct  117  ---GCFEMAGTAQYPLPAMAPLMNSPTNDLSAATHLTFLREMLMRDYNKRVEDYLFTVGD  173

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDR---  177
             C  N+ LA L+ VPLVGCA+H LN AVQ    +  ++LD V+ LM+KL+          
Sbjct  174  NCYTNQCLANLLCVPLVGCATHHLNLAVQNFFREVSDDLDKVKSLMVKLKSLYQSSTLRF  233

Query  178  -------SSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                    S  TR  STF MI R+F LLEFI   DDEL D +P PA
Sbjct  234  KTPLRPVLSQDTRWSSTFCMIHRFFRLLEFI-IDDDELADNLPGPA  278

>PPTG_12757
Length=420

 Score = 133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 115/226 (51%), Gaps = 60/226 (27%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M SLT+ V+  +  EMPD+FGL+ DGWTH SEHY+AV+  YE                  
Sbjct  63   MESLTKAVEVHVGNEMPDKFGLMLDGWTHGSEHYLAVFGCYETR----------------  106

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                       A   ++ +  +  D+E                       L  C FLV D
Sbjct  107  -----------AGPSIIGIPAIFFDKE-----------------------LSNCIFLVGD  132

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VN RLA LMGVPLVGCASHRLN AV+ +L  +E++L+ VQ LM +L+      +   
Sbjct  133  NCAVNMRLARLMGVPLVGCASHRLNLAVRTQLDPHEKDLEQVQSLMKRLRTLTQAAKLRL  192

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            K          TR GST+ M+ RYF L EFI+  D+EL ++MPSPA
Sbjct  193  KTPLRPKLRQQTRWGSTYAMLARYFELREFINVNDEELVELMPSPA  238

>PHYSO_337039
Length=450

 Score = 130 bits (328),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 117/215 (54%), Gaps = 39/215 (18%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++T+ ++ +I   MP+RFGL+ DGWTH +EHY+AVY                      
Sbjct  92   MEAVTKAMETMIGDTMPERFGLVLDGWTHGTEHYMAVY----------------------  129

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
               G F +    + PLL +A ++++ ++ LSA GH+  +   LP  +GK +  C FLV D
Sbjct  130  ---GCFETATGPQYPLLSLAPVMDEPDDRLSADGHLTAIKRFLPF-FGKSISGCLFLVGD  185

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqq-klNCDRSS  179
             C VN+RLA L+GVPL+GCASHRLN AV+    DY E  D++ + + +L   + +   SS
Sbjct  186  NCGVNKRLANLLGVPLIGCASHRLNLAVR----DYLEPHDSILEEIQQLMLPRPHWPLSS  241

Query  180  AKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
             +T  G   F          FI A D+EL D +PS
Sbjct  242  DRTSAGRRPFQ--------PFISADDEELADFLPS  268

>PPTG_10216
Length=327

 Score = 128 bits (322),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 96/147 (65%), Gaps = 10/147 (7%)

Query  79   MAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
            MA L+N+ ++   AR H+ FL+TML RDYGK L  C F+VAD C+VNR LATLMGVPLVG
Sbjct  1    MAPLINESDDDHGARTHLAFLSTMLERDYGKSLRNCLFVVADNCAVNRLLATLMGVPLVG  60

Query  139  CASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTF  188
            CASHRLN AVQ  L DYE++L  +Q LM K++          K          TR GST+
Sbjct  61   CASHRLNLAVQDYLRDYEDDLIVLQTLMRKMKTLNYAAALRFKTPLRPIIRQDTRWGSTY  120

Query  189  FMIMRYFYLLEFIDAIDDELEDMMPSP  215
             M+ RYF + E++   DD++ +++PSP
Sbjct  121  AMVERYFRISEYLPVEDDDVAELLPSP  147

>PHYCA_120756
Length=236

 Score = 125 bits (315),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 10/125 (8%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            ML RDY K+L  C FLV D CSVNRRLATLMGVPLVGCASHRLNRAV  +L+++ E+LD 
Sbjct  1    MLLRDYNKRLEQCVFLVGDNCSVNRRLATLMGVPLVGCASHRLNRAVAAQLSEHAEDLDL  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQ LMLKL+      +   K          TR GSTF M+ R+F LL F+D  DDEL ++
Sbjct  61   VQTLMLKLRTLTQSAKLRLKTSLRPIIRQQTRWGSTFAMLNRFFELLPFLDTDDDELAEL  120

Query  212  MPSPA  216
            +PSPA
Sbjct  121  LPSPA  125

>PHYSO_475994
Length=248

 Score = 126 bits (316),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 85/125 (68%), Gaps = 10/125 (8%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            MLPRDYG QL  C FLVAD C+VNRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  
Sbjct  1    MLPRDYGVQLAQCRFLVADNCTVNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLAA  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQ LM+KL+      +   K          TR  STF M+ RY  LLEF+DA DD+L D+
Sbjct  61   VQALMVKLRTLTQSAKLRLKTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLDAEDDDLMDL  120

Query  212  MPSPA  216
            +P PA
Sbjct  121  LPPPA  125

>PPTG_13171
Length=288

 Score = 126 bits (317),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 115/217 (53%), Gaps = 37/217 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M S+ + V++ I   MP  FGL+ DG+T A+EH++AVY  YE      F+          
Sbjct  1    MESVVKAVQKSIGEGMPKSFGLVIDGYTQATEHFLAVYACYESSDGPRFQ----------  50

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                           LL MA ++++ ++ L+A GH   +A  LP  +G+ L    FLV D
Sbjct  51   ---------------LLSMAPIIDEPDDALNADGHAAAIARFLPF-FGRSLDDVRFLVND  94

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VN+RLA LMGVPLVGCASHRLN AV+  LA +E+ L  VQ LM KL        S+ 
Sbjct  95   NCAVNKRLANLMGVPLVGCASHRLNLAVREYLAPHEDALAEVQALMRKLVHLSKQPSSAK  154

Query  181  K----------TRGGSTFFMIMRYFYLL-EFIDAIDD  206
            K          TR  STF M+ RYF LL +  D + D
Sbjct  155  KTALQPVLRQDTRWSSTFKMLARYFRLLCKLFDELHD  191

>PHYCA_109215
Length=245

 Score = 125 bits (314),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 10/125 (8%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            ML RDY K+L  C FLV D CSVNRRLATLMGVPLVGCASHRLNRAV  +L+++ E+LD 
Sbjct  1    MLLRDYNKRLEQCVFLVGDNCSVNRRLATLMGVPLVGCASHRLNRAVAAQLSEHAEDLDL  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQ LMLKL+      +   K          TR GSTF M+ R+F LL F+D  DDEL ++
Sbjct  61   VQTLMLKLRTLTQSAKLRLKTSLRPIIRQQTRWGSTFAMLNRFFELLPFLDTDDDELAEL  120

Query  212  MPSPA  216
            +PSPA
Sbjct  121  LPSPA  125

>PHYCA_114634
Length=246

 Score = 124 bits (312),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (70%), Gaps = 10/125 (8%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            MLPRD+GKQL  C F+V D C+VNR LATL+GVPLVGCASHRLNRAVQ+++  YE++L  
Sbjct  1    MLPRDFGKQLEACLFIVGDNCTVNRLLATLIGVPLVGCASHRLNRAVQVDMKQYEDDLSG  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQ LM++L+      +  +K          TR  STF M+ RYF LLE +D  DD++ D+
Sbjct  61   VQALMVRLRTLKQSAKLRSKTSLRPIIRQDTRWSSTFSMVHRYFKLLEHLDPTDDDIVDV  120

Query  212  MPSPA  216
            +P+P+
Sbjct  121  LPAPS  125

>PHYSO_471883
Length=262

 Score = 124 bits (312),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 84/125 (67%), Gaps = 10/125 (8%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            MLPRDYG QL  C FLVAD C+VNRRLATLM +PLVGCASHRLN AVQ ++A +EE L  
Sbjct  1    MLPRDYGVQLAQCRFLVADNCAVNRRLATLMSLPLVGCASHRLNLAVQADMASHEEALAA  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQ LM+KL+      +   K          TR  STF M+ RY  LLEF+DA DD+L D+
Sbjct  61   VQALMVKLRTLTQSAKLRLKTPLRPVIRQDTRWSSTFKMVRRYLQLLEFLDAEDDDLMDL  120

Query  212  MPSPA  216
            +P PA
Sbjct  121  LPPPA  125

>PHYCA_130818
Length=188

 Score = 122 bits (306),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 85/125 (68%), Gaps = 10/125 (8%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            ML RDY K+L  C FLV D CSVNRRLATLMGVPLVGCASHRLNRAV  +L+++ E+LD 
Sbjct  1    MLLRDYNKRLEQCVFLVGDNCSVNRRLATLMGVPLVGCASHRLNRAVAAQLSEHAEDLDL  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQ LMLKL+      +   K          TR GSTF M+ R+F LL F+D  DDEL ++
Sbjct  61   VQTLMLKLRTLTQSAKLRLKTSLRPIIRQQTRWGSTFAMLNRFFELLPFLDTDDDELAEL  120

Query  212  MPSPA  216
            + SPA
Sbjct  121  LTSPA  125

>PHYSO_254669
Length=282

 Score = 125 bits (313),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 97/162 (60%), Gaps = 26/162 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++ + V   IAAE+ DRF L+ DGW++AS + +AV++ YE++                
Sbjct  130  MEAVAQSVGLDIAAELLDRFWLMLDGWSYASVYCVAVFIYYEIN----------------  173

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                      VA+  LL MA ++ + ++ LSAR H +FLA +L   +GK L  C FLVAD
Sbjct  174  ---------GVAQYALLSMAPIIQEPDDDLSARTHRDFLAGLLD-GFGKTLSGCVFLVAD  223

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             CSVNR LA +M VPLVGCASHRLNRAVQ  L  YE++L  V
Sbjct  224  NCSVNRCLAVIMQVPLVGCASHRLNRAVQCHLEQYEDDLAVV  265

>H257_02526
Length=288

 Score = 124 bits (312),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 93/159 (58%), Gaps = 26/159 (16%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            LT  V++ I+ E+PDRFG+IFDGWTH SEHY+AV+  YE                     
Sbjct  139  LTEVVEKEISKEIPDRFGIIFDGWTHNSEHYLAVFGSYE---------------------  177

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
                 D V + PLL +A ++++ ++  SA+ H   + ++L   + K +  C FLV D CS
Sbjct  178  ----KDGVFEQPLLSLAPIIHEPDDYHSAKTHYTAIKSVLAM-FKKTIKQCVFLVGDNCS  232

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            VN++LA LM VPL+GCASHRLN AV+     +E+EL  +
Sbjct  233  VNKKLAKLMSVPLIGCASHRLNLAVKAYTQQHEDELAKI  271

>PPTG_13659
Length=530

 Score = 128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 113/214 (53%), Gaps = 26/214 (12%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +T+ V++ I  +MP  FGL+FDGW+H +EHY+AVY  Y+  S   +           
Sbjct  136  MEDVTKAVERSIGLDMPTEFGLMFDGWSHGTEHYLAVYACYDGPSGPCY-----------  184

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                          PLL MA ++++ ++ L A GH+  +   LP  +GK +  C F+V D
Sbjct  185  --------------PLLSMAPIMDEPDDQLGAEGHLIAIERFLPF-FGKTIEGCKFIVGD  229

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             CSVN+RLA +MGVPLVGCASHRL  AV+  L  +E+ L+ +Q LM K +      +   
Sbjct  230  NCSVNKRLANMMGVPLVGCASHRLQLAVRDYLTPHEDALEEIQILMRKPRTLKQAAKLRT  289

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
            KT          R+      +   D+E+ D++PS
Sbjct  290  KTPLMPVLRQATRWSSTFAMLKPDDEEISDLLPS  323

>PHYSO_477890
Length=250

 Score = 123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 88/138 (64%), Gaps = 15/138 (11%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            ML RDYG QL  C FLVAD C+VNRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  
Sbjct  1    MLQRDYGVQLAQCRFLVADNCAVNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLAA  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQ LM+KL+      +   K          TR  STF M+ RY  LLEF+DA DD+L D+
Sbjct  61   VQALMVKLRTLTQSAKLRLKTPLRPVLRQDTRWSSTFEMVRRYLQLLEFLDAEDDDLMDL  120

Query  212  MPSPA-----QTAVCELC  224
            +P PA     Q    ELC
Sbjct  121  LPPPAMNKRLQALYQELC  138

>PHYSO_516015
Length=209

 Score = 121 bits (303),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 83/125 (66%), Gaps = 10/125 (8%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            ML RDYG QL  C FLVAD C+VNRRLATLM VPLVGCASHRLN AVQ ++A +EE+L  
Sbjct  1    MLQRDYGVQLAQCRFLVADNCAVNRRLATLMSVPLVGCASHRLNLAVQADMASHEEDLAA  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            VQ LM+KL+      +   K          TR  STF M+ RY  LLEF+DA DD L D+
Sbjct  61   VQALMVKLRTLTQSAKLRLKTPLRPVIRQDTRWSSTFEMVRRYLQLLEFLDAEDDGLMDL  120

Query  212  MPSPA  216
            +P PA
Sbjct  121  LPPPA  125

>PHYSO_337571
Length=430

 Score = 125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 91/162 (56%), Gaps = 28/162 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  L + VK  +  E+P  FG+  D W+H SEHY+AV+V YE+      RC         
Sbjct  123  MVRLVQHVKASMRRELPGHFGMKLDDWSHNSEHYLAVFVCYELGGQP--RCQ--------  172

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                           L+ MA L+ +  + LSA GH+EFL TML RDYGK L  C +LV D
Sbjct  173  ---------------LIAMAPLVQEPGQNLSAEGHVEFLRTMLARDYGKTLENCLYLVGD  217

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
                NRRLATL+GVPLVG ASHRLN   Q  L D+++ELD V
Sbjct  218  ---TNRRLATLLGVPLVGYASHRLNLVAQNLLEDFKDELDQV  256

>PPTG_12396
Length=288

 Score = 121 bits (304),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 106/183 (58%), Gaps = 30/183 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++T+ V++ + A MP+ FGLI  GWTH +EHY+AVY                      
Sbjct  136  MEAVTKAVEKKLGASMPEHFGLILVGWTHKTEHYMAVY----------------------  173

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
               G F + +  + PLL +A ++++ ++ LSA GH+  +   LP  +GK +  C FLV D
Sbjct  174  ---GCFETASGPQYPLLSLAPVMDEPDDHLSADGHLTAIKRFLPF-FGKSISGCLFLVVD  229

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VN+RLA L+GVPL+GCASHRLN AV+    DY E  D + + + +L +KL   + +A
Sbjct  230  NCTVNKRLANLLGVPLIGCASHRLNLAVR----DYLEPHDNILEKVQQLMRKLRTLKQAA  285

Query  181  KTR  183
            K R
Sbjct  286  KLR  288

>PPTG_04998
Length=238

 Score = 118 bits (295),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 107/216 (50%), Gaps = 66/216 (31%)

Query  3    SLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKT  62
            ++TR V++ IA ++ +RFG+IFDGW+HAS+H+IAV  RYEV      RC           
Sbjct  78   AVTRSVERAIAVDLLERFGIIFDGWSHASQHFIAVLARYEVGEEV--RC-----------  124

Query  63   VGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADIC  122
                        PLL MA L                               C FLV D C
Sbjct  125  ------------PLLSMAPL-------------------------------CVFLVGDNC  141

Query  123  SVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK-  181
            + N RLATLM +P +GCASHRL+RAV  +L ++  +LD VQ LMLKL+      +   K 
Sbjct  142  TANHRLATLMDIPRIGCASHRLSRAVAAQLKEHAGDLDLVQTLMLKLRTLTQSAKLRLKT  201

Query  182  ---------TRGGSTFFMIMRYFYLLEFIDAIDDEL  208
                     TR GS F M+ R+F LL F+DA D+E 
Sbjct  202  SLRPIIRQQTRWGSNFAMLNRFFELLPFLDADDEEF  237

>PHYSO_413615
Length=118

 Score = 113 bits (282),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 67/97 (69%), Gaps = 0/97 (0%)

Query  66   FSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVN  125
            +  D V + PLL MA L+NDE +  SA  H  FLATML RDY K+L    FLV D C VN
Sbjct  5    YEVDGVLRCPLLYMAPLVNDETDDFSATSHQAFLATMLARDYQKRLDQILFLVGDNCGVN  64

Query  126  RRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            RRL TLMGVPLVGCASHRLNRAV   L++  E++D V
Sbjct  65   RRLGTLMGVPLVGCASHRLNRAVAARLSECAEDVDMV  101

>PPTG_04930
Length=97

 Score = 110 bits (276),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 73/122 (60%), Gaps = 25/122 (20%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +TR +++ +AAE+P RFG++FDGWTHASEHY+A +  YEV+   V            
Sbjct  1    MEGVTRAIERKLAAELPARFGVLFDGWTHASEHYVAWFACYEVNGVLV------------  48

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                         TPLL MA L+N+  +GLSAR H EFLATMLPRD+G Q+  C  +V D
Sbjct  49   -------------TPLLAMAPLMNEPADGLSARSHYEFLATMLPRDFGAQIDQCRLIVGD  95

Query  121  IC  122
             C
Sbjct  96   SC  97

>PPTG_04453
Length=452

 Score = 115 bits (288),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 92/147 (63%), Gaps = 11/147 (7%)

Query  80   AHLLNDEEEG-LSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
            A LL  E+ G  SA GH  FL +ML RDY K L  C F V D C+VNRRLAT+  +PL+G
Sbjct  167  ASLLIGEDGGDHSAEGHRVFLDSMLQRDYDKSLHDCLFTVGDNCAVNRRLATIAHLPLIG  226

Query  139  CASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTF  188
            CASHRLN AVQ  L  Y++ELD++  LM KL+   +  +  AK          TR  ST+
Sbjct  227  CASHRLNFAVQAYLQSYKDELDSIPNLMRKLRTLNHAAKLRAKTSLRPVLRHDTRWSSTY  286

Query  189  FMIMRYFYLLEFIDAIDDELEDMMPSP  215
             M+ RYF L  FI+A D+++ ++MPSP
Sbjct  287  AMVGRYFCLAGFIEADDEDMCELMPSP  313

>PHYSO_289239
Length=253

 Score = 108 bits (271),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 14/107 (13%)

Query  110  QLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlkl  169
            +L  C F VAD C+VNRRLATLM VPLVGCASHRLN AVQ  +A +EE+L  V       
Sbjct  61   ELAQCRFFVADNCAVNRRLATLMSVPLVGCASHRLNLAVQANMASHEEDLAAV-------  113

Query  170  qqklNCDRSSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                   ++   TR GSTF M+ RY  LLEF+DA DD+L D++P PA
Sbjct  114  -------QALMDTRWGSTFEMVRRYLQLLEFLDAEDDDLMDLLPPPA  153

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 9/85 (11%)

Query  1   MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
           M  +   V++ IA+E+P RFG++ DGWTHASEHYIAV+  YE+     F     AV    
Sbjct  20  MDGVVVAVERSIASELPARFGIMLDGWTHASEHYIAVFACYELAQCRFFVADNCAVNRRL  79

Query  61  KTVGLFSSDAVAKTPLL-CMAHLLN  84
            T        +   PL+ C +H LN
Sbjct  80  AT--------LMSVPLVGCASHRLN  96

>PPTG_24302
Length=359

 Score = 110 bits (276),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 99/212 (47%), Gaps = 59/212 (28%)

Query  5    TRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVG  64
            TR V+  I A+MP R+GLI DGW   SEHY+AV+V +E                +A TV 
Sbjct  41   TRHVEAAIKADMPKRYGLIIDGWAFNSEHYLAVFVGFE----------------KAGTV-  83

Query  65   LFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSV  124
                    + PLL MA L+N   +  SA  H+ FL  +L  DY K++  C F+V + C  
Sbjct  84   --------QYPLLTMAPLMNSPMDDRSAATHLTFLREILLCDYNKRVEDCLFIVGENCYT  135

Query  125  NRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRG  184
            ++RLA L+GVPL+      +                                  S  T  
Sbjct  136  DQRLANLLGVPLLKTPLRPM---------------------------------LSQDTHW  162

Query  185  GSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             ST++MI RYF LLEFI   DDEL D +P PA
Sbjct  163  SSTYYMIHRYFRLLEFIKD-DDELADNLPGPA  193

>PHYSO_250686
Length=484

 Score = 112 bits (280),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 120/224 (54%), Gaps = 36/224 (16%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            +T+ V+  I+A +P  FG++ DGW+  SEHY+AV+                         
Sbjct  129  VTKEVEIGISAFIPLEFGIMLDGWSFHSEHYVAVF-------------------------  163

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
             +F  D  ++  LL +A + +D  E  +A  H+ FL  +LP  + +      +L++D CS
Sbjct  164  AVFEHDQRSEKVLLVLAPIADDSVEDQTAESHVAFLTGILPF-FKRGTSSIIYLLSDNCS  222

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK--  181
            VN RLA L+ VP +GCASHRLN AV + L+DYE  L+ +Q+LM KL+     +R   K  
Sbjct  223  VNTRLADLLQVPFIGCASHRLNLAVNVYLSDYEPLLEQMQQLMRKLRGLSKANRLRQKTN  282

Query  182  --------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQ  217
                    TR GSTF M+ RYF L + +D  DD++  +MP+  Q
Sbjct  283  LRRVLRQATRWGSTFKMLERYFDLRDALDTDDDDIVSLMPTRRQ  326

>PYAP_24840
Length=214

 Score = 106 bits (265),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 87/163 (53%), Gaps = 27/163 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  LT  V+  I A +PDRF +IFDG T+ SEHY+AV+                      
Sbjct  62   MARLTMRVEAAITAFLPDRFSIIFDGRTNQSEHYVAVF----------------------  99

Query  61   KTVGLFSSDAVAKTPLLCMAHLL-NDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVA  119
                 F  D  A+  LL M  LL +DE +  SA  H+ FL T+L   YGK L    +L  
Sbjct  100  ---ATFPHDGKAENVLLAMTPLLADDESDDHSADSHVPFLRTILTF-YGKSLESIMYLAG  155

Query  120  DICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            D CS+N+RLA L+GVPLV CASHRLN AV   ++D +  L+ V
Sbjct  156  DNCSMNQRLANLLGVPLVECASHRLNLAVNNYMSDCKTVLERV  198

>PPTG_11426
Length=373

 Score = 109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 109/224 (49%), Gaps = 56/224 (25%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++T+ V++ I  E+   FGL+ DGWTHA                       PA     
Sbjct  136  MEAVTKAVEKAIGDEISKNFGLVLDGWTHA-----------------------PAF----  168

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                              +A   +++ + L+A  H+  +   LP  +GK +  C FLV D
Sbjct  169  ------------------VAGPCDEQPQQLNAESHLTAIKRFLPF-FGKSVSGCLFLVGD  209

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VN+R++ L+GVPLVGC+SHRLN AV+  L   E++L+ VQ LM KL+          
Sbjct  210  NCAVNKRVSDLVGVPLVGCSSHRLNLAVRDFLEPSEDDLEGVQLLMRKLRTLKQAANLRT  269

Query  181  K----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
            K          TR  STF M+ RYF + EFI A DDEL D +PS
Sbjct  270  KTPLRAVLRQDTRWSSTFSMLKRYFRIREFISADDDELADYLPS  313

>PPTG_05891
Length=337

 Score = 108 bits (269),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 85/148 (57%), Gaps = 4/148 (3%)

Query  71   VAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLAT  130
             A+ PLL MA L++   +  SA  H+ FL  ML RDY K++  C F+V D C  N+RLA 
Sbjct  85   TAQYPLLAMAPLVSYPIDH-SAATHLTFLREMLMRDYNKRVEDCLFIVGDNCYANQRLAN  143

Query  131  LMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRS--SAKTRGGSTF  188
            L+ VPLVGCASHRL+ AV+    +  ++LD          +     R   S  TR  STF
Sbjct  144  LLSVPLVGCASHRLSLAVESFFREVSDDLDKESLNQSAKLRFNTPLRPMLSQDTRWSSTF  203

Query  189  FMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             MI RYF LLEFI   DDEL D +P PA
Sbjct  204  CMIHRYFRLLEFIKD-DDELADNLPGPA  230

>PHYSO_474251
Length=255

 Score = 106 bits (264),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 79/125 (63%), Gaps = 11/125 (9%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            ML RDYGK +  C FLV D CS NRRLATL+GVPLVGCASHRLN A Q  L D+++ELD 
Sbjct  1    MLARDYGKTIENCLFLVGDNCSTNRRLATLLGVPLVGCASHRLNLAAQNLLEDFKDELDQ  60

Query  162  VqklmlklqqklNCDR----------SSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            V+KLM+KL+      +           S  TR  ST  M+ RY  LLEFI   DD+L + 
Sbjct  61   VKKLMIKLKGLNQSAKLRFKTKLRPVLSQATRWSSTLCMVNRYMKLLEFIQD-DDDLAEY  119

Query  212  MPSPA  216
            +P P+
Sbjct  120  LPPPS  124

>PPTG_08674
Length=477

 Score = 108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 112/229 (49%), Gaps = 44/229 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  L R V+ VIA  +P  FG+IFDGWT  SEHY+AV+                      
Sbjct  86   MRLLAREVESVIAGILPKSFGIIFDGWTFRSEHYVAVFAS--------------------  125

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                 F  D   +T L+ MA +++DE    +A  H++FL  +L   YG+      ++V D
Sbjct  126  -----FRHDGKMQTILIAMAPIIDDEISDHTASSHVKFLDVILSY-YGRSKASIAYIVGD  179

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             CSVN  +A  + VP+VGCASHRLN AV L LA   + LD V      + +  N    SA
Sbjct  180  NCSVNGAVADQLQVPMVGCASHRLNLAVNLLLAGDGKLLDKV---QKLMYKMKNSLLVSA  236

Query  181  K--------------TRGGSTFFMIMRYFYLLEFI-DAIDDELEDMMPS  214
            K              TR  STF M+ RYF L EF+ D  +DEL   +P+
Sbjct  237  KLRRKTLLRPVPRQDTRWSSTFAMVNRYFELKEFLSDDDEDELTGFLPT  285

>PHYSO_511059
Length=268

 Score = 103 bits (257),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 87/146 (60%), Gaps = 19/146 (13%)

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
            +++ ++ LSA GH+  +   LP  +GK +  C FLV D C VN+RLA L+GVPL+GCASH
Sbjct  1    MDEPDDQLSADGHLTAIKRFLPF-FGKSISGCLFLVGDNCGVNKRLANLLGVPLIGCASH  59

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK--------------TRGGSTF  188
            RLN AV+    DY E  D++ + + +L +KL   + +AK              TR  STF
Sbjct  60   RLNLAVR----DYLEPHDSILEEVQQLMRKLRTLKQAAKLRAKTPLAAVLRQDTRWSSTF  115

Query  189  FMIMRYFYLLEFIDAIDDELEDMMPS  214
             M+ RYF L  FI A D+EL D +PS
Sbjct  116  SMLKRYFRLRPFISADDEELADFLPS  141

>PHYSO_496273
Length=296

 Score = 104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 85/146 (58%), Gaps = 19/146 (13%)

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
            +++  + LSA GH+  +   LP  +GK +  C FLV D C VN+RLA L+GVPL+GCASH
Sbjct  1    MDEPNDQLSADGHLTAIKRFLPF-FGKSISGCLFLVGDNCGVNKRLANLLGVPLIGCASH  59

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK--------------TRGGSTF  188
            RLN AV+    DY E  D++ + + +L + L   + +AK              TR  STF
Sbjct  60   RLNLAVR----DYLEPHDSILEEVQQLTRTLRTLKQAAKLRAKTPLAAVLRHDTRWSSTF  115

Query  189  FMIMRYFYLLEFIDAIDDELEDMMPS  214
             M+ RYF L  FI A D+EL D +PS
Sbjct  116  SMLKRYFRLRPFISADDEELADFLPS  141

>PPTG_23390
Length=309

 Score = 102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 88/137 (64%), Gaps = 8/137 (6%)

Query  79   MAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
            MA L+ ++ +  SA GH  FL +ML RDYGK L  C F++ D C+ NRRLAT+  +PL+G
Sbjct  1    MAPLIGEDGDDHSAEGHRVFLDSMLQRDYGKSLYDCLFILGDNCAFNRRLATIAHLPLIG  60

Query  139  CASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRGGSTFFMIMRYFYLL  198
            CAS  LN AVQ  L  Y++ELDT+Q LM KL+   +    +AK R      M+ RYF L 
Sbjct  61   CASRWLNIAVQAYLQFYKDELDTIQNLMRKLRTLNH----AAKLRHA----MMDRYFCLA  112

Query  199  EFIDAIDDELEDMMPSP  215
             FI+A D+EL ++M SP
Sbjct  113  GFIEADDEELCELMASP  129

>PPTG_20277
Length=404

 Score = 103 bits (256),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 107/220 (49%), Gaps = 40/220 (18%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V Q +  E+ + FGL+FDGW+HA  HY+A++  YE D                       
Sbjct  23   VGQQLEKELGELFGLMFDGWSHAGIHYVALFAVYEADGKL--------------------  62

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                   PLL ++ L +  +   +A  H++   + L   Y K L M  F+V D C+ NR 
Sbjct  63   -----HVPLLGLSPLADGTQ---TADAHVQLFKSTLD-VYNKTLSMVAFMVGDNCNTNRS  113

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
            +AT +GVPLVGCASHR N AV   L  +E  L  V  LM++L+ + N    S        
Sbjct  114  IATKLGVPLVGCASHRFNLAVNKFLEPHEALLSDVNSLMVELRHENNLAELSKYTELLPV  173

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQ  217
                TR  STF M+ RY  +   I  + + +E+++P+ A+
Sbjct  174  KRNVTRWSSTFTMVQRYIRIRSDIKKV-EAVEELIPTGAK  212

>PHYSO_510021
Length=270

 Score = 100 bits (248),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 19/146 (13%)

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
            +++ ++ LSA GH+  +   L   +GK +  C FLV D C VN+RLA L+GVPL+GCASH
Sbjct  1    MDEPDDQLSADGHLTAIKRFLSF-FGKSISGCLFLVGDNCGVNKRLANLLGVPLIGCASH  59

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK--------------TRGGSTF  188
            RLN AV+    DY E  D++ + + +L +KL   + +AK              TR  STF
Sbjct  60   RLNLAVR----DYLEPHDSILEEVQQLMRKLRTLKQAAKLRAKTPLAAVLRQDTRWSSTF  115

Query  189  FMIMRYFYLLEFIDAIDDELEDMMPS  214
             M+ RYF L  FI A D+EL D +PS
Sbjct  116  SMLKRYFRLRPFISADDEELADFLPS  141

>PHYRA_78526
Length=260

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/215 (31%), Positives = 96/215 (45%), Gaps = 78/215 (36%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++T+ ++ VI  E P+ FG + DGW+H +EHY+AVY  YE ++   F           
Sbjct  1    MEAVTKAMENVIGVETPESFGFVIDGWSHGTEHYLAVYACYETEAGPQF-----------  49

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                          PLL +A ++++ ++ L+A GH+  +  +LP           F V D
Sbjct  50   --------------PLLSLAPVMDEPDDQLNAEGHLTAMKRILP----------FFFVGD  85

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+VN+RLA L+GVPLVG                                          
Sbjct  86   NCAVNKRLANLLGVPLVGY-----------------------------------------  104

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDEL-EDMMPS  214
             TR  ST  MI RYF L EF+ A ++EL ED +PS
Sbjct  105  -TRWLSTRSMIKRYFRLREFVSADNEELEEDYLPS  138

>PHYCA_129211
Length=270

 Score = 99.4 bits (246),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 86/146 (59%), Gaps = 11/146 (8%)

Query  79   MAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
            MA +++D     +A  H+ FL ++LP  Y + +    +LV D CSVN RLA L+ VP +G
Sbjct  1    MAPIVDDTTADHTADSHVSFLESVLPF-YKRDIRSIAYLVGDNCSVNTRLADLLNVPFIG  59

Query  139  CASHRLNRAVQLELADYEEELDTVqklmlklqqklNC----------DRSSAKTRGGSTF  188
            CASHRLN AV+L LA+YE +LD +Q+LM KL+                +    TR  ST+
Sbjct  60   CASHRLNLAVKLFLAEYEHQLDQIQQLMRKLRGLNKAAKLRVFYFFLRKLRQTTRWSSTY  119

Query  189  FMIMRYFYLLEFIDAIDDELEDMMPS  214
             M+ RYF L   +D  DDE+ ++MPS
Sbjct  120  KMLERYFKLRPLLDEDDDEITELMPS  145

>PHYSO_521288
Length=258

 Score = 99.0 bits (245),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 83/132 (63%), Gaps = 11/132 (8%)

Query  95   HMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            H+  L+T+L R +GK +   CFL++D  +VN+RLA +MGVPLVGCASHRLN AV+L  A 
Sbjct  2    HLAALSTILQR-FGKSINQVCFLISDNSAVNKRLARIMGVPLVGCASHRLNLAVRLYTAP  60

Query  155  YEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAI  204
             E  L  +QKLM+KL+   +  +   K          TR  STF M+  Y  LLEFID  
Sbjct  61   LENALAGIQKLMVKLRTLNHAAKLRFKTTLRPVLRNDTRWSSTFAMLDHYVRLLEFIDRE  120

Query  205  DDELEDMMPSPA  216
            DD + +++PSP+
Sbjct  121  DDAVAELLPSPS  132

>PHYSO_254667
Length=473

 Score = 101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 78/143 (55%), Gaps = 26/143 (18%)

Query  20   FGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCM  79
            FG++FDGWT  SEHY+AVY                          +F  D  A   LL  
Sbjct  145  FGIMFDGWTFQSEHYLAVY-------------------------AVFEHDGRADNVLLAF  179

Query  80   AHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGC  139
            A L++D+    S+   +EFL  +LP  +G+ +    +LV D C+VN +LA L+ +PLVGC
Sbjct  180  APLIDDDVTDHSSASPVEFLEGILPF-FGRDISDVVYLVGDNCAVNTKLADLLDIPLVGC  238

Query  140  ASHRLNRAVQLELADYEEELDTV  162
            ASHRLN AVQ+ +ADYE  L  +
Sbjct  239  ASHRLNLAVQVFMADYEPLLGKI  261

>PHYRA_77331
Length=409

 Score = 100 bits (250),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 108/216 (50%), Gaps = 43/216 (20%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            IA ++ D+FGL+FDGWT  + H++A+Y                         G+F  D  
Sbjct  109  IAVDINDQFGLMFDGWTSGTMHFVAIY-------------------------GVFVQDGT  143

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
             +  +L     ++  E G SA  H+E +  +L   Y K   M  F+VAD C+ N+ +AT 
Sbjct  144  LRQVMLA----ISPAEYGQSAEAHLEMIDAVLEL-YNKDSAMIIFVVADNCATNQAIATR  198

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCD-----------RSSA  180
            + VPLVGCASHR N AV   L DY+  +D VQ L ++L    N             R++A
Sbjct  199  LEVPLVGCASHRFNLAVCRYLEDYKTLIDQVQTLCIQLLYPNNAAELARHTHYKPLRANA  258

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             TR  ST+ M+ RY  + + I  +   +ED++P P+
Sbjct  259  -TRWSSTYQMLARYVKIRDDIKMV-AAVEDLVPRPS  292

>PPTG_20312
Length=205

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 75/136 (55%), Gaps = 27/136 (20%)

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
            +N+ ++ LS+R H  FLATMLPRD+G Q+  C F+V D CSVNR LA LMG  L+G    
Sbjct  1    MNEPDDDLSSRSHYAFLATMLPRDFGVQIDQCRFIVGDNCSVNRLLAMLMGYLLLGADG-  59

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRGGSTFFMIMRYFYLLEFID  202
                  Q+E A                    +  R  + TR  STF M+ RYF LLEF+D
Sbjct  60   ------QVEDA--------------------HSIRQVSDTRWSSTFGMLKRYFQLLEFLD  93

Query  203  AIDDELEDMMPSPAQT  218
            A DD++ +++PSP   
Sbjct  94   AEDDDIMEVLPSPTSN  109

>PHYSO_516986
Length=237

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 77/132 (58%), Gaps = 11/132 (8%)

Query  95   HMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            H+  L+T+L R +GK +   CFL++D C+VN+RLA +M VPLV CASHRLN AV+L  + 
Sbjct  2    HLAALSTILQR-FGKSINQVCFLISDNCAVNKRLARIMSVPLVRCASHRLNLAVRLYTSP  60

Query  155  YEE----------ELDTVqklmlklqqklNCDRSSAKTRGGSTFFMIMRYFYLLEFIDAI  204
             E           +L T+ +      +   C      TR  STF M+ RY  LLEFID  
Sbjct  61   LENALAGIQKLIVKLRTLNQAAKLRFKTTLCPVLRNDTRWSSTFAMLDRYGRLLEFIDRE  120

Query  205  DDELEDMMPSPA  216
            DD + +++PSP+
Sbjct  121  DDAVAELLPSPS  132

>PHYSO_533107
Length=253

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 82/151 (54%), Gaps = 26/151 (17%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            +T+ V+  I+A +P +FG+I DGW+  SEHY+AV+                         
Sbjct  129  VTKEVEIGISAFIPLKFGIILDGWSFHSEHYVAVF-------------------------  163

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
             +F  D  ++  LL +A + +D  E  +A  +  FL  +LP  + + +    +LVAD CS
Sbjct  164  AVFEHDQRSEKVLLALAPIADDGVEDQTAESYGAFLTGILPF-FKRDISSIIYLVADNCS  222

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            VN RLA L+ VP +GCASHRLN AV + L+D
Sbjct  223  VNTRLAGLLQVPFIGCASHRLNLAVNVYLSD  253

>PHYSO_532826
Length=253

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 82/151 (54%), Gaps = 26/151 (17%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            +T+ V+  I+A +P +FG+I DGW+  SEHY+AV+                         
Sbjct  129  VTKEVEIGISAFIPLKFGIILDGWSFHSEHYVAVF-------------------------  163

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
             +F  D  ++  LL +A + +D  E  +A  +  FL  +LP  + + +    +LVAD CS
Sbjct  164  AVFEHDQRSEKVLLALAPIADDGVEDQTAESYGAFLTGILPF-FKRDISSIIYLVADNCS  222

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            VN RLA L+ VP +GCASHRLN AV + L+D
Sbjct  223  VNTRLAGLLQVPFIGCASHRLNLAVNVYLSD  253

>PHYSO_510733
Length=273

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 84/153 (55%), Gaps = 29/153 (19%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ +A  +P +FG++FDG T  SE Y                            VG+F 
Sbjct  131  VEKDVAEALPAKFGIVFDGCTFKSEQY----------------------------VGVFP  162

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
             D  A+T LL MA +++DE E  +A  H+ FL+T+L   + +      ++V D CS N +
Sbjct  163  HDNRAETVLLAMAPIVDDEVEDHTAESHVAFLSTVLGF-FNRTTNDIIYVVGDNCSTNGK  221

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELD  160
            ++TL+GVPLVGCASHRLN AV   +  +E+EL+
Sbjct  222  VSTLLGVPLVGCASHRLNLAVTAFMGKHEKELE  254

>PHYCA_105692
Length=243

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 78/125 (62%), Gaps = 11/125 (9%)

Query  102  MLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDT  161
            ML RDY K L  C F+V D C+VN+RLATL+GVPLVGCASHRLN A+Q  L D+  +L  
Sbjct  1    MLSRDYQKNLDGCLFIVGDNCAVNKRLATLLGVPLVGCASHRLNLALQSMLGDHASDLAQ  60

Query  162  VqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDM  211
            V++LMLKL+      +   K          TR G TF M+  Y  +L+ I  IDD ++D 
Sbjct  61   VKELMLKLKTLNLSAQLRFKTHLRPVISQYTRWGLTFSMVHLYLEILDVIKDIDD-VQDQ  119

Query  212  MPSPA  216
            +PSPA
Sbjct  120  LPSPA  124

>PPTG_05879
Length=344

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 11/143 (8%)

Query  82   LLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCAS  141
            ++++ ++ L+A GH+  +   LP  +GK +  C FLV D CS+N+RL+ L+G PLVGC+S
Sbjct  18   VMDEPDDQLNAEGHLTAIKRFLPF-FGKSVSGCLFLVGDNCSLNKRLSDLLGEPLVGCSS  76

Query  142  HRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTFFMI  191
            HRLN AV+  L   E++++ V +LM KL       +   +          TR  STF M+
Sbjct  77   HRLNLAVRDFLEPSEDDVEGVPQLMRKLCTLKQAAKLRTRTPLRAVLRQDTRWSSTFSML  136

Query  192  MRYFYLLEFIDAIDDELEDMMPS  214
             RYF++ EFI A DDEL D  PS
Sbjct  137  KRYFHIREFISADDDELADYPPS  159

>PHYCA_115203
Length=148

 Score = 93.6 bits (231),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 73/145 (50%), Gaps = 28/145 (19%)

Query  16   MPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTP  75
            MP+R G+IFDGWT  + +Y+A+Y  Y V+    +                         P
Sbjct  1    MPERIGVIFDGWTSGTTYYVALYAVYIVEGAVFY-------------------------P  35

Query  76   LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVP  135
            LL ++ L+  EE  L A  H+E L  +L   Y K      F+V D CS N+  AT +GVP
Sbjct  36   LLALSLLV--EESDLGAESHIELLDEVL-ETYQKSRSCILFIVGDNCSTNQAFATKLGVP  92

Query  136  LVGCASHRLNRAVQLELADYEEELD  160
            LVGCASHR N AVQ  L  +E  LD
Sbjct  93   LVGCASHRYNLAVQRYLQKHEALLD  117

>H257_09845
Length=389

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 109/234 (47%), Gaps = 40/234 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +TR V+  IAAE+PD FGL  DGWT  S+H+  ++  Y V +               
Sbjct  16   MDKVTRNVEAKIAAELPDVFGLCIDGWTDGSKHFCTIFATYAVAN---------------  60

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDY-GKQLGMCCFLVA  119
                      V  TPLL M+ LL  + + + A  H+ F+A  L  D  G +L    F+  
Sbjct  61   ----------VRHTPLLAMSPLL--KPDSMDADPHIAFIAETL--DLCGIELANLAFVTG  106

Query  120  DICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSS  179
            D CS N  +A  MGVPLVGC SH  N A++  L  YE +L ++  +M +L +       +
Sbjct  107  DNCSTNVSMAAKMGVPLVGCYSHNFNLAMKALLVLYESDLLSIHAIMTRLGRLRPAGAVT  166

Query  180  ----------AKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQTAVCEL  223
                        TR  STF M+ RY  LL F+  +    + ++ S   T V +L
Sbjct  167  RFTDLLPVCRNVTRWSSTFQMVQRYLALLRFLPEVSGVRDLLLLSGQNTRVKKL  220

>PPTG_06186
Length=446

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 114/223 (51%), Gaps = 38/223 (17%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            L R V+ VIA  +P  FG+IFDGWT  SEHY+AV+                         
Sbjct  38   LVREVETVIAGILPKSFGIIFDGWTFRSEHYVAVFAS-----------------------  74

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
              F  D   +T ++ +A +++DE    +A  +++ L  +L   YG+      ++V D CS
Sbjct  75   --FRHDGKMQTIVIAIAPIIDDEISDHTASSNVKILDVILSY-YGRSKASIAYIVGDNCS  131

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK--  181
            VN   A  + VP+VGCASHRLN AV L LA  ++ LD +QKLM K++  L     S +  
Sbjct  132  VNGAGADQLQVPMVGCASHRLNLAVNLLLAGDDKLLDKIQKLMYKVKNLLLVSAKSRRKT  191

Query  182  ---------TRGGSTFFMIMRYFYLLEFI-DAIDDELEDMMPS  214
                     TR  STF ++ RYF L EF+ D  +DEL   +P+
Sbjct  192  LLRPVPRQDTRWSSTFAIVNRYFELKEFLSDDDEDELTGFLPT  234

>PHYCA_119960
Length=265

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 87/142 (61%), Gaps = 11/142 (8%)

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
            +++ ++ L+A GH+  ++  LP  YGK    C FLV D C+VN+RLA L+GVPLVGC SH
Sbjct  1    MDEPDDQLNAEGHLLAISRFLPF-YGKTTSNCLFLVGDNCAVNKRLANLLGVPLVGCVSH  59

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTFFMIM  192
            RLN AV+  L  +E+ LD VQ+L+ KL+      +   K          TR  STF MI 
Sbjct  60   RLNLAVRDYLKPFEQSLDQVQQLVRKLRTLKQAAQLRTKTPLAAVLRQDTRWSSTFSMIQ  119

Query  193  RYFYLLEFIDAIDDELEDMMPS  214
            RYF L EF+ A DD+L D +PS
Sbjct  120  RYFRLREFLSADDDDLADYLPS  141

>PHYSO_525589
Length=131

 Score = 91.7 bits (226),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 75/140 (54%), Gaps = 26/140 (19%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            + DGW+  SEHY+AV+                          +F  D  ++  LL +A +
Sbjct  1    MLDGWSFHSEHYVAVF-------------------------AVFEHDQRSEKVLLALAPI  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
             +D  E  +A  H+ FL  +LP  + + +    +LVAD CSVN RLA L+ VPL+GCASH
Sbjct  36   ADDGVEDQTAESHVAFLTGILPF-FKRDISSIIYLVADNCSVNTRLADLLQVPLIGCASH  94

Query  143  RLNRAVQLELADYEEELDTV  162
            RLN AV + L+DYE  L+ +
Sbjct  95   RLNLAVNVYLSDYEPLLEQM  114

>PHYCA_128425
Length=187

 Score = 93.2 bits (230),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 81/142 (57%), Gaps = 11/142 (8%)

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
            +++ +E L+A GH+  ++  LP  YGK    C FLV D C+VN+RLA L+GVPL GC S 
Sbjct  1    MDEPDEQLNAEGHLLAISRFLPF-YGKTTSNCLFLVGDNCTVNKRLANLLGVPLFGCVSR  59

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTFFMIM  192
             LN AV+  L  +E+ LD VQ+L+ KL+      +   K          TR  ST  MI 
Sbjct  60   HLNLAVRDYLKPFEQSLDQVQQLVRKLRTLKQATQLRTKTPLAAVLRQDTRWSSTISMIQ  119

Query  193  RYFYLLEFIDAIDDELEDMMPS  214
            RYF L EF+ A D +L D + S
Sbjct  120  RYFRLREFLSADDGDLADYLLS  141

>PHYSO_249073
Length=437

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 76/151 (50%), Gaps = 29/151 (19%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            + +E+   FGL+FDGW HA  HY+A+Y  +E D     R                     
Sbjct  80   LGSELGTLFGLMFDGWAHAGVHYVALYTVWEADGEVRVR---------------------  118

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
                LL ++HL +  +   +A  H+     +L   Y K L M  FLV D C+ N  +AT 
Sbjct  119  ----LLGLSHLTDGSQ---TADAHVVMFKDVL-EVYNKTLDMVGFLVGDNCNTNLSIATK  170

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            MGVPLVGCASHRLN AV+  LA YE  LD V
Sbjct  171  MGVPLVGCASHRLNPAVKKFLAPYEPLLDEV  201

>PHYSO_503930
Length=238

 Score = 93.6 bits (231),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 84/153 (55%), Gaps = 26/153 (17%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ +A  +P +F ++FDG T  SE Y+ V+                          +F 
Sbjct  93   VEKDVAEALPAKFDIVFDGCTFKSEQYVGVF-------------------------AVFP  127

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
             D  A+T LL MA +++DE +  +A  H+ FL+T+L   + +      ++V D CS N +
Sbjct  128  HDNRAETVLLAMAPIVDDEVKDHTAESHVAFLSTVLGF-FNRTTNDIIYVVGDNCSTNGK  186

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELD  160
            ++TL+GVPLVGCASHRLN AV   +  +E+EL+
Sbjct  187  VSTLLGVPLVGCASHRLNLAVTAFMGKHEKELE  219

>PHYSO_246570
Length=364

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 78/151 (52%), Gaps = 38/151 (25%)

Query  69   DAVAKTPLLCMAHLLN---DEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVN  125
            DAV +    C+ H +     EE GL   GH  FLATML RDY K+L     LV D C VN
Sbjct  120  DAVTR----CVEHSIAAEMPEEFGLIFDGHQAFLATMLARDYQKRLDQVLVLVGDNCGVN  175

Query  126  RRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRGG  185
            RRLATLMG+PLVG                ++ +L  + +                +TR G
Sbjct  176  RRLATLMGLPLVG----------------FKTDLRPIIRQ---------------QTRWG  204

Query  186  STFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            STF MI RYF LL FIDA DDEL +++P  A
Sbjct  205  STFAMINRYFELLPFIDAEDDELAELLPPAA  235

 Score = 38.5 bits (88),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 21/26 (81%), Gaps = 0/26 (0%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDG  26
            M ++TR V+  IAAEMP+ FGLIFDG
Sbjct  119  MDAVTRCVEHSIAAEMPEEFGLIFDG  144

>PHYSO_481325
Length=153

 Score = 91.3 bits (225),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 83/153 (54%), Gaps = 26/153 (17%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V++ +   +P +FG++FDG T  SE Y+ V+                          +  
Sbjct  8    VEKDVTEALPAKFGIVFDGCTFKSEQYVGVF-------------------------AVLL  42

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
             D  A+T LL MA +++DE E  +A  H+ FL+T+L   + +      ++V D CS + +
Sbjct  43   HDNRAETVLLAMAPIVDDEVEDHTAESHVAFLSTVLGF-FNRTTNDIIYVVGDNCSTDGK  101

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELD  160
            ++TL+GVPLVGCASHRLN AV   +  +E+EL+
Sbjct  102  VSTLLGVPLVGCASHRLNLAVTAFMGKHEKELE  134

>PYIW_27597
Length=184

 Score = 92.0 bits (227),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 75/154 (49%), Gaps = 30/154 (19%)

Query  7    PVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLF  66
             V   IA EM   FGLIFDGWT  S HY+A++  Y VD                      
Sbjct  60   KVSAAIAREMGSVFGLIFDGWTSGSVHYVALFAVYMVDD---------------------  98

Query  67   SSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNR  126
                V    LL  + +    E+G +AR H+EF+ T+L   Y K+  +   LV + C+ N+
Sbjct  99   ----VRHQRLLAFSSM----EDGQTARAHVEFIETILHL-YKKKASIIKLLVNNNCTTNQ  149

Query  127  RLATLMGVPLVGCASHRLNRAVQLELADYEEELD  160
             +AT + V LVGCASHR N      L DY+E +D
Sbjct  150  SVATKLAVSLVGCASHRYNLTAMRFLNDYQENID  183

>PHYRA_83936
Length=279

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/216 (32%), Positives = 103/216 (48%), Gaps = 31/216 (14%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M   ++ +  +I   M    G++++GW+H+S HY+ VY  Y V+     R +        
Sbjct  1    MQRCSKKIGVLIEKAMGKLSGVMWNGWSHSSVHYVVVYCMYHVNGKRRERLL--------  52

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                       A +P+         EE    A  H+E    +L   Y K   M   LV D
Sbjct  53   -----------ALSPI---------EESSQDAEVHIEMFMRVLAL-YNKNTSMVALLVGD  91

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             CS N+++ATL+ +PLVGCASHR N AV   LA YE EL  +   ML     L   + + 
Sbjct  92   SCSTNQKIATLLELPLVGCASHRYNLAVNRYLAAYETELAALNHRMLANFTDLVPIKRNM  151

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             TR  STF M++RY  + + I  + D +E+ +P+ A
Sbjct  152  -TRWSSTFEMVLRYKRIRDAIRQV-DAVEENVPTGA  185

>PHYCA_131927
Length=233

 Score = 92.8 bits (229),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 10/110 (9%)

Query  116  FLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNC  175
            F+VAD C+VNR LATLMGVPLVGCASHRLN AVQ  L DYE++L  +Q LM K++     
Sbjct  1    FVVADNCAVNRLLATLMGVPLVGCASHRLNLAVQDYLRDYEDDLIVLQTLMRKMKTLNYA  60

Query  176  DRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSP  215
                +K          TR GST+ M+ RYF + EF+   DD++ +++PSP
Sbjct  61   AALRSKTPLRPIIRQDTRWGSTYAMVERYFRISEFLPVEDDDVAELLPSP  110

>PHYSO_505181
Length=410

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 106/229 (46%), Gaps = 44/229 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V + +  EM   F L+FDGWTHA  HY+A+Y  YE                  
Sbjct  98   MEGIAIKVGEKLGKEMGTLFALMFDGWTHAGIHYVALYAVYETACKL-------------  144

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        + PLL M+ L   E+   +A  H++    +L   Y +   M  FLV D
Sbjct  145  ------------RIPLLGMSPL---EDGDQTADAHIKLFKNILDV-YDQTSDMVGFLVGD  188

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+ N+ +AT MG+PLVGCASHR N AV      Y + LD V  L ++L+ + N  R+  
Sbjct  189  DCATNQSIATKMGIPLVGCASHRFNLAVSKFAEPYGDLLDEVNSLTVELRHENN--RAEL  246

Query  181  K------------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQ  217
            K            TR  STF M+ RY  +   I  + + +E+M+P+  +
Sbjct  247  KKYTDLVPIKRNVTRWSSTFTMVERYIRIRAEIKTV-NAVEEMVPTGGK  294

>PPTG_10612
Length=555

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 111/229 (48%), Gaps = 44/229 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  L R V+ VIA  MP  FG+IFDGWT  SEH +AV+                      
Sbjct  164  MRLLVREVETVIAGIMPKSFGIIFDGWTFRSEHCVAVFAS--------------------  203

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                 F  D   +T ++ +A +++D+    +A  +++ L  +L   YG+      ++V D
Sbjct  204  -----FRHDGKMQTIVIAIAPIIDDDIRDYTASSNVKILDVILSY-YGRSKASIAYIVGD  257

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             CSVN  +A  + VP+VGCASHRLN AV L LA  ++ LD +      + +  N    SA
Sbjct  258  NCSVNGAVADQLQVPMVGCASHRLNLAVNLLLAGDDKLLDKI---QKLMYKVKNLLLVSA  314

Query  181  K--------------TRGGSTFFMIMRYFYLLEFI-DAIDDELEDMMPS  214
            K              TR  STF ++ RYF L EF+ D  +DEL   +P+
Sbjct  315  KFRRKTLLRPVPRQDTRWSSTFAIVNRYFELKEFLSDDDEDELTGFLPT  363

>PHYCA_115609
Length=131

 Score = 88.6 bits (218),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 26/140 (19%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGW+  SEHY+AV+                          +F  D  A   LL  A L
Sbjct  1    MFDGWSFQSEHYLAVF-------------------------AVFEHDGKADKVLLAFAPL  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
            ++DE    S+  +++FL  +LP  + + +    +LV D C+VN RL+ L+ +PLVGCASH
Sbjct  36   VDDEATDHSSASYVKFLKGVLPF-FNRDITSVVYLVGDNCAVNTRLSDLLSIPLVGCASH  94

Query  143  RLNRAVQLELADYEEELDTV  162
            RLN AVQ  +A Y+  L  +
Sbjct  95   RLNLAVQDFMAKYDSLLSKI  114

>H257_18272
Length=257

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 99/211 (47%), Gaps = 22/211 (10%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRY--EVDSNTVFRCMRPAVKD  58
            M  L   V + I  E+PD+FG++ DGWT   EH+IA++  Y    D   V   M P +KD
Sbjct  1    MHLLRASVVEDIMKELPDKFGVVLDGWTQMREHFIALFAVYVNAGDRKEVLLSMTPLIKD  60

Query  59   EAKTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLV  118
             + T  +   D +  +P         DE    +A  ++ ++   L + + +      F+V
Sbjct  61   TSLT-HVQGVDELQPSPE-------TDEIVSHTAEKNVHWIRKQLAK-FKRSTTCITFIV  111

Query  119  ADICSVNRRLATLMGVPLVGCASHRLNRAVQ----LELADYEEELDTVqklmlklqqklN  174
            AD CSVN+++ T M VPL+GCASHR N AVQ     E AD   ++  V            
Sbjct  112  ADNCSVNKKMTTDMKVPLLGCASHRFNLAVQDLMKGEFADLLAKVQKVMLSCKAPNNAAE  171

Query  175  CDRSSA-------KTRGGSTFFMIMRYFYLL  198
              + ++        TR  S F M+ R+  LL
Sbjct  172  LKKLTSLKPRFLQATRWSSAFEMLRRFQKLL  202

>PHYSO_255876
Length=469

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 109/219 (50%), Gaps = 37/219 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            MG LT+  +++IAA + ++FG++FDG T     Y+ V+                      
Sbjct  126  MGLLTKAAEEIIAAILLEKFGIVFDGST-----YVVVF----------------------  158

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                +F+ D   +  LL M  L++DE    SA  H++FL T+L   +   L    +LV D
Sbjct  159  ---AVFAHDGKIEKILLAMPPLVDDEVMDHSAPAHVDFLQTILGF-FKCTLASVLYLVGD  214

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRS--  178
             C  N  +ATLM VP VG ASHRL+ AV   +  YE  L+ V + +++  + LN   S  
Sbjct  215  NCPTNGAVATLMRVPFVGRASHRLSLAVVEYMEAYEPLLNKV-QDLMRKLRGLNASASLR  273

Query  179  ---SAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
                  TR  STF M+ RYF L + I+ +DD    +MP+
Sbjct  274  PVLRQSTRWSSTFNMVKRYFDLQDAINTLDDSTAALMPT  312

>PHYSO_523900
Length=410

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 109/229 (48%), Gaps = 44/229 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V + +  EM   F L+ DGWTHA  HY+A+Y  YE                  
Sbjct  98   MEGIAIEVGEKLGKEMGKLFALMLDGWTHAGIHYVALYAVYE------------------  139

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
             T G        + PLL ++ L + ++   +A  H++    +L   Y K   M  FLV D
Sbjct  140  -TAGKL------RIPLLGISPLEDGDQ---TADAHIKLFKNILDV-YDKTSDMVGFLVGD  188

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C+ N+ +AT MG+PLVGCASHR N AV   +  Y + LD V  LM++L+ + N  R+  
Sbjct  189  NCATNQSIATKMGIPLVGCASHRFNLAVNKLMEPYGDLLDEVNNLMVELRHENN--RAEL  246

Query  181  K------------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQ  217
            K            TR  STF M+  Y  +   I  + D +E+M+P+  +
Sbjct  247  KKYTDLVPIKRNVTRWSSTFTMVEGYIRIRAEIKKV-DAVEEMVPTGGK  294

>PHYSO_499950
Length=256

 Score = 90.9 bits (224),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 101/207 (49%), Gaps = 44/207 (21%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGWTHA  HY+A+Y  YE                   T G        + PLL M+ L
Sbjct  1    MFDGWTHAGIHYVALYAVYE-------------------TAGKL------RIPLLGMSPL  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
             + ++   +A  H++    +L   Y K   M  FLV D C+ N  +AT MG+PLVGCASH
Sbjct  36   DDGDQ---TADAHIKLFKNILDV-YDKTSDMVGFLVGDNCATNLSIATKMGIPLVGCASH  91

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------------TRGGSTFFM  190
            R N AV   +  Y + LD V  LM++L+ + N  R+  K            TR  STF M
Sbjct  92   RFNLAVNKFMEPYGDLLDEVNNLMVELRHENN--RAELKKYTELVPIKRNVTRWSSTFTM  149

Query  191  IMRYFYLLEFIDAIDDELEDMMPSPAQ  217
            + RY  +   I  + D +E+M+P+  +
Sbjct  150  VERYIRIRVEIKKV-DAVEEMVPTGGK  175

>PHYSO_526629
Length=332

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 103/221 (47%), Gaps = 44/221 (20%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V+ +I  +M    G ++DGWT   EHY+ V+                         G+F 
Sbjct  8    VEGMIGVDMQGACGAMYDGWTCNLEHYVVVF-------------------------GVFC  42

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
             +   + PLL +A +    E  L+A  H  F+  +  + Y + L    FL+ D C+ NR 
Sbjct  43   KNGKLEQPLLAIAPM---GEGDLTAPAHCAFITRVFEK-YNQSLESLAFLIGDNCATNRA  98

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
             AT + VPL+GCASHR N AV   L DY EE+  V  LM  L    N  R++ K      
Sbjct  99   AATRLEVPLIGCASHRFNLAVNKYLEDYTEEVSVVSALMQALPTINN--RAALKDQTKLS  156

Query  182  ------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                  TR GSTF M+ RY  + + I  + + + D++P+ A
Sbjct  157  PLRPNVTRWGSTFKMLARYVRIRDDIKQV-EAVFDLIPTAA  196

>PHYCA_114284
Length=281

 Score = 91.3 bits (225),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 79/134 (59%), Gaps = 12/134 (9%)

Query  91   SARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQL  150
            +A  H+  + T+L R Y K  GM  F+V D CS N+++ATL+GVPLVGCASHR N AV  
Sbjct  19   TAEAHVTMMKTVL-RIYNKTTGMVTFIVGDNCSTNQKIATLLGVPLVGCASHRFNLAVNR  77

Query  151  ELADYEEELDTVqklmlklqqklNCDR----------SSAKTRGGSTFFMIMRYFYLLEF  200
             LA+YE+EL TV  LM++L+   N  R              TR  ST+ M+ RY  + + 
Sbjct  78   FLAEYEDELATVNDLMIQLRHCNNAARLRELTDLQPVKRNATRWSSTYAMVDRYVRIRDA  137

Query  201  IDAIDDELEDMMPS  214
            I  + + +ED +PS
Sbjct  138  IRQV-EAVEDYVPS  150

>PYAR_18806
Length=243

 Score = 90.1 bits (222),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (53%), Gaps = 26/125 (21%)

Query  3    SLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKT  62
            SLT  V+  IA E+PD+FGLIFDGWTH SEH++A++  Y                     
Sbjct  138  SLTSAVESKIAMELPDQFGLIFDGWTHNSEHFLAIFASY---------------------  176

Query  63   VGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADIC  122
                 +D   +TPLL +A ++N  +E   A  HM  + T+L   +GK L  C F V D C
Sbjct  177  ----VADGAVQTPLLSLAPVINKPDEQHGAETHMAAIETVLSF-FGKALSHCVFFVGDNC  231

Query  123  SVNRR  127
            +VN+R
Sbjct  232  AVNKR  236

>PPTG_02049
Length=199

 Score = 88.6 bits (218),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 79/157 (50%), Gaps = 26/157 (17%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            LT+ +  +IA  +P RFG+++DGWT  SEHY+AV+                         
Sbjct  4    LTKALGDIIADVLPKRFGIVWDGWTFRSEHYLAVF-------------------------  38

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
             +F  D   +  LL M+ L +D+    SA  H+ FL  M+   + + L    ++VAD C+
Sbjct  39   AVFGHDGKMEKILLAMSTLADDDIVNHSAMAHVAFL-RMILWFFKRSLSDILYIVADNCA  97

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELD  160
             N  +A+LM  P V CASHRL+ AV   +  YE  LD
Sbjct  98   TNGCIASLMKAPFVECASHRLSLAVVEYMESYESILD  134

>PHYCA_112478
Length=270

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 86/151 (57%), Gaps = 19/151 (13%)

Query  79   MAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
            MA L++DE +  +AR H++F+ T+L   +G+      ++V D CSVN  +A  + VP+VG
Sbjct  1    MAPLVDDEVDDHTARSHVKFMDTILSY-FGRSKANIAYIVGDNCSVNGVIADQLQVPVVG  59

Query  139  CASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK--------------TRG  184
            CASHRLN AV L L+  E+    + K+   + +  N    SAK              TR 
Sbjct  60   CASHRLNLAVNLLLSGDEK---LITKIQKLMYKIKNSLVVSAKLRRKTLLRPVPKQVTRW  116

Query  185  GSTFFMIMRYFYLLEFI-DAIDDELEDMMPS  214
             STF M+ RYF L EFI D I++EL D+MP+
Sbjct  117  SSTFAMVNRYFELKEFISDDIEEELADLMPT  147

>PPTG_19934
Length=173

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 79/159 (50%), Gaps = 26/159 (16%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            LT+ +  +IA  +P RFG+++DGWT  SEHY+AV+                         
Sbjct  24   LTKALGDIIADVLPKRFGIVWDGWTFRSEHYLAVF-------------------------  58

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
             +F  D   +  LL M+ L +D+    SA  H+ FL  M+   + + L    ++VAD C+
Sbjct  59   AVFGHDGKMEKILLAMSTLADDDIVNHSAMAHVAFL-RMILWFFKRSLSDILYIVADNCA  117

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             N  +A LM  P V CASHRL+ AV   +  YE  LD +
Sbjct  118  TNGCIALLMKAPFVECASHRLSLAVVEYMESYESILDKM  156

>PHYCA_133604
Length=275

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 83/146 (57%), Gaps = 10/146 (7%)

Query  79   MAHLLNDEE----EGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGV  134
            MA LL+ E+        A  H+ FL T+L +   +++    FLV D CSVN  +A+ +GV
Sbjct  1    MAPLLDKEDCNSDPHHDADAHIAFLKTIL-KPLKRRIDCIRFLVGDNCSVNGSIASKLGV  59

Query  135  PLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRS-----SAKTRGGSTFF  189
            PLVGCASHRLN A+   L +YE+ L+ +  LM  L+   +   S       KTR  STF 
Sbjct  60   PLVGCASHRLNLAMTQYLDEYEDILEKINDLMKFLRGLNHKKTSLRPVIRQKTRWSSTFP  119

Query  190  MIMRYFYLLEFIDAIDDELEDMMPSP  215
            M+ RYF L  F+D+ D +L   MPSP
Sbjct  120  MVERYFKLKPFLDSADGDLAAYMPSP  145

>H257_11375
Length=458

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 79/162 (49%), Gaps = 26/162 (16%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M +L   V++ IA+++PD+F ++ DGW+H S HY+A++  +                   
Sbjct  124  MHALCAHVERTIASQLPDQFAIVHDGWSHGSTHYLAIFATFP------------------  165

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                  SSD +  T  L     +ND EE LSA  H EF   +L   YGK       L+ D
Sbjct  166  ------SSDPIGYTRTLLAFAPIND-EESLSADAHYEFTVFVL-ELYGKTWDNVIALIGD  217

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             CS N   A   GVPL+G ASHR N  +   LAD+ + +D V
Sbjct  218  NCSTNGAFARRAGVPLIGYASHRFNLFMSDVLADHADVIDNV  259

>PHYCA_131982
Length=325

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 103/226 (46%), Gaps = 40/226 (18%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M +  + V+Q IA+ +P  FG+ FDGWT   E Y+A++V                     
Sbjct  1    MAATAKAVEQRIASILPPCFGIKFDGWTCFLEQYVALFV---------------------  39

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                +F  +      LL +A L   +E   +A  H  F+  +L   Y +      FLV D
Sbjct  40   ----VFWHEGELHKVLLAIAPL---DEADQTADSHCSFIRNIL-GIYSQSQSPLRFLVGD  91

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklN------  174
             C+ N+ +AT + +PLVGCASHR N A Q  +A Y E ++TV  LM  L    N      
Sbjct  92   NCATNQLIATKLNIPLVGCASHRFNLATQKYIAQYSELVETVGALMAALSSPNNRRELRR  151

Query  175  ----CDRSSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                    +  TR  ST+ M+ RY  + + I  +D   E ++P PA
Sbjct  152  HTDLAPLRANATRWSSTYAMLERYVKIRDAIKHVDAVFE-LLPKPA  196

>PHYCA_77523
Length=171

 Score = 86.3 bits (212),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 12/110 (11%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            +GKQL  C F+V D C+VNR LATL+GVPLVGCASHRLNRAVQ+++  YE++L  VQ LM
Sbjct  1    FGKQLDACLFIVGDNCAVNRLLATLIGVPLVGCASHRLNRAVQVDMEQYEDDLSGVQALM  60

Query  167  lklqqklNCDRSSAK----------TRGGSTFFMIMRYFYL--LEFIDAI  204
            ++L+      +  +K          TR  STF M+ R   L  + F+D I
Sbjct  61   VRLRTLKQSAKLRSKTSLRPIIRQDTRWSSTFSMVHRADDLRRVAFVDLI  110

>PHYCA_128089
Length=278

 Score = 89.0 bits (219),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 72/122 (59%), Gaps = 10/122 (8%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            +GK +    FLV+D CS+N+RLA L+  PLVGCASHRLN AV L  A  E  L  +Q L+
Sbjct  35   FGKTIDQVAFLVSDNCSLNKRLARLLDAPLVGCASHRLNLAVTLVTASLESVLVKIQGLV  94

Query  167  lklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            ++L+      +   K          TR GSTF M+ RYF LLE+ID  D+ L + +PS +
Sbjct  95   VRLRTLNESAKLRFKTKLRPVLRQDTRWGSTFKMLHRYFDLLEYIDRADENLAEFIPSAS  154

Query  217  QT  218
            + 
Sbjct  155  EN  156

>H257_09898
Length=389

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 93/211 (44%), Gaps = 36/211 (17%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  + R ++  +   +P+ F  +FD WT  S HY+AV+V +  DS          ++   
Sbjct  1    MHQMCRWLEAKLKKTLPESFACVFDAWTSGSTHYVAVFVSFPSDS----------LRGYE  50

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
            K +   SS              +NDE+  LSA   +EF   +L   YGKQ      L+ D
Sbjct  51   KVLISLSS--------------MNDED-SLSATAFLEFFYFVLDV-YGKQRRNVVALIGD  94

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEE----------ELDTVqklmlklq  170
             C+ NR    L G+P+ GCASHR N  V   LADYE+          +L  +       +
Sbjct  95   NCATNRAFTRLAGIPMEGCASHRFNLFVGDVLADYEDLLCAVHAIMKKLSNIIPAAKLRR  154

Query  171  qklNCDRSSAKTRGGSTFFMIMRYFYLLEFI  201
                C +   KTR  S+  M+ RY  L  F+
Sbjct  155  TTPLCPKQRNKTRRSSSVAMLARYVELKPFL  185

>PHYSO_251327
Length=362

 Score = 89.4 bits (220),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 100/204 (49%), Gaps = 44/204 (22%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGWTHA  HY+A+Y  YE                   T G        + PLL ++ L
Sbjct  1    MFDGWTHAGIHYVALYAVYE-------------------TAGKL------RIPLLGISPL  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
               E+   +A  H++ L  +L   Y K   M  FLV D C+ N+ +AT MG+PLVGC SH
Sbjct  36   ---EDGDQTADAHIKLLKNILDV-YDKTSDMVGFLVEDNCATNQSIATKMGIPLVGCESH  91

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------------TRGGSTFFM  190
            R N AV   +  Y + LD V  L+++L+ + N  R+  K            TR  STF M
Sbjct  92   RFNLAVNKFMEPYGDLLDEVNNLLVELRHENN--RAELKKYTDLVPIKRNVTRWSSTFTM  149

Query  191  IMRYFYLLEFIDAIDDELEDMMPS  214
            + RY  +   I  + D +E+++P+
Sbjct  150  VERYIRIHAEIKKV-DAVEEIVPT  172

>PHYSO_495083
Length=326

 Score = 88.6 bits (218),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 98/204 (48%), Gaps = 44/204 (22%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGWTHA  H++A+Y  YE                   T G        + PLL M+ L
Sbjct  1    MFDGWTHAGIHFVALYAVYE-------------------TAGKL------RIPLLGMSPL  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
               E+   +A  H++    +L   Y K   M  FLV D C+ N+ +AT MG+PLVGCASH
Sbjct  36   ---EDGDQTADAHIKPFKNILDV-YDKTSDMVGFLVGDNCATNQSIATKMGIPLVGCASH  91

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------------TRGGSTFFM  190
            R N AV      Y + LD V  LM++L+ + N  R+  K            TR  STF M
Sbjct  92   RFNLAVNKFTEPYGDLLDEVNNLMVELRHENN--RAELKKYTDLVPIKRNVTRWSSTFTM  149

Query  191  IMRYFYLLEFIDAIDDELEDMMPS  214
            + RY  +   I  + D +E M+P+
Sbjct  150  VERYIRIRAEIKKV-DAVEKMVPT  172

>PPTG_20638
Length=122

 Score = 84.0 bits (206),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 52/84 (62%), Gaps = 1/84 (1%)

Query  79   MAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
            MA L+N+       R    FLATML  DYGK    C F+  D CSVNRRLA+ MGVPL G
Sbjct  1    MAPLINEANGDHGTRAQ-PFLATMLVLDYGKLANNCLFIAGDNCSVNRRLASRMGVPLEG  59

Query  139  CASHRLNRAVQLELADYEEELDTV  162
            CASHRL  AVQ  L  YEE+L  +
Sbjct  60   CASHRLKLAVQAYLKRYEEDLAQI  83

>PHYSO_407182
Length=108

 Score = 83.2 bits (204),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 68/137 (50%), Gaps = 29/137 (21%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGWTHA  HY+A+Y   E D               A+ +GL        +PL      
Sbjct  1    MFDGWTHAGVHYVALYAVCEADGEV-----------RARLLGL--------SPL------  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
                +   +A  H+E    +L   Y K L M  FLV D C+ N  +AT MGVPLVGCASH
Sbjct  36   ---TDGSQTADAHVEMFKKVL-EVYNKTLDMVGFLVGDNCNTNLSIATKMGVPLVGCASH  91

Query  143  RLNRAVQLELADYEEEL  159
            RLN AV+  LA YE  L
Sbjct  92   RLNLAVKKFLAPYEPLL  108

>PHYSO_527104
Length=318

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/217 (34%), Positives = 105/217 (48%), Gaps = 48/217 (22%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            + DGW   SE Y+A++                          +F  D  ++  LL +A +
Sbjct  1    MLDGWGFHSEDYVAIF-------------------------AVFEHDQRSEKALLALAPI  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
             +D  E  +A  H+ FL  +LP  + + +    +LVAD CSVN RL  L+ VP +GCASH
Sbjct  36   ADDGVEDQTAESHVAFLTGILPF-FKRVISSIIYLVADNCSVNTRLDDLLQVPFIGCASH  94

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK---------------------  181
            RLN AV + L+DYE   + +Q+LMLKL+     +R S                       
Sbjct  95   RLNLAVNVYLSDYEPLQEQMQQLMLKLRGLNKANRLSFLLFCSFCFFLRQKTNLRPVLRQ  154

Query  182  -TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQ  217
             TR GSTF M+ RYF L + +D  DD++  +MPS  Q
Sbjct  155  ATRWGSTFKMLDRYFDLRDALDTDDDDIVSLMPSHRQ  191

>PHYCA_105488
Length=319

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 103/213 (48%), Gaps = 47/213 (22%)

Query  16   MPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTP  75
            MP+  GL+FDGW+  S +Y+ VY  Y                             VA +P
Sbjct  1    MPNSIGLLFDGWSAGSTYYVGVYAIY----------------------------VVAGSP  32

Query  76   ---LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLM  132
               LL +A LL++ + G  A  H+ F+   L   +GK+ G   F+V D CS ++ +AT M
Sbjct  33   RRVLLALAPLLDENDFG--ADSHIAFITETLSV-FGKEPGCVRFIVRDNCSTSQAIATHM  89

Query  133  GVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSS---------AK--  181
            G+PLVGCASHRLN A+   + ++E  L  V +L   +      + ++         AK  
Sbjct  90   GLPLVGCASHRLNLAIPQHVEEHEGFLSQVNELTSDVSAPHQENAATLLKFTELQPAKRN  149

Query  182  -TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMP  213
             TR  STF M+ R+  +   +  + + +E+++P
Sbjct  150  ATRWSSTFKMVRRFLQIKHAVKHV-EAVEELVP  181

>H257_15374
Length=517

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 106/218 (49%), Gaps = 42/218 (19%)

Query  4    LTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTV  63
            LT  V++ I+ E+PDRFG+IFDGWTH SEHY+ V+ +                    +  
Sbjct  139  LTEVVEKKISKEIPDRFGIIFDGWTHNSEHYLVVFTK--------------------RME  178

Query  64   GLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICS  123
             L S         L +A ++++ ++  SA+ H   + ++L   + + +  C FLV D CS
Sbjct  179  SLCS---------LSLAPIIHEPDDDHSAKTHYTAIKSVLAM-FKETIMQCVFLVGDNCS  228

Query  124  VNRRLATLMGVPLVGCASHRLNRAVQLELADYEE---ELDTVqklmlklqqklNCDRSSA  180
            VN++LA LM             +  + ELA  ++   +L T+ +    L +         
Sbjct  229  VNKKLAKLMSA---------YTQQHEDELAKIQQLMIKLRTLNQASKLLFRTELRPILRQ  279

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQT  218
             TR  STF M+ R+F L E +D  DD + +++P+  +T
Sbjct  280  DTRWSSTFAMLQRFFKLREHLDHEDDTILEILPTLGET  317

>PHYSO_501313
Length=131

 Score = 82.8 bits (203),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (51%), Gaps = 26/140 (19%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            + DGW+  SE Y+AV+                          +F  D  ++  LL +A +
Sbjct  1    MLDGWSFHSERYVAVF-------------------------SVFEHDQRSEKVLLALAPI  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
             +D  E   A  H+  L  +LP  + + +    +LVAD CSVN RLA L+ VP +GCASH
Sbjct  36   ADDGVEDQMAESHVAVLTGILPF-FKRDISSIIYLVADNCSVNTRLADLLQVPFIGCASH  94

Query  143  RLNRAVQLELADYEEELDTV  162
            RLN AV + L+DYE  L+ +
Sbjct  95   RLNLAVNVYLSDYEPLLEQM  114

>PHYCA_79170
Length=149

 Score = 83.2 bits (204),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 66/147 (45%), Gaps = 55/147 (37%)

Query  16   MPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTP  75
            MP +FGL+ DGWTH +EHY+ V+  YE  S   +                         P
Sbjct  48   MPGKFGLLLDGWTHGTEHYLGVFACYEAPSGPQY-------------------------P  82

Query  76   LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVP  135
            LL +A ++ D                                V D C+VN+RLA LMG+P
Sbjct  83   LLSLAPIVVDAA------------------------------VGDNCAVNKRLARLMGIP  112

Query  136  LVGCASHRLNRAVQLELADYEEELDTV  162
            LVGCASHRLN AV+  L  +E +L+ V
Sbjct  113  LVGCASHRLNPAVRTLLEPHEADLEQV  139

>PPTG_23412
Length=751

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 71/126 (56%), Gaps = 18/126 (14%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            +GK +    FLV+D CS+N++LA L+GVPLVGCASHRLN AV L  A     L++V    
Sbjct  474  FGKTIDRVAFLVSDNCSLNKKLARLLGVPLVGCASHRLNLAVTLVTA----SLESVLVKT  529

Query  167  lklqqklNCDRSSAK--------------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMM  212
              L  +L     SAK              TR GSTF M+  YF LLEFID  D+ L + +
Sbjct  530  QGLMVRLRTLNESAKLRFKTKLRPVLRQDTRRGSTFKMLHHYFDLLEFIDRDDENLAEFI  589

Query  213  PSPAQT  218
            PS ++ 
Sbjct  590  PSASEN  595

>PPTG_24770
Length=158

 Score = 83.2 bits (204),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 62/102 (61%), Gaps = 25/102 (25%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M SLTR V++ IAAE+P+RFGL+FDGW HAS+H+IAV+  Y+                  
Sbjct  77   MDSLTRVVERAIAAELPERFGLLFDGWAHASQHFIAVFACYD------------------  118

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATM  102
                   +  V KTPLL MA LL+  ++ LSARGHMEFLA M
Sbjct  119  -------AGGVRKTPLLSMAPLLDALDDDLSARGHMEFLANM  153

>PPTG_20946
Length=284

 Score = 85.9 bits (211),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 67/147 (46%), Gaps = 53/147 (36%)

Query  16   MPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTP  75
            MP++FGLI DGW+H +EHY+ VY  YEV +   +                         P
Sbjct  1    MPEQFGLILDGWSHGTEHYLTVYGCYEVATGPQY-------------------------P  35

Query  76   LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVP  135
            LL +A   ++                            C FLV D C+ N+RLA L+GV 
Sbjct  36   LLSLAPTTSN----------------------------CLFLVGDNCAANKRLANLLGVS  67

Query  136  LVGCASHRLNRAVQLELADYEEELDTV  162
            L+GCASHRLN  V+  L  +EE LD V
Sbjct  68   LIGCASHRLNLVVRDYLKPFEESLDQV  94

>PHYCA_51822
Length=158

 Score = 82.8 bits (203),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 2/116 (2%)

Query  105  RDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqk  164
            R +GK +    FLV+D CS+N+RLA L+  PLVGCASHRLN AV L  A  E  L  +Q 
Sbjct  3    RVFGKTIDQVAFLVSDNCSLNKRLARLLDAPLVGCASHRLNLAVTLVTASLESVLVKIQG  62

Query  165  lmlklqqklNCDRSSAK--TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQT  218
            LM++L+      R   +  TR GSTF M+ R F LLE+ID   + L + +PS ++ 
Sbjct  63   LMVRLRTFNTKLRPVLRQDTRWGSTFKMLHRCFDLLEYIDRDYENLAEFIPSASEN  118

>PHYCA_104102
Length=310

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 102/200 (51%), Gaps = 47/200 (24%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTP---LLCM  79
            +FDGW+  S +Y+ +Y  Y                             VA +P   LL +
Sbjct  1    MFDGWSAGSTYYVGIYAIY----------------------------VVAGSPRRVLLAL  32

Query  80   AHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGC  139
            A LL++ + G  A  H+ F+   L   +GK+ G   F+V D CS N+ +AT MG+PLVGC
Sbjct  33   APLLDENDFG--ADSHIAFITETLSV-FGKEPGCVRFIVGDNCSTNQAIATRMGLPLVGC  89

Query  140  ASHRLNRAVQLELADYEEELDTVqklmlklqqklNC-------DRSSAK---TRGGSTFF  189
            ASHRLN A+Q  +A++E  L  V +LM +L+ K N        +   AK   TR  STF 
Sbjct  90   ASHRLNLAIQQHVAEHEALLSQVNELMCQLRTKKNAATLLKFTELRPAKRNVTRWSSTFK  149

Query  190  MIMRYFYL---LEFIDAIDD  206
            M+ R+  +   ++ ++A+++
Sbjct  150  MVRRFLQIKHAVKHVEAVEE  169

>PHYRA_81096
Length=364

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 97/214 (45%), Gaps = 44/214 (21%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            +  E+    GL+FDGWTHA  HYI +Y  YE +                           
Sbjct  27   LEKELGTLIGLMFDGWTHAGVHYIGLYAVYEAEGEL------------------------  62

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
             + PLL +  L +      +A  H +    +L   Y K   M  FLV D C+ N+ +A  
Sbjct  63   -RVPLLGLPPLTDGTH---TADAHAQLFENVLDV-YHKTNDMVGFLVGDNCNTNQCIANK  117

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------  181
            MG+PLVGCASHR N AV   LA YE  L  V  LM+ L+Q+ N                 
Sbjct  118  MGIPLVGCASHRFNLAVNKFLAPYESLLGEVNDLMVALRQENNFAELKKHTELLPVKRNV  177

Query  182  TRGGSTFFMIMRYFYL-LEFIDAIDDELEDMMPS  214
            TR  STF M+ RY    ++ ++A+    E+++P+
Sbjct  178  TRWSSTFTMVQRYIRSDIQKVEAV----EELIPT  207

>H257_01783
Length=329

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 88/153 (58%), Gaps = 11/153 (7%)

Query  76   LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVP  135
            LL +A ++++ ++   A+ H   + ++L   + K +  C F+V D CSVN++L  LM VP
Sbjct  2    LLSIAPIIHEPDDDHCAKTHYTAIKSVLAM-FKKAIKQCDFVVGDNCSVNKKLVKLMSVP  60

Query  136  LVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDR----------SSAKTRGG  185
            L+GCASHRLN AV+     +E+EL  +Q+LM+KL+      +              TR  
Sbjct  61   LIGCASHRLNLAVKAYTQQHEDELVKIQQLMIKLRTLNQASKLLFRTELRPILRQDTRWS  120

Query  186  STFFMIMRYFYLLEFIDAIDDELEDMMPSPAQT  218
            STF M+ R+F L E +D  DD + +++P+  +T
Sbjct  121  STFAMLQRFFELREHLDHEDDTILEILPTLGET  153

>PHYCA_59647
Length=215

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 74/147 (50%), Gaps = 30/147 (20%)

Query  16   MPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTP  75
            M   F L+FDGWT  S +++ +Y  Y  +                   G+     +A +P
Sbjct  88   MGTSFALMFDGWTSHSLNFLGIYALYVYN-------------------GVRHQRLLAVSP  128

Query  76   LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVP  135
            +          E+G +A  H++ ++T+L   Y K L M  ++V D C+ N  +AT MGVP
Sbjct  129  M----------EDGQTAEAHLDHISTVLSM-YEKNLQMVRYVVGDNCATNHSMATRMGVP  177

Query  136  LVGCASHRLNRAVQLELADYEEELDTV  162
            L+GCASHR N AV   L DY+ ++D +
Sbjct  178  LIGCASHRFNLAVNRFLQDYQTQIDLI  204

>PPTG_22261
Length=663

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 101/224 (45%), Gaps = 45/224 (20%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++ + V   I  E+   F L+FD W+H S  Y+ +Y  YE+             + E 
Sbjct  320  MHTVAKDVGAAIEHEIGTSFALMFDCWSHGSVQYVGLYDVYEMM----------GTRRER  369

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                LF                        +A   ++ +  +L R Y K   M  F+V D
Sbjct  370  LLSCLF-----------------------WTAAKQLKMMKAVL-RIYNKTTDMVTFIVGD  405

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDR---  177
             C+ N+++ATL+GVPLVGCASHR N  +    A+YE EL T+  LM++L+   N  R   
Sbjct  406  NCNTNQKIATLLGVPLVGCASHRFNLVINPFHAEYEAELATINDLMIQLRHCNNAARLGE  465

Query  178  -------SSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
                       TR  ST+ M+ RY  + + I  + +  ED +PS
Sbjct  466  LTDLQPVKRNATRWSSTYAMVDRYVRIRDAIRQV-EAAEDYVPS  508

>PPTG_06264
Length=200

 Score = 81.6 bits (200),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 56/101 (55%), Gaps = 30/101 (30%)

Query  116  FLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNC  175
            F+V D C+VN+RLA LMGVPLVGCASHRLN AV+  L                       
Sbjct  2    FVVGDNCAVNKRLAHLMGVPLVGCASHRLNLAVRRFL-----------------------  38

Query  176  DRSSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                   + GSTF M+ RY  L E+I A DDEL ++MPSPA
Sbjct  39   -------KPGSTFAMLDRYLALREYISADDDELAEVMPSPA  72

>PPTG_12864
Length=210

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 73/120 (61%), Gaps = 10/120 (8%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            +GK +  C FLV D C+VN+RLA LM VPLVGCASHRLN AV+  L  +E  LD VQ+LM
Sbjct  11   FGKTINGCKFLVGDNCAVNKRLANLMNVPLVGCASHRLNLAVREFLVPFETALDQVQQLM  70

Query  167  lklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             KL+      +   K          TR  STF M+ RY  L EF+ A DD++ D++PS A
Sbjct  71   RKLRTLNQAAKLRMKTPLMPILRQDTRWSSTFSMLERYIRLREFLSADDDDMADLLPSRA  130

>PYIW_19602
Length=167

 Score = 80.5 bits (197),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 77/160 (48%), Gaps = 34/160 (21%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   V   I   M ++FGL+FDGWT  + HY+A++                      
Sbjct  37   MQHVATKVGASITRAMSEQFGLMFDGWTSNAFHYVALF----------------------  74

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
               G++++D     PLL ++ +    E G +A  H+E ++++L   YGK + M  F+V  
Sbjct  75   ---GVYATDGTRCQPLLTISPI----EHGQAADAHVELMSSVL-ELYGKTIDMVQFIVGG  126

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELD  160
             CS N+  A  + +PL+GC SHR N AV    + Y E L 
Sbjct  127  NCSTNQPAAVKLSIPLIGCTSHRFNLAV----SKYPERLQ  162

>PYIW_26280
Length=291

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 94/202 (47%), Gaps = 47/202 (23%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +F+GWT  + HY A++                          ++++D   + PLL ++ +
Sbjct  1    MFNGWTSGAFHYAALF-------------------------SVYATDGTRRQPLLAISSM  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
                E G     H+E L+++L + YGK + M  F+V D CS N+ +AT + +PL+GCASH
Sbjct  36   ----EHGQPVDAHIELLSSVL-KLYGKTIDMIQFIVDDNCSTNQPVATKLSIPLIGCASH  90

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRGGSTFFMIMRYFYLLEFID  202
            R N  V   L+DY +  D V  LM                +  ST+ M+ RY  + +   
Sbjct  91   RFNLVVSKYLSDYSDLPDQVHALM---------------AQWSSTYDMLERYIAIRDAAK  135

Query  203  AIDDELEDMMP-SPAQTAVCEL  223
             +   +ED++P S A   +  L
Sbjct  136  QV-ASMEDLVPRSSAHNEIVTL  156

>PHALS_01004
Length=509

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/243 (27%), Positives = 116/243 (48%), Gaps = 50/243 (21%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  L+  V+  I   +P +F ++FDGWT  S H++AV+  +                D+ 
Sbjct  112  MSHLSELVRNKIRNLLPSQFAIVFDGWTDCSTHFLAVFAVFP---------------DKD  156

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
            +  G ++   ++  PL         +E  L A  H E +  +L + +GK       ++ D
Sbjct  157  QQTG-YNKALLSFFPLA--------DETSLDADSHHESIYDVL-QQFGKDFSNIACIIGD  206

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             C++N+ LA      LVGCASHRLN  VQ  L+ Y + +D+V+ +M+ L++  N  R++ 
Sbjct  207  NCALNKSLAKKCKSYLVGCASHRLNLGVQKFLSYYSDLIDSVRAIMVSLRKIKN--RAAL  264

Query  181  K------------TRGGSTFFMIMRYFYLLEFIDAI-----------DDELEDMMPSPAQ  217
            K            TR  S + M+ RY  +L+F+++I           +D++E ++   +Q
Sbjct  265  KELTPLSPVLDNATRWSSKYQMLSRYSEILQFVESIVPRKLQLSPGDNDKIEKLLKKLSQ  324

Query  218  TAV  220
              +
Sbjct  325  LEI  327

>PHYSO_530223
Length=152

 Score = 79.0 bits (193),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 68/140 (49%), Gaps = 29/140 (21%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGWTHA  HY+A+Y  YE                   T G        + PLL M+ L
Sbjct  1    MFDGWTHAGIHYVALYAVYE-------------------TAGKL------RIPLLGMSPL  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
               E+    A  H++    +L   Y K   M  FLV D C+ N+ +AT +G+PLVGCASH
Sbjct  36   ---EDGDQMADAHIKLFKNILDV-YDKTSDMVGFLVGDNCATNQSIATKIGIPLVGCASH  91

Query  143  RLNRAVQLELADYEEELDTV  162
            R N AV   +  Y++ L  V
Sbjct  92   RFNLAVNKFMEPYDDLLGEV  111

>PHYSO_254072
Length=426

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 75/162 (46%), Gaps = 29/162 (18%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +   + Q +  E+   FGL+FDGW+HA  HY+A++  YE D                
Sbjct  68   MEGIAIKIGQDLKKELGILFGLMFDGWSHAGVHYVALFAVYEPDGKL-------------  114

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        + PLL +  L +  +   +A  H+E    +L   Y K L M  F+V D
Sbjct  115  ------------RVPLLGLPPLADGNQ---TADVHVELFKNILDV-YNKTLDMVGFMVGD  158

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
              + N+ +A  M VPLVGCASHR N AV   LA Y+  L  V
Sbjct  159  KYNTNQAIANKMAVPLVGCASHRFNLAVNKFLAPYKTLLSGV  200

>PHYCA_116548
Length=230

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 10/99 (10%)

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
            LA LMG+PLVGCASHRLN AVQ ++  +EE+L  VQ LM+KL+      +   K      
Sbjct  1    LANLMGIPLVGCASHRLNLAVQNDMLVHEEDLAAVQTLMIKLRTVTQSAKLRLKTPLRPV  60

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
                TR  STF M+ RYF LLEF+DA DDE+ +++P PA
Sbjct  61   IRQDTRWSSTFEMMRRYFKLLEFLDADDDEIMELVPLPA  99

>PHYCA_98973
Length=108

 Score = 77.0 bits (188),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 29/137 (21%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGW+HA  HY+A++  YE D                            + PLL ++ L
Sbjct  1    MFDGWSHAGIHYVALFAAYEADGKL-------------------------RVPLLGLSPL  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
             +  +   +A  H++   + L   Y K L M  F+V   C+ NR +AT +GVP VGCASH
Sbjct  36   ADGTQ---TADAHVQLFKSTLDV-YNKTLSMVAFMVGVNCNTNRSIATKLGVPQVGCASH  91

Query  143  RLNRAVQLELADYEEEL  159
            R N AV   L  +E  L
Sbjct  92   RFNLAVNKFLEPHEALL  108

>PPTG_03236
Length=312

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 68/118 (58%), Gaps = 11/118 (9%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            Y K + M  FLVAD C+ N+R+ATL+ +PLVGCASHR N AV   LA YE EL  V  LM
Sbjct  9    YKKDISMVAFLVADNCATNQRIATLLELPLVGCASHRYNLAVNRYLASYETELTVVNSLM  68

Query  167  lklqqklNC-------DRSSAK---TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
            ++L    N        DR   K   TR  STF M+ RY  + + I  + D +E+ +P+
Sbjct  69   VQLCHVNNAAELARFTDRKPVKRNITRWSSTFEMVCRYKEIRDSIRQV-DAVEEFIPN  125

>PHYSO_410894
Length=87

 Score = 76.3 bits (186),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 1/68 (1%)

Query  95   HMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            H+  L+T+L +++GK +   CFL++D C+VN+RLA +MGVPLVGCASHRLN AV+L  + 
Sbjct  4    HLAALSTIL-QEFGKSINQACFLISDNCAVNKRLARIMGVPLVGCASHRLNMAVRLYTSP  62

Query  155  YEEELDTV  162
             E  L  +
Sbjct  63   LENALAGI  70

>H257_10910
Length=526

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 94/226 (42%), Gaps = 54/226 (24%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRY--EVDSNTVFRCMRPAVKDE--AKTVGL--  65
            I  E+PD+FG++ DGWTH SEH+IA++  Y    D   V   M P +KD   A   G+  
Sbjct  102  IMKELPDKFGVVLDGWTHMSEHFIALFAVYVNAGDRKKVLLSMTPLIKDTSLANVQGVDE  161

Query  66   ----FSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADI  121
                  +D V +   L + H                                  F VAD 
Sbjct  162  LQPSPETDEVVQVQALYLLH---------------------------------HFYVADN  188

Query  122  CSVNRRLATLMGVPLVGCASHRLNRAVQ----LELADYEEELDTVqklmlklqqklNCDR  177
            CSVN+++A  M VPL+ CASHR N AVQ     E AD   ++  V      L       +
Sbjct  189  CSVNKKMAIDMKVPLLRCASHRFNLAVQDLMKGEFADLLAKVQKVMLSCKALNNAAELKK  248

Query  178  SSA-------KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             +A        TR  S F M+ R+  LL  ++ +    +  M S A
Sbjct  249  LTALKPKLLQTTRWSSAFEMLRRFQKLLPSLEQMPKRAKLKMSSKA  294

>PHYCA_124924
Length=253

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 101/201 (50%), Gaps = 41/201 (20%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGW+  + H++AV+V Y         C R         VGL         P+      
Sbjct  1    MFDGWSSGTRHFVAVFVVYHGSDGL---CER--------LVGL--------APM------  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
                ++G SA  H+EF+  +L   YGK L M  F+VAD C+ N+ +AT + VPL+GCASH
Sbjct  36   ----KDGQSADAHIEFIDAILDV-YGKTLAMVKFVVADNCTTNKSVATKLDVPLIGCASH  90

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDR----------SSAKTRGGSTFFMIM  192
            R N A+   L+++E  ++ +Q+LM  L+Q  N  +           +  TR  S + M+ 
Sbjct  91   RFNLAMVRFLSNHEHLINMIQRLMTSLRQPNNAAQLALHTALLPEKANATRWSSVWKMVH  150

Query  193  RYFYLLEFIDAIDDELEDMMP  213
            +Y  + +    +  E+E+++P
Sbjct  151  KYVCIRDAAKHV-AEVEELLP  170

>PYIW_25497
Length=314

 Score = 80.5 bits (197),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 73/140 (52%), Gaps = 32/140 (23%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGWT  + H++A++                          ++++D + + PLL ++ +
Sbjct  1    MFDGWTSGAFHFVALF-------------------------SVYATDGMRRQPLLAISPM  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
                E G SA  H+E ++ +L   YGK + M  F+V D CS N+ +AT + +PL+GC SH
Sbjct  36   ----EHGQSADAHIELMSNVLEL-YGKTIDMIQFIVGDNCSTNQFIATKLSIPLIGCDSH  90

Query  143  RLNRAVQLELADYEEELDTV  162
            R N AV   L+DY +  D V
Sbjct  91   RFNLAV--TLSDYSDLTDQV  108

>PHYCA_106411
Length=230

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 68/111 (61%), Gaps = 13/111 (12%)

Query  116  FLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNC  175
            FLV D  SVN+RLA +MGVPLVGCASHRLN AV+  LA +E  L+ +Q+LM KL+     
Sbjct  1    FLVGDNGSVNKRLADIMGVPLVGCASHRLNLAVRDYLAPHEPALEEIQQLMRKLRTLKQA  60

Query  176  DRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             +   K          TR  STF M+ RYF L    D  +++L ++MPSPA
Sbjct  61   AKLRLKTPLVPIMRQDTRWASTFSMLKRYFRLR---DTDNEDLAELMPSPA  108

>PHYCA_108979
Length=256

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 79/128 (62%), Gaps = 9/128 (7%)

Query  95   HMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            H++ L ++LP  + + +    +LV D  +VN R+  L+ +PLVGCASHRLN AVQ  +A 
Sbjct  1    HVKLLKSVLP-FFNRDITSVVYLVGDNGAVNTRVPDLLSIPLVGCASHRLNLAVQELMAK  59

Query  155  YEEELDTVqklmlklqqklNCD--RSSAK------TRGGSTFFMIMRYFYLLEFIDAIDD  206
            Y+  L  +Q+LM KL+   +    R+S++      TR  ST+ M+ R+F +  F++  DD
Sbjct  60   YDSLLPKIQELMRKLRTLNHSATLRTSSRHVVRQCTRWDSTYKMVKRFFAIKGFVETSDD  119

Query  207  ELEDMMPS  214
            EL ++MP+
Sbjct  120  ELAELMPT  127

>PHYCA_119644
Length=301

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 101/201 (50%), Gaps = 41/201 (20%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGW+  + H++AV+V Y         C R         VGL         P+      
Sbjct  1    MFDGWSSGTRHFVAVFVVYHGSDGL---CER--------LVGL--------APM------  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
                ++G SA  H+EF+  +L   YGK L M  F+VAD C+ N+ +AT + VPL+GCASH
Sbjct  36   ----KDGQSADAHIEFIDAILDV-YGKTLAMVKFVVADNCATNKSVATKLDVPLIGCASH  90

Query  143  RLNRAVQLELADYEEELDTVqklmlklqqklNCDR----------SSAKTRGGSTFFMIM  192
            R N A+   L+++E  ++ +Q+LM  L+Q  N  +           +  TR  S + M+ 
Sbjct  91   RFNLAMVRFLSNHEHLINMIQRLMTSLRQPNNAAQLALHTALLPEKANATRWSSVWKMVH  150

Query  193  RYFYLLEFIDAIDDELEDMMP  213
            +Y  + +    +  E+E+++P
Sbjct  151  KYVCIRDAAKHV-AEVEELLP  170

>PHYSO_340757
Length=527

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 92/222 (41%), Gaps = 46/222 (21%)

Query  19   RFGLIFDGWTHASEHYIAVYVRYEVDSN---------TVFRCMRPAVKDEAKTVGLFSSD  69
            R G  FD WT    H++A+    E              +F  + P   D  K   LF +D
Sbjct  142  RVGFAFDAWTCNGYHFVAIIAVVEKAGLGGKSREQFLLLFEPIDPKHYDAKKK--LFHAD  199

Query  70   AVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLA  129
            A+                        +EF    L R Y       CFLV D  SVN  + 
Sbjct  200  AI------------------------IEFFYVALDR-YRIDANQLCFLVGDNASVNGSIG  234

Query  130  TLMGVPLVGCASHRLNRAVQLELADYEEE----------LDTVqklmlklqqklNCDRSS  179
              + +PLVGCASHRLN AV+  LA Y+ E          L T +   +  +        +
Sbjct  235  RKIDLPLVGCASHRLNLAVEQHLALYDAEVTKVEKLMRYLRTSKVRSVLHKLNGPTPLLN  294

Query  180  AKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQTAVC  221
              TR  ST+ M+ RY  + +FID+   EL  ++P+P + +VC
Sbjct  295  NTTRWSSTYLMLKRYKSIAKFIDSSSPELAPLLPTPEEHSVC  336

>H257_10662
Length=407

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 108/228 (47%), Gaps = 48/228 (21%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++ R ++  I+  +P+ F +I+DGWT  S HY+A++  +  DS+  +           
Sbjct  77   MHAMCRWMESKISETLPESFAIIYDGWTSGSTHYVAMFATFPNDSHRGY-----------  125

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        +  LL M+ +  +EE+ LSA  H++          G+ +     L+ D
Sbjct  126  ------------EKVLLAMSPM--NEEDSLSAAAHVQ---------TGENV---VALIGD  159

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNC-----  175
             CS+NR  + L GVP++GC SHR N  V   LA++EE L  V  +M KL   +       
Sbjct  160  NCSINRAFSRLAGVPMIGCVSHRFNLFVGDVLAEHEELLVAVNAIMKKLTNFIPSAKLRR  219

Query  176  -----DRSSAKTRGGSTFFMIMRYFYLLEFIDAID-DELEDMMPSPAQ  217
                  +   +TR  S+  M+ RY  L  F+  +  +E+++++ S  Q
Sbjct  220  LTDLRPKQRNQTRWNSSVAMLDRYVKLTPFLPLMGVEEIDNLLLSVRQ  267

>PHYCA_113307
Length=223

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 72/132 (55%), Gaps = 12/132 (9%)

Query  95   HMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            H+E    +L   Y K + M  FLVAD C+ N+R+ATL+ +PLVGCASHR N AV   LA 
Sbjct  36   HIEMFKRVLAL-YNKDISMVAFLVADNCATNQRIATLLELPLVGCASHRYNLAVNRYLAA  94

Query  155  YEEELDTVqklmlklqqklNCDRSSA----------KTRGGSTFFMIMRYFYLLEFIDAI  204
            YE EL  V  LM++L+   N    S            TR  STF M+ RY  + + I  +
Sbjct  95   YEPELAAVNSLMVQLRHVNNAAELSKFTDLKPVKRNGTRWSSTFAMVDRYKKIRDSIRQV  154

Query  205  DDELEDMMPSPA  216
             D +++ +P  A
Sbjct  155  -DAVDEFIPKGA  165

>PPTG_06263
Length=82

 Score = 72.4 bits (176),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 54/104 (52%), Gaps = 25/104 (24%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +T+ V+Q I AE+PD+FG+I DGWTH +EHY+AVY  Y+V                 
Sbjct  1    MEKVTKAVEQRIGAELPDKFGVILDGWTHGTEHYLAVYGCYDV-----------------  43

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLP  104
                      V K PLL  A ++N  ++ L+A  HM  LA  LP
Sbjct  44   --------HGVRKCPLLSFAPIINGLDDRLNAESHMTALAAFLP  79

>PPTG_08850
Length=301

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 82/140 (59%), Gaps = 14/140 (10%)

Query  76   LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVP  135
            L+ MA +++DE    +A  H++FL  +L   YG+      ++V DICSVN  +A  + VP
Sbjct  5    LIAMAPIIDDEISDHTASSHVKFLDVILSY-YGRSKASIAYIVGDICSVNGAVADQLQVP  63

Query  136  LVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRGGSTFFMIMRYF  195
            +VGCASHRLN AV L LA  ++ LD +QKLM K             TR  STF M+ RYF
Sbjct  64   MVGCASHRLNLAVNLLLAGDDKLLDKIQKLMYK------------DTRWSSTFAMVNRYF  111

Query  196  YLLEFI-DAIDDELEDMMPS  214
             L EF+ D  +DEL   +P+
Sbjct  112  ELKEFLSDDDEDELTGFLPT  131

>PPTG_22045
Length=431

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 61/227 (27%), Positives = 92/227 (41%), Gaps = 62/227 (27%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++T  V+ +I AEMP+ FGL+ DGW++ SE+Y+AVY  Y +     +           
Sbjct  73   MEAVTHEVETIIGAEMPNEFGLMLDGWSNGSEYYLAVYAVYSIKGGGHY-----------  121

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLP--RDYGKQLGMCCFLV  118
                          PLL M  ++N+ E    A   +  ++  LP     G+ + + C   
Sbjct  122  --------------PLLSMTPVVNEPENDRGAESLLAAISIFLPFSEKNGETMSISC---  164

Query  119  ADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYE----------EELDTVqklmlk  168
                                   HRL  AV+  LA YE          ++L T+ +    
Sbjct  165  ----------------------RHRLILAVKALLALYEADVCEVQRLMKQLKTLSEGAKL  202

Query  169  lqqklNCDRSSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSP  215
                        +TR GST  M+ RYF L  F+   DDEL + +PSP
Sbjct  203  RLVTPLRPVLRQQTRWGSTHAMLRRYFELRGFLSMDDDELAEFLPSP  249

>PYIW_20457
Length=218

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 75/162 (46%), Gaps = 30/162 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M +LT  V+  I  ++P  + LIFDG +  S+H+I +   ++                  
Sbjct  1    MAALTVQVEAEIRLQIPPVYALIFDGRSDNSDHFIDITFAWD------------------  42

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
               G  +   VA  PLL        +E  +SA  H +FL   L      + G+ C L+ D
Sbjct  43   ---GAVAKHLVAFAPLL--------DETNMSATNHKDFLDATLELLQFNKDGLVC-LIGD  90

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
             C+ N   A LMGVPL+GC SHRLN+A +  L D   EL  V
Sbjct  91   NCNSNGATARLMGVPLIGCWSHRLNQAAEQVLQDCNSELQLV  132

>PHYCA_103032
Length=290

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 65/120 (54%), Gaps = 11/120 (9%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            Y K L M  F+V D CS N+ +AT +GVPLVGCASHR N AV   LADYE  L  V  LM
Sbjct  47   YNKTLDMVAFIVGDNCSTNQSIATKLGVPLVGCASHRFNLAVNKYLADYEPLLAQVNTLM  106

Query  167  lklqqklNCDRSSA----------KTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             KL Q  N    S            TR  S+F M+ RY  +   I  + D +E+++P+ A
Sbjct  107  SKLCQVNNFAELSKVTSLHPIKRNMTRWSSSFEMLQRYIRIRPQIKTV-DAVEELIPTGA  165

>PPTG_24278
Length=225

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 72/138 (52%), Gaps = 32/138 (23%)

Query  79   MAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
            MA ++N  +E  SAR H +FLA ML +D+                 NRRLAT+M VPLVG
Sbjct  1    MAPVINGLDEDPSARIHRDFLAGMLEQDFA----------------NRRLATIMLVPLVG  44

Query  139  CASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKTRGGSTFFMIMRYFYLL  198
            CASHRLNRAVQ  +   E +   VQ LM KL+   +   S                F LL
Sbjct  45   CASHRLNRAVQQHMTQNENDFAAVQGLMTKLRTIKHPKAS----------------FALL  88

Query  199  EFIDAIDDELEDMMPSPA  216
            EF+D  D+EL  ++P PA
Sbjct  89   EFLDQDDEELMYLLPCPA  106

>PHYRA_75115
Length=302

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 17/122 (14%)

Query  103  LPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            +P  +G       F++     VN+RLA ++GVPLVGC SHRLN AV+  L  ++  L+ V
Sbjct  16   MPESFG-------FIIDGWTHVNKRLANVLGVPLVGCTSHRLNLAVRDYLGPHDNILEEV  68

Query  163  qklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMM  212
            Q+LM KL+      +   K          TR  STF M+ RYF L EFI A D+EL D +
Sbjct  69   QQLMRKLRTLKQASKLRTKTSLAAVLRQDTRWLSTFSMLKRYFLLREFISADDEELGDYL  128

Query  213  PS  214
            PS
Sbjct  129  PS  130

 Score = 42.7 bits (99),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 0/37 (0%)

Query  1   MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAV  37
           M ++T+ V++ I  EMP+ FG I DGWTH ++    V
Sbjct  1   MEAVTKAVEKAIGGEMPESFGFIIDGWTHVNKRLANV  37

>PHYRA_78224
Length=333

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 73/149 (49%), Gaps = 29/149 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M   T+ V++ IAA +P  FG+++DGW    EH++A Y+ +  D      C+        
Sbjct  43   MAETTKAVERAIAAIIPSIFGVMYDGWLCFVEHFVATYIVFWRDDQ--LHCV--------  92

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                           LL +A L   +E   SA  H+ F+  +L   YG+      FL+ D
Sbjct  93   ---------------LLAVAPL---DEADQSAASHVAFIRNIL-AIYGQSPAHLRFLIGD  133

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQ  149
             C+  +  AT+ G+PLVGCASHRLN A +
Sbjct  134  NCATIQLTATMFGIPLVGCASHRLNLATK  162

>PPTG_09187
Length=213

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 93/212 (44%), Gaps = 64/212 (30%)

Query  3    SLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKT  62
            ++T  V +V A ++P+RFG IFDGW+H +EH+IAV+  YE+  N   RC           
Sbjct  23   AVTHSVVRVSAEDIPERFGTIFDGWSHGTEHFIAVFAWYEM--NGEIRC-----------  69

Query  63   VGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADIC  122
                        PLL MA L+N+                          G   F+  +  
Sbjct  70   ------------PLLSMAPLVNE--------------------------GTNDFVGRNAS  91

Query  123  SVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKT  182
             ++RR A             RL +A  L +  + E  D        ++ K + +RS+   
Sbjct  92   RLSRRDAI-----------ARLQQAAPLIVGIFAETADNDTVRETTIENKPSTNRSANPL  140

Query  183  RGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
              GSTF M+ R+F LL F+D  D++L +++PS
Sbjct  141  --GSTFAMLNRFFELLPFLDVDDEDLGELLPS  170

>PHYSO_248863
Length=315

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 68/142 (48%), Gaps = 29/142 (20%)

Query  21   GLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMA  80
            G ++DGW+ + EHY+A++                         G+F  +   + PLL + 
Sbjct  6    GAMYDGWSCSLEHYVALF-------------------------GVFCKNGKLEQPLLAIE  40

Query  81   HLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCA  140
             +    E  L+A  H  F+  +  + Y + L    FL+ D C+ NR  AT + VPL+GCA
Sbjct  41   AM---GEGDLTAPTHCAFITRVFEK-YNQSLESLAFLIGDNCATNRTTATRLEVPLIGCA  96

Query  141  SHRLNRAVQLELADYEEELDTV  162
            SHR N AV   L DY +E+  V
Sbjct  97   SHRFNLAVNKYLEDYTDEVSAV  118

>H257_05042
Length=204

 Score = 73.6 bits (179),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 73/152 (48%), Gaps = 26/152 (17%)

Query  3    SLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKT  62
            ++ R ++  I+  +P+ F +++DGWT  S HY+A++  +    N   R     +      
Sbjct  79   AMCRWMESKISETLPESFAIVYDGWTSGSTHYVAMFATFP---NNYHRGYEKVL------  129

Query  63   VGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADIC  122
                    +A +P+        +EE+ LSA  H+++L  +L   Y K  G    L+ D C
Sbjct  130  --------LAMSPM--------NEEDSLSAAAHVQYLNFVLGV-YAKDRGNVVALIGDNC  172

Query  123  SVNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            S NR  A     P++GCASHR N  V   LA+
Sbjct  173  STNRAFARTADAPMIGCASHRFNLFVGDVLAE  204

>PPTG_07963
Length=96

 Score = 70.5 bits (171),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 55/90 (61%), Gaps = 10/90 (11%)

Query  116  FLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNC  175
            F+V D C+VN+RLA LMGVPLVGCASH LN AV+  L  YEE+++ VQ L+ +L+     
Sbjct  2    FVVGDNCAVNKRLAHLMGVPLVGCASHHLNLAVRRFLEPYEEDMEQVQTLVRRLRTITQA  61

Query  176  DRSSAK----------TRGGSTFFMIMRYF  195
             +   K          TR GSTF M+ RY 
Sbjct  62   SKLRLKTSLRPKLRNETRWGSTFAMLDRYL  91

>PPTG_02934
Length=229

 Score = 73.6 bits (179),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 67/136 (49%), Gaps = 29/136 (21%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M ++ + V  VI  E+   FGL+FDGW+H S HYI +Y  Y+V                 
Sbjct  117  MHTVAKNVGVVIDQELGVSFGLMFDGWSHGSMHYIGLYGVYDV-----------------  159

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
              +G      ++ +PL          E G SA  H+E + T+L   Y K   M  F+V D
Sbjct  160  --MGARRERLLSLSPL---------GEGGQSAEAHVEMIRTVLDV-YNKTTAMVAFIVGD  207

Query  121  ICSVNRRLATLMGVPL  136
             C+ N+++ATL+GVPL
Sbjct  208  NCNTNQKIATLLGVPL  223

>PHYCA_82200
Length=82

 Score = 69.3 bits (168),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 3/81 (4%)

Query  76   LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVP  135
            LL +A LL++ + G  A  H+ F+   L   +GK+ G   F+V D CS N+ +AT MG+P
Sbjct  2    LLALAPLLDENDFG--ADSHIAFITETLSV-FGKEPGCVRFIVGDNCSTNQAIATRMGLP  58

Query  136  LVGCASHRLNRAVQLELADYE  156
            LVGCASHRLN A+Q  +A++E
Sbjct  59   LVGCASHRLNLAIQQHVAEHE  79

>PYIW_27314
Length=190

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 73/152 (48%), Gaps = 21/152 (14%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  L + V+  I+  +P  FGL+ DG T ++ HY+AV+  Y             A     
Sbjct  1    MDQLAQRVESTISTTLPSSFGLVLDGRTSSARHYMAVFAVY-------------AGARAP  47

Query  61   KTVGLFSSDAVAKTP------LLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMC  114
             ++GL  S ++ +         + +A    ++EE LSA    + +A  L R YGK     
Sbjct  48   ASIGLLGSSSLHENRECKGRCFVLLAFCPMEDEEDLSAPSLFDLIAGTLSR-YGKPWEFV  106

Query  115  CFLVADICSVNRRLATLMG-VPLVGCASHRLN  145
             F+V D CSVN+ +    G + L+GCASHR N
Sbjct  107  AFMVGDNCSVNQYIGRRKGAILLIGCASHRFN  138

>PPTG_04989
Length=253

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 58/95 (61%), Gaps = 10/95 (11%)

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKT---------  182
            MG+PLVGCASHRLN AV+  L  +E +L+ VQ LM +L+      +   KT         
Sbjct  1    MGIPLVGCASHRLNLAVRTLLEPHEADLEQVQSLMKRLRTLTQAAKLRLKTSLRPKLRQE  60

Query  183  -RGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             R GST+ M+ RYF L EFI A D++L  +MPSPA
Sbjct  61   TRWGSTYAMLARYFDLREFISADDEDLARLMPSPA  95

>PHYCA_113633
Length=234

 Score = 72.4 bits (176),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 75/126 (60%), Gaps = 10/126 (8%)

Query  99   LATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEE  158
            L+T+    +GK +    FLV D C+VN+RLA LM VPLVGCASHRLN AV+  L  +E+ 
Sbjct  15   LSTVFLPFFGKTIQGVRFLVGDNCAVNKRLANLMEVPLVGCASHRLNLAVRDFLRPHEDI  74

Query  159  LDTVqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFIDAIDDEL  208
            L+ VQ LM KL+      +   K          TR  STF M+ RY  L EF+ A DD++
Sbjct  75   LEEVQLLMRKLRTLNQAAKLRLKTPLVAVLRQDTRWSSTFTMLDRYVRLREFLSADDDDI  134

Query  209  EDMMPS  214
             D++PS
Sbjct  135  ADLLPS  140

>PHYCA_114426
Length=279

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 70/138 (51%), Gaps = 12/138 (9%)

Query  87   EEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNR  146
            E   +A  H+E    +L   Y K   M  F+V D C+ NR +A  + VPLVGCASHRLN 
Sbjct  18   EGSQTADVHIEHFKRVLDV-YNKTTSMILFVVGDNCTTNRSIANKLSVPLVGCASHRLNL  76

Query  147  AVQLELADYEEELDTVqklmlklqqklNCDR----------SSAKTRGGSTFFMIMRYFY  196
            AVQ  L  YE+ELD +  LM++L+   N                 TR  ST  M+ RY  
Sbjct  77   AVQAYLKQYEQELDELNALMVQLRHPNNSAELAKFTDLRPIKRNTTRWSSTREMVSRYIE  136

Query  197  LLEFIDAIDDELEDMMPS  214
            +   I  + + +ED +P+
Sbjct  137  IRSDIRKV-EAVEDFIPT  153

>PPTG_11113
Length=318

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 11/119 (9%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            Y K+  M  FLVAD CS N+ +AT MGV LVGCASHR N AV   L D + ++D VQ L 
Sbjct  9    YKKEPSMILFLVADNCSTNQAVATRMGVALVGCASHRFNLAVCRYLEDLKSQIDQVQTLC  68

Query  167  lklqqklNCDR----------SSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSP  215
            ++L+   N  +           +  TR  ST+ M+ RY  +   I  +   +ED++P P
Sbjct  69   IQLRYTNNAAKLAQFTKYKPLKANATRWSSTYHMLARYVKIRHAIKMV-AAVEDLLPRP  126

>PPTG_01731
Length=177

 Score = 70.9 bits (172),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 72/157 (46%), Gaps = 30/157 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +T  V    A  + D FGL+FDGWT  + H++ ++                      
Sbjct  1    MRHVTSKVGAADAELLGDSFGLMFDGWTCGTVHFVGIF----------------------  38

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
               G+   D V + PLL ++      ++G SA  H+E +  +L   Y K   M  F V D
Sbjct  39   ---GVSVRDGVRRQPLLSISM----AKDGQSADDHIEMIDNVLDV-YEKNREMLRFDVGD  90

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEE  157
             C  N+ +AT + VPL+GCAS R N A    L +YE+
Sbjct  91   NCPTNKAIATRLKVPLIGCASQRFNLAGCEYLVEYED  127

>PHYSO_333013
Length=502

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 88/208 (42%), Gaps = 20/208 (10%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            +A E+P  FGL+ DGWT    HYIA++  +  DS          +         +     
Sbjct  127  VARELPASFGLVLDGWTSGGRHYIAIFAVFGSDST--------GITGGGADNEYYDDLEC  178

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
            +    L +     + EE + A+   + +A  L R Y K      F+V D CSVN+ +   
Sbjct  179  SSRRFLLLTFAPVEVEEDMGAQSQYDLIADTLSR-YNKPWSAVKFMVGDNCSVNQCIGRK  237

Query  132  MG-VPLVGCASHRLNRAVQLELADYEE----------ELDTVqklmlklqqklNCDRSSA  180
             G +P +GCASHR N AV+  L   +E          +L T++   L  +          
Sbjct  238  EGAIPFIGCASHRFNLAVKDFLKTEDELIAKVHALMTKLRTIKGRALLRRVSHLSPLLRY  297

Query  181  KTRGGSTFFMIMRYFYLLEFIDAIDDEL  208
             TR  ST+ M+ RY  L   I  +  +L
Sbjct  298  DTRWSSTYEMVARYVKLQPAIIKLGHDL  325

>PHYSO_525912
Length=319

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 18/108 (17%)

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
            +  +N+RLA L+GVPL+GCASHRLN AV+    +Y E  D++ + + +L +KL   + +A
Sbjct  37   VYGLNKRLANLLGVPLIGCASHRLNLAVR----NYLEPQDSILEEVQQLMRKLRTLKQAA  92

Query  181  KTRG--------------GSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
            K R                STF M+ RYF L  FI A D+EL D +PS
Sbjct  93   KLRAKTPLAAVLRQDTHWSSTFSMLKRYFRLRPFISADDEELADFLPS  140

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 0/38 (0%)

Query  1   MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVY  38
           M ++T+ ++ +I   MP+RFGL+ DGWTH +EHY+AVY
Sbjct  1   MEAVTKAMETMIGDAMPERFGLVLDGWTHGTEHYMAVY  38

>PYAR_18789
Length=301

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 69/122 (57%), Gaps = 13/122 (11%)

Query  87   EEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNR  146
            E+G +A  H+E L  +L   YGK + M  FLV D CS N+ +AT +GVPLVGCASH  N 
Sbjct  2    EDGFTADAHVEHLKAILSV-YGKSVDMVRFLVGDNCSTNQCIATQLGVPLVGCASHHFNL  60

Query  147  AVQLELADYEEELDTVqklmlklqqklNCD-----------RSSAKTRGGSTFFMIMRYF  195
            AV   L++YE+ +  +Q L+ +L+   N             R++A TR  ST  M+ RY 
Sbjct  61   AVTKFLSEYEDVISQIQNLVSQLRFPKNVTELSNHTTLLPVRANA-TRWSSTAEMVERYM  119

Query  196  YL  197
             +
Sbjct  120  RI  121

>PPTG_19011
Length=131

 Score = 68.6 bits (166),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 65/139 (47%), Gaps = 33/139 (24%)

Query  24   FDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHLL  83
            FDGW+ +S +Y+ +Y  Y                             +A TPLL  A L 
Sbjct  10   FDGWSTSSTYYVGIYAIY----------------------------VIADTPLL--APLF  39

Query  84   NDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHR  143
              EE    A   + F+   L    GKQ G   F++ D C   + +AT MG+PLVGCASHR
Sbjct  40   --EENAFGADLRIAFIMETLAVS-GKQPGCVRFIIGDNCITIQAIATRMGLPLVGCASHR  96

Query  144  LNRAVQLELADYEEELDTV  162
            +N A+Q  +A++E  L  V
Sbjct  97   INLAIQQHVAEHEALLSQV  115

>PHYSO_506404
Length=466

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 83/197 (42%), Gaps = 20/197 (10%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            I  E+P  FGL+ DGWT    HYIA++  +  DS          +         +     
Sbjct  117  ITRELPASFGLVLDGWTSGGRHYIAIFAVFGSDST--------GITGGGADNEYYDDLEC  168

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
            +    L +     + EE + A+   + +A  L R Y K      F+V D CSVN+ +   
Sbjct  169  SSRRFLLLTFAPVEVEEDMGAQSQYDLIADTLSR-YNKPWSAVKFMVGDNCSVNQCIGRK  227

Query  132  MG-VPLVGCASHRLNRAVQLELADYEE----------ELDTVqklmlklqqklNCDRSSA  180
             G +P +GCASHR N AV+  L   +E          +L T++   L  +          
Sbjct  228  EGAIPFIGCASHRFNLAVKDFLKTEDELIAKVHALMTKLRTIKGRALLRRVSHLSPLLRN  287

Query  181  KTRGGSTFFMIMRYFYL  197
             TR  ST+ M+ RY  L
Sbjct  288  DTRWSSTYEMVARYVKL  304

>PPTG_19362
Length=258

 Score = 71.2 bits (173),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 11/114 (10%)

Query  113  MCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqk  172
            M  FLVAD CS+N+R+ATL+ +PLV CASHR N AV   LA YE EL  V  LM++L+  
Sbjct  1    MVAFLVADNCSINKRIATLLDLPLVRCASHRYNLAVNRSLAPYEAELAAVNDLMVQLRHC  60

Query  173  lNCDRSSAKT----------RGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             N    +  T          R  STF MI RY  + + I  + + +E+ +P+ A
Sbjct  61   NNAAELAKHTELKPIKRNTIRWSSTFEMIHRYKRIRDAIRQV-EAVEEFIPTGA  113

>PPTG_04929
Length=212

 Score = 70.1 bits (170),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 10/87 (11%)

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------  181
            MGVPLVGCASHRLNRAVQ  L  +E++L  VQ LM+KL+      +   K          
Sbjct  1    MGVPLVGCASHRLNRAVQKYLLQHEDDLAAVQALMIKLRTLTQSAKLRLKTELQPVIRQD  60

Query  182  TRGGSTFFMIMRYFYLLEFIDAIDDEL  208
            TR  STF M+ RYF LLEF+DA DD++
Sbjct  61   TRWSSTFGMLKRYFQLLEFLDADDDDI  87

>PPTG_05887
Length=130

 Score = 68.2 bits (165),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 59/118 (50%), Gaps = 25/118 (21%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            + S+TR V+  +   MP+R G+I DGW+ +SEHY+AV             C + A     
Sbjct  38   LESVTRHVEAALKVGMPERHGMIIDGWSFSSEHYLAVSC-----------CFKMA-----  81

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLV  118
                       A+ PLL MA L+N   +  SA  H+ FL  ML RDY K++  C F+V
Sbjct  82   ---------GTAQYPLLAMALLVNYRMDDHSAATHLTFLREMLMRDYNKRVEDCLFIV  130

>PPTG_09163
Length=177

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 0/84 (0%)

Query  79   MAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
            MA L+N   +  S   H+ FL  ML RDY K++    F+V D C  N+RL  L+ V LVG
Sbjct  1    MAPLVNSPTDDHSVATHLTFLREMLMRDYNKRVDDYLFIVGDNCYTNQRLDNLLSVSLVG  60

Query  139  CASHRLNRAVQLELADYEEELDTV  162
             ASHRLN AVQ    +  ++LD V
Sbjct  61   GASHRLNLAVQNFFREVSDDLDKV  84

>PPTG_14142
Length=316

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 64/120 (53%), Gaps = 11/120 (9%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            Y K   M  F+V D C+ N+ +AT M VPLVGCASHR N AV   L D++  +D VQ L 
Sbjct  9    YNKDRSMVLFMVVDNCATNQAVATRMRVPLVGCASHRFNLAVSRYLEDFKTLIDQVQTLC  68

Query  167  lklqqklNCDR----------SSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            ++L+   N              S  TR  ST  M+ RY  +L+ I  +   +ED++P P+
Sbjct  69   VQLRYTNNAAELARFTKYKLLKSNATRWSSTHQMLARYVEILDAIKMV-AAVEDLLPRPS  127

>PHYSO_466615
Length=236

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 76/157 (48%), Gaps = 29/157 (18%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            + + T+ VK+ IA+ +P  FG++FDGWT   EH +AV   + ++    +  +  A  DE 
Sbjct  105  VAATTKAVKKAIASVIPLDFGVMFDGWTCFGEHNVAVIAVFWLNGEVHYVVLAVAPLDEV  164

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                    D  A++   C     N    GLS                   L + C    D
Sbjct  165  --------DQTAES--YCAFTRNNLSIFGLSVEA----------------LKLLC---GD  195

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEE  157
             C+ N+R+ATL+GVPLVG ASHR N A +  LA++++
Sbjct  196  NCATNQRMATLLGVPLVGWASHRFNLATKKFLAEHDD  232

>PHYSO_482107
Length=286

 Score = 68.9 bits (167),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 74/141 (52%), Gaps = 16/141 (11%)

Query  86   EEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLN  145
            E+   +A  H++    +L   Y K   M  FLV D C+  + +AT MG+PLVGCASHR N
Sbjct  5    EDGDQTADAHIKLFKNILDV-YDKTSDMVGFLVGDNCATTQSIATKMGIPLVGCASHRFN  63

Query  146  RAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------------TRGGSTFFMIMR  193
             AV   +  Y + LD V  LM++L+ + N  R+  K            TR  STF M+ R
Sbjct  64   LAVNKFMEPYGDLLDEVNNLMVELRHENN--RADLKKYTDLVPIKRNVTRWSSTFTMVER  121

Query  194  YFYLLEFIDAIDDELEDMMPS  214
            Y  +   I  + D +E+M+P+
Sbjct  122  YIRIRAEIKKV-DAVEEMVPT  141

>PHYSO_255233
Length=418

 Score = 69.7 bits (169),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 65/149 (44%), Gaps = 11/149 (7%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            +A E+P  FG + DGWT    HYI ++  +  DS          +         +     
Sbjct  81   VARELPASFGPVLDGWTSGGRHYIVIFAVFGSDST--------GITGGGADTEYYDDLEC  132

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
            +    L +     + EE + A+     +A  L R Y K      F V D CSVN+ +   
Sbjct  133  SSRRFLLLTFAPVEVEEDMGAQSQYNLIAGTLSR-YNKPWSAVKFTVGDNCSVNQCIGRK  191

Query  132  MGV-PLVGCASHRLNRAVQLELADYEEEL  159
             GV P +GCASHR N AV+ +    E+EL
Sbjct  192  KGVIPFIGCASHRFNLAVK-DFLKTEDEL  219

>PPTG_07864
Length=65

 Score = 63.9 bits (154),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)

Query  116  FLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            F+V D C+VN+RLA LMGVPLVGCASH LN AV+  L  YEE+L+ V
Sbjct  2    FVVGDNCAVNKRLAHLMGVPLVGCASHHLNLAVRRFLEPYEEDLEQV  48

>PPTG_02917
Length=279

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 57/94 (61%), Gaps = 10/94 (11%)

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAKT---------  182
            MG+PLVGCAS+RLN AV+  L   E +L+ VQ LM +L+      +   KT         
Sbjct  1    MGIPLVGCASYRLNLAVRTLLEPREADLEQVQSLMKRLRTLTQAAKLRLKTSLRPKLRQE  60

Query  183  -RGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSP  215
             R GST+ M+ RYF L EFI A D++L ++MPSP
Sbjct  61   TRWGSTYAMLARYFDLREFISADDEDLAELMPSP  94

>H257_07326
Length=378

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 15/123 (12%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            Y K+L    F++ D CSVN+R+A L+ VPL+GC SH  N AVQ  + +++   D +  +M
Sbjct  147  YSKKLDAITFVIGDNCSVNQRIAGLLNVPLIGCVSHHFNLAVQRMMEEHKNLSDRIHCVM  206

Query  167  lklqqklNCDRSSAK------------TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
            L+ +   N  RS+ +            TR  ST+ M+ R+F + + + AI D L  + P+
Sbjct  207  LRARNVKN--RSALRLLTPLPPKLRNDTRWSSTYAMVARFFEIKDHLAAITD-LRAIFPA  263

Query  215  PAQ  217
            P +
Sbjct  264  PVE  266

>H257_18698
Length=122

 Score = 65.1 bits (157),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query  86   EEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLN  145
            +E+ L A  H++ + + L   YGK      F+ AD C  N  +A  +GVPLVGC SH+ N
Sbjct  6    KEDNLDANSHVDLIESTLSF-YGKAASDITFITADNCPTNASIAIKLGVPLVGCYSHKFN  64

Query  146  RAVQLELADYEEELDTV  162
             A+Q  LADYE+ L  +
Sbjct  65   LAMQSYLADYEDALKAI  81

>PHYSO_247318
Length=471

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 68/149 (46%), Gaps = 11/149 (7%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            +A E P  FGL+ DGWT    HYIA++  +  DS          +         +     
Sbjct  127  VARERPASFGLVLDGWTSGGRHYIAIFAVFGSDST--------GITGGGADNEYYDDLEC  178

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
            +    + +     + EE + A+   + +A  L R Y K      F+V D CSVN+ +   
Sbjct  179  SSRRFVLLTFAPVEVEEDMGAQSQYDLIADTLSR-YNKPWIAVKFMVGDNCSVNQCIGRN  237

Query  132  MG-VPLVGCASHRLNRAVQLELADYEEEL  159
             G +P +GCASHR N AV+ +    E+EL
Sbjct  238  EGAIPFIGCASHRFNLAVK-DFLKTEDEL  265

>PPTG_19612
Length=369

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 10/93 (11%)

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDR----------SSAK  181
            M VPL+GCASHRLNRAV  +L ++ ++LD VQ LMLKL+                 +  +
Sbjct  1    MDVPLIGCASHRLNRAVAAQLKEHADDLDLVQTLMLKLRTLTQSAELRLKTSLRPITRQQ  60

Query  182  TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
            TR GSTF M+ R+F LL F+DA D+EL   +PS
Sbjct  61   TRWGSTFAMLNRFFELLPFLDADDEELAVPLPS  93

>PPTG_05214
Length=174

 Score = 66.2 bits (160),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 49/104 (47%), Gaps = 25/104 (24%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  LT+  ++ +  EMPD+FGLI DGWTH SEHY+AV+ RYE  +  ++           
Sbjct  93   MEGLTKAAEEHMGNEMPDKFGLILDGWTHESEHYLAVFSRYEARAGPIY-----------  141

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLP  104
                          PLL +A ++ D      A  H+E     LP
Sbjct  142  --------------PLLSLALIVFDAAGRFDADAHLEAFVAFLP  171

>PHYRA_87231
Length=493

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/219 (28%), Positives = 98/219 (45%), Gaps = 40/219 (18%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V+  IA  +P   G++FDGWT+ S HYI +                         +  F 
Sbjct  141  VEAKIADILPLFVGIMFDGWTNISTHYIGI-------------------------IATFM  175

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
             + V    LL  +  LN  E+  +A  H   L  +L   +GK +     ++ D C+ N+ 
Sbjct  176  ENGVYYEVLLGCSPPLN--EKSYTADEHYALLEAVL-SIFGKPITSPSVIIGDNCATNKA  232

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA--KTRGG  185
            LA LM VPL+GC  H+LN AV+  LA       T++++   + Q  N   + A  +    
Sbjct  233  LADLMKVPLIGCGCHKLNLAVKAYLARRPAIEKTIERVDKIVSQLRNLKAAGALRELTWS  292

Query  186  STFFMIMRYFYL------LEFIDAID----DELEDMMPS  214
            ST+ M+ R+  L      L+ +D I     + ++ +MPS
Sbjct  293  STYKMLHRFLRLDVQARQLDDVDTIRRADAERIKTVMPS  331

>PPTG_19620
Length=320

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 11/121 (9%)

Query  87   EEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNR  146
            ++G +A  H+E + ++L   Y K L M  FL+ D CS N+ LA+++ +PL+ CA+HRLN 
Sbjct  2    DDGQTASAHLEHMESVL-MLYNKDLSMVRFLIGDNCSTNQCLASMLKIPLISCANHRLNL  60

Query  147  AVQLELADYEEELDTVqklmlklqqklNCDRSS----------AKTRGGSTFFMIMRYFY  196
            AV   L  Y+ ++D +Q LM++L+   N    S            TR  ST+ M+ RY  
Sbjct  61   AVNRFLEGYQTQIDMIQNLMIQLRHTNNAAALSRVTHLKPIKANVTRWSSTYQMLQRYMK  120

Query  197  L  197
            +
Sbjct  121  I  121

>PHYRA_83838
Length=280

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 77/155 (50%), Gaps = 15/155 (10%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDA-  70
            +A E+P  FG++ DG T +  HYIA++         VF          A+    +  D  
Sbjct  132  VAEELPPSFGIVVDGCTFSGRHYIAIF--------PVFNDPDLCSGSPAQGGSDYYDDTD  183

Query  71   --VAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRL  128
              + +  LL +  L  D E+ L A+   + +A  L R Y +  G   F+VAD  SVN+ +
Sbjct  184  CYIRRFLLLVLCPL--DVEKDLEAQSLFDLIADTLSR-YNRPWGAVHFMVADNGSVNQYI  240

Query  129  ATLMG-VPLVGCASHRLNRAVQLELADYEEELDTV  162
             +  G + ++GCASHR+N AV   L+DYE  L  +
Sbjct  241  GSRDGAITMIGCASHRINVAVNDYLSDYETLLSKI  275

>PHYRA_74522
Length=430

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 85/209 (41%), Gaps = 21/209 (10%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V+ VIA ++PD FG+  DGW     H++A+   Y   S        P+  D  + +    
Sbjct  93   VRDVIAVKLPDLFGIALDGWLSGGRHFVAIMAVYNETSTANDGQRNPSYDDSIQCLS---  149

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                     + +A     EE  L A+   + +A  L   + K      F++ D CSVN+ 
Sbjct  150  ------RRFVLLAICPFAEEVDLGAQSLYDLIADTLA-TFNKPWSSVLFMIGDNCSVNQS  202

Query  128  LATLMG-VPLVGCASHRLNRAVQLELADYE----------EELDTVqklmlklqqklNCD  176
            +    G +P +GCASHR   AV   L D E          + L T++      +      
Sbjct  203  IGRKAGALPFIGCASHRFQPAVNDFLGDEESLLAKIHALMKHLSTIKGRSALRKVTPLAP  262

Query  177  RSSAKTRGGSTFFMIMRYFYLLEFIDAID  205
                 TR  STF ++ RY      + A+D
Sbjct  263  VMRNATRWSSTFAILERYVKPHPVLLALD  291

>PPTG_16263
Length=454

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 98/228 (43%), Gaps = 66/228 (29%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +T  V   +A  + D FGL+FDGWT  + H++ ++                      
Sbjct  99   MRHVTSQVGATVAELLGDSFGLLFDGWTCGTVHFVGIF----------------------  136

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
               G+   D V + PLL ++      E+G SA  H+E +  +L                 
Sbjct  137  ---GVSVRDGVRRQPLLSISM----AEDGQSADAHIEMIDNVLG----------------  173

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
                   +AT + VPL+GCASHR N AV   L +Y + +  VQ L ++L+   N    +A
Sbjct  174  ------AIATRLKVPLIGCASHRFNLAVCEYLTEYADLIAEVQVLCIQLRHPNNSAALAA  227

Query  181  ----------KTRGGSTFFMIMRYFYLLEFIDAID--DELEDMMPSPA  216
                       TR  ST+ M+ RY   +E  DAI     +ED++P P+
Sbjct  228  FTGLKPLKATVTRWSSTYEMLKRY---VEIRDAIKMVQAVEDLVPRPS  272

>PPTG_12513
Length=340

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 90/212 (42%), Gaps = 46/212 (22%)

Query  19   RFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLC  78
            + G   D WT    H++AV                         +G+  +D      LLC
Sbjct  51   KVGFAIDAWTEEGMHFVAV-------------------------IGVTGADKY----LLC  81

Query  79   MAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVG  138
             + L  + + G      +E L  +L   Y       CF V D  SVN  +A    VP++G
Sbjct  82   FSTLTGESDMGSDVI--IELLDDVLD-TYEIHASQLCFYVIDHASVNVAIANKTLVPMIG  138

Query  139  CASHRLNRAVQLELADYEEELDTVqklmlklqqklN------------CDRSSAKTRGGS  186
             ASHR N AVQ  + + ++ LD V  LM+KL    N              R++A  R  S
Sbjct  139  RASHRFNLAVQALMREDDDILDKVHALMVKLNTIKNRHHLREADALMPVYRNTA--RWSS  196

Query  187  TFFMIMRYFYLLEFIDAIDDELEDMMPSPAQT  218
            TF MI RYF +   +D IDD+L   +P+P + 
Sbjct  197  TFSMIDRYFRIYSKLDRIDDQLAGFIPTPREN  228

>H257_13816
Length=422

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 66/134 (49%), Gaps = 11/134 (8%)

Query  89   GLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAV  148
             LSA  H+EF   +L   YGK       L+ D CS N   A L GVP +GCA HRLN  V
Sbjct  98   SLSAAAHVEFTEFVLDL-YGKSWSNVIALIGDNCSTNVAFARLAGVPFIGCACHRLNHFV  156

Query  149  QLELADYEEELDTVqklmlklqqklNCDR----------SSAKTRGGSTFFMIMRYFYLL  198
               L +Y   +D V  LM KL+  L   R          + + TR  STF M+ RY  L 
Sbjct  157  PDMLTNYAYVIDKVNALMTKLRFTLPAARLRRVTPLRAITLSATRWSSTFNMLKRYIELK  216

Query  199  EFIDAIDDELEDMM  212
             F+ AI D+  D++
Sbjct  217  PFLWAIADDSIDVL  230

>PHYCA_117495
Length=236

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 69/133 (52%), Gaps = 12/133 (9%)

Query  92   ARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLE  151
            A  H++    +L   Y K + M  FLVAD C+ N+R+ATL+ +PLVGC SHR +      
Sbjct  7    AEVHIQMFKRVLAL-YKKDISMVAFLVADNCATNQRIATLLELPLVGCGSHRYSHVGNRC  65

Query  152  LADYEEELDTVqklmlklqqklN-------CDRSSAK---TRGGSTFFMIMRYFYLLEFI  201
            L  Y+ EL  V  LM++L+   N        DR   K   TR  S F M  RY  + + I
Sbjct  66   LVSYQTELAAVNSLMVQLRHVNNTAELAKFTDRKPVKRNITRWSSKFKMAPRYKEIRDSI  125

Query  202  DAIDDELEDMMPS  214
              + D +E+++P 
Sbjct  126  RQV-DAVEELIPK  137

>PPTG_13815
Length=148

 Score = 65.1 bits (157),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 53/90 (59%), Gaps = 7/90 (8%)

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqkl-------NCDRSSAKTRG  184
            MG PLVGCASHRLN AVQ  L+ Y+E++  +Q LM K++          N       TR 
Sbjct  1    MGAPLVGCASHRLNLAVQAHLSSYDEDVAQIQTLMRKMKTLNLAAALRFNTLLLRQDTRW  60

Query  185  GSTFFMIMRYFYLLEFIDAIDDELEDMMPS  214
            GST  M+ R F+L EF+   DDE  D+MPS
Sbjct  61   GSTDRMVERCFWLSEFLPDDDDETADIMPS  90

>PPTG_04988
Length=97

 Score = 63.2 bits (152),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 52/110 (47%), Gaps = 28/110 (25%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M S+T+  ++ IA EMPD+FGL+ DGW+H +EHY+ V+  YE  S   +           
Sbjct  1    MESVTKAGEKKIADEMPDKFGLLLDGWSHGTEHYLGVFACYETPSGPQY-----------  49

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLP---RDY  107
                          PLL +A ++ D      A  HM  LA  LP   R+Y
Sbjct  50   --------------PLLSLAPIVVDSAGRFDAETHMAALAAFLPFLERNY  85

>H257_03266
Length=369

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 72/159 (45%), Gaps = 30/159 (19%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  +TR V+  IAAE+PD FG+  DGWT  S+H+ A++  Y V +               
Sbjct  155  MDKVTRNVEAKIAAELPDVFGICSDGWTDGSKHFCAIFATYGVAN---------------  199

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                      V  TPLL M+ LL  + + +    ++ F+   L   YGK+L    F+  D
Sbjct  200  ----------VRHTPLLAMSPLL--KPDSMDTDAYIAFIEETLGL-YGKELANLAFVTGD  246

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEEL  159
             C  N  +A   G P +   S  L  A++  L  YE ++
Sbjct  247  NCFTNVSMAAKTGAPRMPSWSSNL--ALKAFLVPYESDM  283

>PHYCA_126516
Length=159

 Score = 64.3 bits (155),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 4/49 (8%)

Query  114  CCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            C FLV D CSVN+RLA L+GVPL+GCASHRLN AV+    DY E  D +
Sbjct  98   CIFLVGDNCSVNKRLANLLGVPLIGCASHRLNLAVR----DYLEPHDNI  142

 Score = 53.9 bits (128),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)

Query  8   VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVF  49
           ++ V+ A MP+ FGLI DGWTH +EHY+AVY  +E  S + +
Sbjct  45  LRWVLGASMPEHFGLILDGWTHKTEHYMAVYGCFETASRSQY  86

>PHYRA_73997
Length=446

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 96/218 (44%), Gaps = 62/218 (28%)

Query  9    KQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSS  68
            ++ IAA +P  FG+++DGW   +EH++A Y+ +  D             D+   V L   
Sbjct  95   ERAIAAIIPSIFGVMYDGWLCFAEHFVATYIVFWRD-------------DQLHCVLL---  138

Query  69   DAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRL  128
               A TPL         +E   +A  H+ F+  +L                         
Sbjct  139  ---AMTPL---------DEADQTAASHVTFIRNIL-----------------------LT  163

Query  129  ATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklN-----CDRSSAK--  181
            AT+  +PLVGCASHR N A +  LA++E+ +  V  L+  L+   N     C    A   
Sbjct  164  ATMFDIPLVGCASHRFNLATERYLAEHEDLIGAVAALVAALRTPKNRAELRCHTPLAPLR  223

Query  182  ---TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
               TR  STF M+ RY  + + I  + D ++D++P PA
Sbjct  224  ANATRWSSTFMMLERYVRIRDAIKHV-DAVDDLVPKPA  260

>PHYCA_106819
Length=109

 Score = 62.8 bits (151),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 61/135 (45%), Gaps = 28/135 (21%)

Query  23   IFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHL  82
            +FDGW+  S HYI V                         +  F  +   +  LL  +  
Sbjct  1    MFDGWSDGSTHYIGV-------------------------IATFMKEGKYREVLLGCSPP  35

Query  83   LNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASH  142
            LN++E   +A  H   L  +L   YGK +     L+ D CS NR LA  MG+PL+GC  H
Sbjct  36   LNEKE--YTADEHYALLKFVL-SIYGKAVESPSVLIGDNCSTNRALANKMGIPLIGCGCH  92

Query  143  RLNRAVQLELADYEE  157
             LN AV+  LA +E+
Sbjct  93   ILNLAVKAFLARHED  107

>PHYRA_86021
Length=367

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 96/218 (44%), Gaps = 62/218 (28%)

Query  9    KQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSS  68
            ++ IAA +P  FG+++DGW   +EH++A Y+ +  D             D+   V L   
Sbjct  95   ERAIAAIIPSIFGVMYDGWLCFAEHFVATYIVFWRD-------------DQLHCVLL---  138

Query  69   DAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRL  128
               A TPL         +E   +A  H+ F+  +L                         
Sbjct  139  ---AMTPL---------DEADQTAASHVTFIRNIL-----------------------LT  163

Query  129  ATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklN-----CDRSSAK--  181
            AT+  +PLVGCASHR N A +  LA++E+ +  V  L+  L+   N     C    A   
Sbjct  164  ATMFDIPLVGCASHRFNLATERYLAEHEDLIGAVAALVAALRTPKNRAELRCHTPLAPLR  223

Query  182  ---TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
               TR  STF M+ RY  + + I  + D ++D++P PA
Sbjct  224  ANATRWSSTFMMLERYVRIRDAIKHV-DAVDDLVPKPA  260

>H257_19348
Length=110

 Score = 62.0 bits (149),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 2/94 (2%)

Query  69   DAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRL  128
            D V    LL +  ++++ ++  SA+ H   + + L   Y K +  C F V D C VN+ L
Sbjct  2    DGVHVQQLLSLTTIIHEPDDDHSAKTHYTAIKSFLAL-YKKAIKQCVFFVGDNCGVNK-L  59

Query  129  ATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            A LM V L+GCASHRLN AV+    ++ +EL  +
Sbjct  60   AALMSVSLIGCASHRLNLAVKAYTQEHVDELAKI  93

>PPTG_01499
Length=504

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 96/226 (42%), Gaps = 40/226 (18%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            M  L   V+  I AEM  ++G ++D  T   E+Y+A+Y  Y  D                
Sbjct  29   MTLLVAAVEAKITAEMSGQYGYLYDASTFYLENYVALYAVYCYDEQL-------------  75

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                        +  LL +A +   EE  L+ + +  F+  +    +  +  M  FL+ D
Sbjct  76   ------------RQVLLAIAPM---EEGDLTVQSNCSFIKKICEIFHLSESNMA-FLIGD  119

Query  121  ICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSA  180
             CS N+  AT + VPL+GCASHR N AV   L  Y+ E++ V  L+  L+   +      
Sbjct  120  NCSTNQATATRLDVPLIGCASHRFNLAVNAYLESYKAEIEAVSALVAALRTVNSRAALRE  179

Query  181  KT----------RGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
             T          R  STF M+ R+    + I  ++    D++P  A
Sbjct  180  HTPLLPLRPNVMRWSSTFEMVARFVRFRDDIKHVESVF-DLIPKAA  224

>PHYSO_498673
Length=368

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 81/197 (41%), Gaps = 20/197 (10%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            +A E+P  FGL+ DGWT    HYIA++     DS          +         +     
Sbjct  30   VARELPASFGLVLDGWTSGGRHYIAIFAVCGSDST--------GITGGGADNEYYDDLEC  81

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
            +    L +     + EE + A+   + +A   P  Y K      F+V D CS+N+ +   
Sbjct  82   SSRRFLLLTFAPVEVEENMGAQSQYDLIADT-PSRYNKPWSAVKFMVGDNCSMNQCIGRK  140

Query  132  MG-VPLVGCASHRLNRAVQLELADYEE----------ELDTVqklmlklqqklNCDRSSA  180
             G +P + CASHR N AV+  L   +E          +L T++   L  +          
Sbjct  141  EGAIPFIECASHRFNLAVKDFLKTEDELIAKVHALMTKLRTIKGRALLRRVSHLSPLLRN  200

Query  181  KTRGGSTFFMIMRYFYL  197
             TR  ST+ M+ RY  L
Sbjct  201  DTRWSSTYEMVARYVKL  217

>PHYCA_101734
Length=250

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 61/113 (54%), Gaps = 13/113 (12%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            Y K   M  F+V D C+ NR  A  + VPLVGCAS+RLN AVQ  L  YE+ELD +  LM
Sbjct  8    YNKTTSMILFVVGDNCTKNRSSANKLSVPLVGCASNRLNLAVQAYLKQYEQELDELNALM  67

Query  167  lklqqklN-------CDRSSAK---TRGGSTFFMIMRYFYL---LEFIDAIDD  206
            ++L+   N        D    K   TR  ST  M+ RY  +   +  ++A++D
Sbjct  68   VQLRHPNNSAELAKFTDLRPIKRNVTRWSSTREMVSRYIEIRGDIRKVEAVED  120

>SDRG_14117
Length=335

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 11/126 (9%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            + K +    F+V D C+ N+ +A  + +PLVGCASHRLN AVQ  L  +E  + T+  LM
Sbjct  10   FNKTIDNVGFIVGDNCATNKAVADHLHIPLVGCASHRLNLAVQAYLQQHEHLIQTIHVLM  69

Query  167  lklqqklN----------CDRSSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            ++L+   N            +    TR  STF M+ R+  + + +  + D + D++PSP 
Sbjct  70   VRLKTNKNRGYLRQHTHLAPKVQNATRWTSTFTMLERFMAIKDHLPFLRD-VVDLIPSPG  128

Query  217  QTAVCE  222
                 E
Sbjct  129  AVVKVE  134

>SDRG_11436
Length=335

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 11/126 (9%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklm  166
            + K +    F+V D C+ N+ +A  + +PLVGCASHRLN AVQ  L  +E  + T+  LM
Sbjct  10   FNKTIDNVGFIVGDNCATNKAVADHLHIPLVGCASHRLNLAVQAYLQQHEHLIQTIHVLM  69

Query  167  lklqqklN----------CDRSSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            ++L+   N            +    TR  STF M+ R+  + + +  + D + D++PSP 
Sbjct  70   VRLKTNKNRGYLRQHTHLAPKVQNATRWTSTFTMLERFMAIKDHLPFLRD-VVDLIPSPG  128

Query  217  QTAVCE  222
                 E
Sbjct  129  AVVKVE  134

>PHYCA_104645
Length=61

 Score = 60.1 bits (144),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 34/53 (64%), Gaps = 0/53 (0%)

Query  107  YGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEEL  159
            Y K   M  FLV D CS N+ +AT MGVPLVGCASHR N AV   LA +E  L
Sbjct  9    YNKTEDMVGFLVGDNCSTNQSIATKMGVPLVGCASHRFNLAVGKYLAPHEALL  61

>PHYSO_335595
Length=474

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 94/218 (43%), Gaps = 51/218 (23%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEA  60
            + + T+ V++ IA+ MP  FG++F GWT   EHY+AV   + ++    +  +  A  DEA
Sbjct  105  LAATTKAVEKAIASVMPPDFGVMFHGWTCFGEHYVAVIAVFWLNGEVHYVVLAVAPLDEA  164

Query  61   KTVGLFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVAD  120
                                          +A  +  F   +L   +G  +    FL  D
Sbjct  165  DQ----------------------------TAESYCAFTRNIL-GSFGLSVEALKFLCGD  195

Query  121  ICSVNRRLATLMGVPLV--GCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRS  178
             C+ N+R ATL+GVPL   G A+H  NRA   EL  +                     R+
Sbjct  196  NCATNQRTATLLGVPLRADGGAAHPKNRA---ELRRHTGLAPL---------------RA  237

Query  179  SAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            +A TR  STF M+ RY  + + I  + D + D++P  A
Sbjct  238  NA-TRWSSTFTMLERYVLIRDEIKRV-DAMYDLVPKSA  273

>PPTG_21829
Length=127

 Score = 61.6 bits (148),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 26/114 (23%)

Query  14   AEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAK  73
             E+P +FGL+ DGW H +EH++A++  Y++                             +
Sbjct  39   TEIPGKFGLMLDGWGHETEHFLALFACYDITGG-------------------------PR  73

Query  74   TPLLCMAHLLNDEEEGLSARGHMEFLATMLP-RDYGKQLGMCCFLVADICSVNR  126
             PLL MA ++++ ++ L+A GH   +   LP   +G  L  C F+V D CSVN+
Sbjct  74   YPLLSMAPVIDELDDQLNAEGHKVTIERFLPFFFFGNSLINCMFIVDDNCSVNK  127

>PPTG_18402
Length=255

 Score = 62.8 bits (151),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 54/95 (57%), Gaps = 10/95 (11%)

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDR----------SSAK  181
            MGVPLVGCASHR N A++  LA YE +L  VQ+LM KL+      +             +
Sbjct  1    MGVPLVGCASHRWNLALKAFLAPYEADLCVVQRLMKKLKTLSEGAKLRLVTPLRPVLRQE  60

Query  182  TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPA  216
            TR GST  M+ RYF    F+   DDEL + +PSPA
Sbjct  61   TRWGSTHAMLRRYFEFRGFLSMDDDELAEFLPSPA  95

>PHYCA_79151
Length=165

 Score = 60.8 bits (146),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)

Query  116  FLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTV  162
            F+V D C+VN+RLA LMGVPLV CA HRLN AV+  LA +E+ L  V
Sbjct  108  FIVGDNCAVNKRLANLMGVPLVSCAGHRLNLAVRKYLAPHEDALAEV  154

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  16   MPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVF  49
            MP  FGL+ DGWTH +EH++AVY  YE      F
Sbjct  68   MPKSFGLVIDGWTHGTEHFLAVYTCYESSDGPRF  101

>PHYCA_112762
Length=224

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 54/91 (59%), Gaps = 5/91 (5%)

Query  116  FLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNC  175
             LV D C+VN+RLA LM VPLVGCASHRLN AV+  L  +E+ L+ VQ LM KL+     
Sbjct  3    LLVGDNCAVNKRLANLMEVPLVGCASHRLNLAVRDFLRPHEDTLEEVQLLMRKLRTLNQA  62

Query  176  DRSSAK-----TRGGSTFFMIMRYFYLLEFI  201
             +         TR  STF M+ RY   +E I
Sbjct  63   AKLRYANFVIYTRWSSTFTMLDRYLRCVESI  93

>PHYSO_501688
Length=333

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 9/152 (6%)

Query  12   IAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAV  71
            +  E+P  FG++ DG T +  HYIA++  +    N    C    V+    T     +D  
Sbjct  112  VTEELPPTFGIVLDGSTFSGRHYIAIFAVF----NDPGMCHGTEVR--GGTDYYDDTDCY  165

Query  72   AKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATL  131
             +  +L     L D EE L A+   + +A  L R Y        F+V D C+VN+ + + 
Sbjct  166  TRRFVLLACCPL-DVEEDLGAQSLFDLIADTLTR-YNMPWEAVHFIVTDNCNVNQYIGSR  223

Query  132  MG-VPLVGCASHRLNRAVQLELADYEEELDTV  162
             G +P+VGCASH  N AV   L DYE  L  +
Sbjct  224  KGALPMVGCASHMFNLAVSDYLPDYETLLAKI  255

>PHYCA_130457
Length=148

 Score = 59.7 bits (143),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (56%), Gaps = 11/111 (10%)

Query  113  MCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqk  172
            M  ++V D C+ N+ +AT +GV L+GCASHR N AV   L DY+ ++D +Q LM++L+  
Sbjct  1    MVSYVVGDNCTTNQSMATRIGVRLIGCASHRFNLAVNRFLRDYQTQIDMIQNLMIQLRHV  60

Query  173  lNCDR----------SSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMP  213
             N              +  TR  STF M+ RY  + + I  + + +E+ +P
Sbjct  61   KNATALAKATNYKPVKANTTRWSSTFQMVDRYCKIRDAILTV-EAVEEFVP  110

>PPTG_12207
Length=171

 Score = 60.1 bits (144),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 11/103 (11%)

Query  132  MGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------  181
            M VPLVGCASHRLN A++  LA ++  L  VQ LM KL+      +   K          
Sbjct  1    MAVPLVGCASHRLNLAMREYLAPHKNTLAEVQALMRKLRTLKQAAKLRKKTALQPVLRQD  60

Query  182  TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPS-PAQTAVCEL  223
            TR  STF M+ RYF L E     D++LED++PS     ++C+L
Sbjct  61   TRWSSTFTMLARYFRLYEHHSPDDEDLEDLIPSRTTHRSLCKL  103

>PHYCA_59074
Length=84

 Score = 57.4 bits (137),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query  95   HMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELAD  154
            H++FL  +LP  + + +    +LV D C+ N  L+ L+ +PLVGCASHRLN AVQ  +A 
Sbjct  1    HVKFLKGVLPF-FNRDITSVIYLVGDNCAGNTWLSDLLSIPLVGCASHRLNLAVQECIAK  59

Query  155  YEEELDTV  162
            Y+  L  +
Sbjct  60   YDSLLPKI  67

>PHYSO_505306
Length=286

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 74/145 (51%), Gaps = 18/145 (12%)

Query  82   LLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCAS  141
            LL D ++  ++  H++    +L   Y     M  FLV D C+  + + T MG+PLVGCAS
Sbjct  3    LLEDGDQ--TSDAHIKLFKNILDV-YDMTSDMVGFLVGDDCATKQSIVTKMGIPLVGCAS  59

Query  142  HRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------------TRGGSTFF  189
            HR N AV      Y + LD V  LM++L+ + N  R+  K            TR  STF 
Sbjct  60   HRFNLAVNKFTEPYGDLLDEVNSLMVELRHENN--RAELKKYTDLVPIKRNVTRWSSTFT  117

Query  190  MIMRYFYLLEFIDAIDDELEDMMPS  214
            M+ RY  +   I  + + +E+M+P+
Sbjct  118  MVERYIRIRAEIKTV-NAVEEMVPT  141

>H257_07778
Length=510

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/233 (26%), Positives = 94/233 (40%), Gaps = 42/233 (18%)

Query  6    RPVKQVIAAEMPDR-FGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVG  64
            R V+  +AA + +  F ++FDGWT  S H++ ++        TV     P      K + 
Sbjct  109  RAVETRVAANLDNTPFAVVFDGWTENSHHFVGLFA-------TV-----PTAMSYDKMLL  156

Query  65   LFSSDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSV  124
             F        PLL        +E  ++A  H  F       D+ K       L+ D C+ 
Sbjct  157  SFE-------PLL--------DETSMTAEKHKTFTLQQYMLDHTKVESGLVALIGDNCAT  201

Query  125  NRRLATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCD--------  176
            N  LA L+  PLVGC+SHRLN  V+  L +   ++  +   +  ++              
Sbjct  202  NVALARLIFRPLVGCSSHRLNLGVEKYLKNELNKVQAIMVKLRNVKASGQLRLTTMLRPV  261

Query  177  -RSSAKTRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQ-----TAVCEL  223
             R+  +  G ST       F  L+ ID  D     +MP+  +     +AV EL
Sbjct  262  LRNETRWTGASTMLNRFVKFMSLKAIDHTDTMYAALMPTHLELLRIDSAVAEL  314

>PPTG_09982
Length=437

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 95/220 (43%), Gaps = 53/220 (24%)

Query  8    VKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFS  67
            V + +  E+   FGL+FDGW+HA  HY+  Y  YE D                       
Sbjct  36   VGRKLEKELGALFGLMFDGWSHAGVHYVGRYAVYEADGEV--------------------  75

Query  68   SDAVAKTPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRR  127
                 + PLL ++ L++  +   +A  H++    +L  D  KQ         D   V+  
Sbjct  76   -----RVPLLGLSPLMDGVQ---TADAHIQMFNNIL--DVYKQ---------DRGYVD--  114

Query  128  LATLMGVPLVGCASHRLNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK------  181
                 GVPLV CASH  N AV   +A +E  L  V  LM++L+++ N             
Sbjct  115  -GDQDGVPLVSCASHLFNLAVGKYIAPHEAWLTEVHDLMVELRKENNLAELKKHTELLPV  173

Query  182  ----TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSPAQ  217
                TR  STF M+ RY  + + I  + D +E+++P+  +
Sbjct  174  KRNVTRWSSTFAMVERYVRIRQDIKKV-DAVEELIPTDGK  212

>H257_01990
Length=145

 Score = 58.5 bits (140),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 63/122 (52%), Gaps = 19/122 (16%)

Query  96   MEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLELADY  155
            ME+L  +L   Y +   +  FLVA  CS NR+++  M VPLVGCASHRLN AV+  ++ +
Sbjct  1    MEYLDVILGL-YNRTTAVVSFLVAGNCSFNRKMSRDMMVPLVGCASHRLNLAVRKMVSTH  59

Query  156  EEELDTVqklmlklqqklNCDRSSA----------------KTRGGSTFFMIMRYFYLLE  199
             +  D +QK+   +    N + S A                 TR  ST+ M+  YF LL 
Sbjct  60   FD--DVIQKVQTLMVALTNLNNSVAFRRLTAPRVLLPKLQNVTRWSSTYSMLELYFLLLP  117

Query  200  FI  201
            ++
Sbjct  118  YL  119

>PPTG_14199
Length=429

 Score = 60.8 bits (146),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 63/140 (45%), Gaps = 29/140 (21%)

Query  14   AEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAK  73
            A+ P  FG++ DGWT  S HYI V   Y                          +D   +
Sbjct  96   ADPPRCFGIMMDGWTDVSTHYICVIATY------------------------MENDTYRE  131

Query  74   TPLLCMAHLLNDEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMG  133
              L C   L    E+  +A  + E L  +L   YGK +     ++ + C+ N+ LA ++G
Sbjct  132  VLLGCSTPL---NEKHYTAEEYYELLEFVL-SIYGKSIPSPSVIINN-CATNKSLAEMVG  186

Query  134  VPLVGCASHRLNRAVQLELA  153
            VPL+GC  H+LN AV+  LA
Sbjct  187  VPLIGCGCHKLNLAVKTLLA  206

>PHYRA_80859
Length=161

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 66/133 (50%), Gaps = 12/133 (9%)

Query  92   ARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNRAVQLE  151
            A  HM+    +L   Y K   M  F+V D CS NR +AT M  PLV CASHR N A+   
Sbjct  2    ADDHMQLFENILDV-YNKTKDMVGFMVGDNCSTNRLIATKMDAPLVMCASHRFNLAMTKY  60

Query  152  LADYEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTFFMIMRYFYLLEFI  201
            LA +E  L+ V  LM+ L+ + N                 TR  STF M+     +   I
Sbjct  61   LAPHETILEAVNDLMVALRHENNFAELKKNTELLPVKRTVTRWASTFTMVQCCIRIRPEI  120

Query  202  DAIDDELEDMMPS  214
            + ++D +E+++P+
Sbjct  121  NKVED-VEELIPT  132

>PHYCA_120718
Length=101

 Score = 56.6 bits (135),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query  87   EEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMGVPLVGCASHRLNR  146
            E+G SA  H+E +  +L   Y     M  F+V D C  N+ +AT + VPL+GCASHR N 
Sbjct  3    EDGQSADAHIEMIDNVLGV-YETNREMLRFVVGDNCPTNKAIATRIKVPLIGCASHRFNL  61

Query  147  AVQLELADYEE  157
            AV   L +YE+
Sbjct  62   AVCEYLTEYED  72

>H257_14757
Length=288

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 92/214 (43%), Gaps = 43/214 (20%)

Query  20   FGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCM  79
            + ++FDGW++ S H++ ++V               ++ +  K  G      +A  P+L  
Sbjct  6    YSIVFDGWSNDSTHFLGMFV---------------SLPNVCKGGGEPVMWLLAFAPML--  48

Query  80   AHLLNDEEEGLSARGHMEFLATMLPRDYGK-----QLGMCCFLVADICSVNRRLATLMGV  134
                  +E    A  H EF+   L + YG+     +    C L+ D CS N+  A L   
Sbjct  49   ------DETSFDAATHYEFILETL-KWYGQSDASIEKWFVC-LIGDNCSTNKATANLFSR  100

Query  135  PLVGCASHRLNRAV-QLELADYEEELDTVqklmlklqqklNCD------------RSSAK  181
            PL+GC SHRLN AV Q   A   + L  V  +M+KL+                  R++ +
Sbjct  101  PLIGCHSHRLNLAVDQFLKAKVSDVLSKVAAVMVKLRSLKAGGRLRLTTMLKPKLRNTTR  160

Query  182  TRGGSTFFMIMRYFYLLEFIDAIDDELEDMMPSP  215
              G  + F    Y+     ID  D E+ +++P+P
Sbjct  161  WTGAVSIFQRYIYYRDGNHIDTSDPEMSELLPTP  194

>PHYCA_105571
Length=335

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 84/192 (44%), Gaps = 20/192 (10%)

Query  25   DGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKTVGLFSSDAVAKTPLLCMAHLLN  84
            DGWT A  HY+A++  ++   +T      P   ++      F          L +A    
Sbjct  2    DGWTSAGWHYVAIFAVFD---DTSASGPTPVTGED-----YFDDLDCLSRRFLLLAFSPV  53

Query  85   DEEEGLSARGHMEFLATMLPRDYGKQLGMCCFLVADICSVNRRLATLMG-VPLVGCASHR  143
            DEEE LSA+   + +A  L   Y +       ++ D CSVN+ +    G +P +GCASHR
Sbjct  54   DEEEDLSAQSLFDLIADTLSL-YERPWDAVLCMIGDNCSVNQYIGRREGAIPFIGCASHR  112

Query  144  LNRAVQLELADYEEELDTVqklmlklqqklNCDRSSAK----------TRGGSTFFMIMR  193
             N A++  LA  E  L  V  LM  L +   C     K          TR  S++ M+ R
Sbjct  113  FNLAMRDLLAPEETALSQVHSLMKALSKLKCCAMLRKKTHLDPVARNDTRWSSSYEMVNR  172

Query  194  YFYLLEFIDAID  205
            Y  L   + ++D
Sbjct  173  YCRLEPVLRSLD  184

>PPTG_00559
Length=125

 Score = 56.6 bits (135),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)

Query  1    MGSLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDS  45
            M ++T+ VK+ I  EM + FGL+ DGWTH +EHY+A Y  YE  +
Sbjct  63   MEAVTKAVKKAIGDEMSENFGLVLDGWTHGTEHYLAFYACYETSA  107

>PPTG_20074
Length=227

 Score = 57.4 bits (137),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 48/92 (52%), Gaps = 25/92 (27%)

Query  3    SLTRPVKQVIAAEMPDRFGLIFDGWTHASEHYIAVYVRYEVDSNTVFRCMRPAVKDEAKT  62
            ++T  V +VIA ++P+RFG IFDG +HA+EH+IAV+  YEV  N   RC           
Sbjct  136  AVTHSVVRVIAEDIPERFGTIFDGCSHATEHFIAVFAWYEV--NGEIRC-----------  182

Query  63   VGLFSSDAVAKTPLLCMAHLLNDEEEGLSARG  94
                        PLL MA L+N++ +    R 
Sbjct  183  ------------PLLSMAPLVNEDTDDFVGRN  202

Lambda      K        H        a         alpha
   0.325    0.137    0.418    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11311626570

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40