Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_206291617122822811331e-158
PHYSO_5388861617122822811269e-158
PPTG_101841617122822811233e-157
PHYCA_1228181617122922911087e-155
PHYKE_108181617123023011017e-154
PHALS_051931617122822810931e-152
PYIR_170331617123222510662e-148
PYVX_146271617122922910541e-146
PYIW_177511617122422810531e-146
PYU1_G0019711617122222610391e-144
PYAR_171301617122722710357e-144
PYAP_16586161712532539813e-135
PHYRA_8473016170194321510602e-132
HYAP_07162161711942289363e-129
CCI46337161712292278544e-116
CCA17366161712282278431e-114
H310_01462161712252298343e-113
SDRG_06607161712202298161e-110
SPRG_05306161712202298152e-110
HYAP_07161161701881788035e-109
H257_00325161712402447772e-104
PYIW_2766816706413840730.74
PYIR_266328668121279731.3
PYVX_1620411207118864713.9
SPRG_1472913018450033695.8
SPRG_1477813022419031676.5
CCA201261204117991667.5
CCI503071201644391688.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_20629

Length=228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PITG_20629                                                            441     1e-158
PHYSO_538886                                                          438     9e-158
PPTG_10184                                                            437     3e-157
PHYCA_122818                                                          431     7e-155
PHYKE_10818                                                           428     7e-154
PHALS_05193                                                           425     1e-152
PYIR_17033                                                            415     2e-148
PYVX_14627                                                            410     1e-146
PYIW_17751                                                            410     1e-146
PYU1_G001971                                                          404     1e-144
PYAR_17130                                                            403     7e-144
PYAP_16586                                                            382     3e-135
PHYRA_84730                                                           412     2e-132
HYAP_07162                                                            365     3e-129
CCI46337                                                              333     4e-116
CCA17366                                                              329     1e-114
H310_01462                                                            325     3e-113
SDRG_06607                                                            318     1e-110
SPRG_05306                                                            318     2e-110
HYAP_07161                                                            313     5e-109
H257_00325                                                            303     2e-104
PYIW_27668                                                            32.7    0.74  
PYIR_26632                                                            32.7    1.3   
PYVX_16204                                                            32.0    3.9   
SPRG_14729                                                            31.2    5.8   
SPRG_14778                                                            30.4    6.5   
CCA20126                                                              30.0    7.5   
CCI50307                                                              30.8    8.0   

>PITG_20629
Length=228

 Score = 441 bits (1133),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 228/228 (100%), Positives = 228/228 (100%), Gaps = 0/228 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEI
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEI  180

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
            SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228

>PHYSO_538886
Length=228

 Score = 438 bits (1126),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 226/228 (99%), Positives = 227/228 (99%), Gaps = 0/228 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKE+
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
            SAGDMRQSLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGLSSWWTS
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228

>PPTG_10184
Length=228

 Score = 437 bits (1123),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 225/228 (99%), Positives = 226/228 (99%), Gaps = 0/228 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MF LTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH
Sbjct  1    MFALTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKE+
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
            SAGDMRQSLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGLSSWWTS
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228

>PHYCA_122818
Length=229

 Score = 431 bits (1108),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 226/229 (99%), Gaps = 1/229 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPVAPELFDADYTQVL+EE+DRKYANKVIADVGLCITLYDFVSIGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEVDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKG-IQattteatdkaeke  179
            DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKG IQATTTEATDKAEKE
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGSIQATTTEATDKAEKE  180

Query  180  ISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
             SAGDMRQSLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGLSSWWTS
Sbjct  181  TSAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  229

>PHYKE_10818
Length=230

 Score = 428 bits (1101),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 220/230 (96%), Positives = 226/230 (98%), Gaps = 2/230 (1%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPVAPELFDADYTQVL+EEIDRKYANKVI+DVGLCITLYDFVSIGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVISDVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaeke-  179
            D+AERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAE E 
Sbjct  121  DSAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAENEG  180

Query  180  -ISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
             ++AGDMRQSLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGLSSWWTS
Sbjct  181  VVTAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  230

>PHALS_05193
Length=228

 Score = 425 bits (1093),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/228 (96%), Positives = 224/228 (98%), Gaps = 0/228 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPV PELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDA VH
Sbjct  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAERLWVWKYS+GQEKF+MDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDK+EKEI
Sbjct  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
             AGDMR+SLAR+RSSSVDLSDNDPTPSAIHIL TIDEDGLGLSSWWTS
Sbjct  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228

>PYIR_17033
Length=232

 Score = 415 bits (1066),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 209/225 (93%), Positives = 218/225 (97%), Gaps = 1/225 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPV+PELFDADYT+VL+EEIDRKYANKVIADVGLCIT+YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVSPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DKA    
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTATGIQATTTEASDKAATS-  179

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSW  225
            +AGDMRQSLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGL+SW
Sbjct  180  AAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSW  224

>PYVX_14627
Length=229

 Score = 410 bits (1054),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 205/229 (90%), Positives = 217/229 (95%), Gaps = 1/229 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTR+SDVIPVAPELFDADYTQVL+EEIDRKYANKVIADVGLCITL+DFV IGDAF+H
Sbjct  1    MFVLTRLSDVIPVAPELFDADYTQVLVEEIDRKYANKVIADVGLCITLHDFVHIGDAFIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteat-dkaeke  179
            D+AERLWVWKYS+ QEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEAT  + +  
Sbjct  121  DSAERLWVWKYSDSQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKEQDGG  180

Query  180  ISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
               GDMR+SLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGL+SWW +
Sbjct  181  AKNGDMRESLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWWVN  229

>PYIW_17751
Length=224

 Score = 410 bits (1053),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 217/228 (95%), Gaps = 4/228 (2%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTR+SDVIPV PELFDADYT+VL+EEIDRKYANKV+ADVGLCIT+YDFV IGDAFVH
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVVADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DKA    
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTATGIQATTTEASDKA----  176

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
             A D+RQSLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGL+SWW +
Sbjct  177  EASDLRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWWVN  224

>PYU1_G001971
Length=222

 Score = 404 bits (1039),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/226 (90%), Positives = 211/226 (93%), Gaps = 6/226 (3%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTR+SDVIPV PELFDADYT+VL+EEIDRKYANKVIADVGLCIT+YDFV IGDAFVH
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+D      
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASD------  174

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWW  226
             A    QSLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGLSSWW
Sbjct  175  KAASEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220

>PYAR_17130
Length=227

 Score = 403 bits (1035),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 201/227 (89%), Positives = 215/227 (95%), Gaps = 0/227 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPVAP+LF+ DY +VL+EEIDRKYANKVIADVGLC+++YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFR+VVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAERLWVWKYSEG EKFYMDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK E   
Sbjct  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWT  227
            +AGDMRQSLAR RS+SVDLS++DPTPSAIHIL TIDEDGLGLSSWWT
Sbjct  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227

>PYAP_16586
Length=253

 Score = 382 bits (981),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 214/253 (85%), Gaps = 26/253 (10%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPVAP+LF+ DY +VL+EEIDRKYANKVIADVGLC+++YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCLSIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQV------------EFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDII  108
            P+DGTSHSQV            EFR+VVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDII
Sbjct  61   PADGTSHSQVKRDGSTDARGVVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDII  120

Query  109  IPSYALQTPSYFDTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAK-----  163
            IPSYA+QTPSYFDTAERLWVWKYSEG EKFYMDLHEEIRFRVT+INFTRVTKTA      
Sbjct  121  IPSYAMQTPSYFDTAERLWVWKYSEGNEKFYMDLHEEIRFRVTSINFTRVTKTAHGGWYV  180

Query  164  ---------GIQattteatdkaekeISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILAT  214
                     GIQATTTEA++K E   +AGDMRQSL R RS+SVDLSD+DPTPSAIHIL T
Sbjct  181  DADGVVGGVGIQATTTEASEKTEGTANAGDMRQSLTRGRSASVDLSDSDPTPSAIHILGT  240

Query  215  IDEDGLGLSSWWT  227
            IDEDGLGLSSWWT
Sbjct  241  IDEDGLGLSSWWT  253

>PHYRA_84730
Length=1943

 Score = 412 bits (1060),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 206/215 (96%), Positives = 213/215 (99%), Gaps = 0/215 (0%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVIPVAPELFDADYTQVL+EEIDRKYANKV+ADVGLCITLYDFVSIGDA+VH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVLADVGLCITLYDFVSIGDAYVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGR+VSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRVVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            D AERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKE+
Sbjct  121  DAAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATI  215
            SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILA +
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILARL  215

>HYAP_07162
Length=194

 Score = 365 bits (936),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 189/228 (83%), Gaps = 34/228 (15%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTR+SDVIPVAP LFDADYTQVLIEEIDRKYANKVIADVGLC+TLYDFV IGDAFVH
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHS VEFR++VFRPFVGEVLKGRIV CT+EHIRVSMDFVQDIIIPSYALQTPSY+
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkaekeI  180
            DTAE+LWVWKYS+GQEKFYMDLHEEIRFRVTNINFTRVTKTAK                 
Sbjct  121  DTAEKLWVWKYSDGQEKFYMDLHEEIRFRVTNINFTRVTKTAK-----------------  163

Query  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228
                             DLSDNDPTPSAIHIL +IDEDGLGLSSWWTS
Sbjct  164  -----------------DLSDNDPTPSAIHILGSIDEDGLGLSSWWTS  194

>CCI46337
Length=229

 Score = 333 bits (854),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 198/227 (87%), Gaps = 3/227 (1%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTRISDVI + P LFD DYT+VL EEIDRKY NKVIADVGLCI++YDF++IGDA +H
Sbjct  1    MFVLTRISDVIAIHPMLFDGDYTKVLKEEIDRKYCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PS+G SH+QVEFR++VFRPF+GEVLKG+I+SC E HIR++M+F+QDI+IPSYALQTPS+F
Sbjct  61   PSEGDSHTQVEFRMIVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdka-eke  179
            DT ERLWVW +++  EKF+MDL+EEIRFRVTN+NFT+V KTAKG+QATT+E+T+K  +  
Sbjct  121  DTYERLWVWTFTDSAEKFHMDLNEEIRFRVTNVNFTQVHKTAKGMQATTSESTEKKDKAS  180

Query  180  ISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWW  226
            +  G++     RRR SSVDLSD+DPTPSA+ IL TIDEDGLGL+SWW
Sbjct  181  LKRGNLDDK--RRRLSSVDLSDSDPTPSAMQILGTIDEDGLGLTSWW  225

>CCA17366
Length=228

 Score = 329 bits (843),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 194/227 (85%), Gaps = 3/227 (1%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVL RISDVI + P LFD DYT+VL EEID+K+ NKVIADVGLCI++YDF++IGDA +H
Sbjct  1    MFVLARISDVIAIHPMLFDGDYTRVLKEEIDKKFCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PS+G SH+QVEFR+VVFRPF+GEVLKG+I+SC E HIR++M+F+QDI+IPSYALQTPS+F
Sbjct  61   PSEGDSHTQVEFRMVVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteat-dkaeke  179
            DT ERLWVW ++E  EKF+MDL+EE+RFRVTN+NFT+V KTAKG+QATT E+T    +  
Sbjct  121  DTYERLWVWTFTESGEKFHMDLNEEVRFRVTNVNFTQVHKTAKGMQATTIESTDKDGKST  180

Query  180  ISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWW  226
            +  G++     +RR SSVDLSDNDPTPSA+ IL TIDEDGLGL+SWW
Sbjct  181  LKGGNIDDR--KRRLSSVDLSDNDPTPSAMQILGTIDEDGLGLTSWW  225

>H310_01462
Length=225

 Score = 325 bits (834),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 187/229 (82%), Gaps = 10/229 (4%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVL R++DVI VAPELF ADY+ VLIEEIDRKYANKVIADVGLCIT YDF+ IGDA+VH
Sbjct  1    MFVLCRVADVIQVAPELFSADYSSVLIEEIDRKYANKVIADVGLCITHYDFIEIGDAYVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH+ V FR+VVFRPF+GE+LKG+I++CTEEHIRVSM+F+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIINCTEEHIRVSMEFMQDIIIPSYAMQNPSFF  120

Query  121  DTAERLWVWKY---SEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkae  177
            D  ERLW WK+    + Q+ +YM L+EE+RFRVTNINFTRV KTA G+QA T  A     
Sbjct  121  DKTERLWEWKFPGREDDQDPYYMYLNEEVRFRVTNINFTRVLKTANGMQAVTEAAD----  176

Query  178  keISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWW  226
               +  D  ++  RRRSSSVDLSD DP P+A+ I+ TIDEDGLGLSSWW
Sbjct  177  ---TKPDKSENPTRRRSSSVDLSDTDPKPAALQIIGTIDEDGLGLSSWW  222

>SDRG_06607
Length=220

 Score = 318 bits (816),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 191/229 (83%), Gaps = 15/229 (7%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVL RI+DVI +APELF  DY+ VL EEIDRKYANKVIADVGLCITLYDF+ IGDA++H
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH++V FR+VVF+PF+GEVLKG+I+SCTEEHIRVSMDFVQDIIIPSYA+QTPS+F
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DTAERLWVWKY---SEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkae  177
            D  ERLW WK+    + Q+ +YM LHEEIRFRVTNINFTRVTKTAKGIQAT TEA     
Sbjct  121  DKNERLWEWKFPGKEDEQDPYYMYLHEEIRFRVTNINFTRVTKTAKGIQATVTEA-----  175

Query  178  keISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWW  226
                      + +RRRSSSVDLS++DP PSA+ I+ TIDEDGLGLSSWW
Sbjct  176  -------ADSASSRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWW  217

>SPRG_05306
Length=220

 Score = 318 bits (815),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 191/229 (83%), Gaps = 15/229 (7%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVL RI+DVI +APELF  DY+ VL EEIDRKYANKVIADVGLCITLYDF+ IGDA++H
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH++V FR+VVF+PF+GEVLKG+I+SCTEEHIRVSMDFVQDIIIPSYA+QTPS+F
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DTAERLWVWKY---SEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQattteatdkae  177
            D  ERLW WK+    + Q+ +YM LHEE+RFRVTNINFTRVTKTAKGIQAT TEA     
Sbjct  121  DKNERLWEWKFPGKEDEQDPYYMYLHEEVRFRVTNINFTRVTKTAKGIQATVTEA-----  175

Query  178  keISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWW  226
                      + +RRRSSSVDLS++DP PSA+ I+ TIDEDGLGLSSWW
Sbjct  176  -------ADSASSRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWW  217

>HYAP_07161
Length=188

 Score = 313 bits (803),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 160/178 (90%), Gaps = 14/178 (8%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVLTR+SDVIPVAP LFDADYTQVLIEEIDRKYANKVIADVGLC+TLYDFV IGDAFVH
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHS VEFR++VFRPFVGEVLKGRIV CT+EHIRVSMDFVQDIIIPSYALQTPSY+
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DTAERLWVWKYSEGQ--------------EKFYMDLHEEIRFRVTNINFTRVTKTAKG  164
            DTAE+LWVWKYS+GQ              EKFYMDLHEEIRFRVTNINFTRVTKTAKG
Sbjct  121  DTAEKLWVWKYSDGQGEGVPQTWSRCLAVEKFYMDLHEEIRFRVTNINFTRVTKTAKG  178

>H257_00325
Length=240

 Score = 303 bits (777),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 190/244 (78%), Gaps = 25/244 (10%)

Query  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
            MFVL R++DVI VAPELF +DY+ VLIEEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH+ V FR+VVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120

Query  121  DTAERLWVWKYS--EG----------------QEKFYMDLHEEIRFRVTNINFTRVTKTA  162
            D  ERLW WK+   EG                Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180

Query  163  KGIQattteatdkaekeISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGL  222
            KG+QA T           S  D  ++ +RRRSSSVDLSD+DP P+A+ I+ TIDEDGLGL
Sbjct  181  KGMQAVTDATD-------SKPDKHEAPSRRRSSSVDLSDSDPKPAALQIIGTIDEDGLGL  233

Query  223  SSWW  226
            SSWW
Sbjct  234  SSWW  237

>PYIW_27668
Length=138

 Score = 32.7 bits (73),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 26/40 (65%), Gaps = 3/40 (8%)

Query  83   EVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPS--YF  120
            E+ K    + +++H+ ++MDF Q++  PS A +TPS  YF
Sbjct  26   ELYKNEFAAVSDDHVVLTMDFAQNLTTPS-AAETPSEWYF  64

>PYIR_26632
Length=212

 Score = 32.7 bits (73),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 40/79 (51%), Gaps = 6/79 (8%)

Query  2   FVLTR-ISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60
           +VL R  S ++P    + D D+  +L+EE   + A KVI  V    T  DFV  G   V 
Sbjct  12  YVLLRSTSKIVPCESVVTDVDHPLLLLEEALSRVAMKVIEIV----TPNDFVCEGVCTVK  67

Query  61  PSDGTSHSQVEFRLV-VFR  78
            S G S S+  F L+ VFR
Sbjct  68  SSCGVSISEDGFALLQVFR  86

>PYVX_16204
Length=1188

 Score = 32.0 bits (71),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 32/64 (50%), Gaps = 5/64 (8%)

Query  10   VIPVAPELFDADYTQVLIEEIDRKYAN-KVIADVGLCITLYDFVSIGDAFVHPSDGTSHS  68
            VIPV    F+ +    LI E+   Y N   ++D    +   + V + DAF++P++G    
Sbjct  829  VIPV----FENEKRHQLIAELKALYKNLSTLSDAATAVACPELVCLYDAFMNPNEGNVSI  884

Query  69   QVEF  72
             VE+
Sbjct  885  VVEY  888

>SPRG_14729
Length=500

 Score = 31.2 bits (69),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 1/33 (3%)

Query  13  VAPELFDADY-TQVLIEEIDRKYANKVIADVGL  44
           V P+  DA +  QV +EEIDR+Y + V+A + L
Sbjct  46  VTPDALDAKHWPQVCVEEIDRRYTSIVLAALPL  78

>SPRG_14778
Length=190

 Score = 30.4 bits (67),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 1/31 (3%)

Query  15  PELFDADY-TQVLIEEIDRKYANKVIADVGL  44
           P+  DA +  QV +EEIDR+Y + V+A + L
Sbjct  62  PDALDAKHWPQVCVEEIDRRYTSTVLAALPL  92

>CCA20126
Length=179

 Score = 30.0 bits (66),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (44%), Gaps = 10/91 (11%)

Query  1   MFVLTRISDVIPVAPELFDADYTQV----LIEEIDRKYANKVIADVGLCITLYDF--VSI  54
           MF L ++S  + + P  F      +    LIEE++     K     G  IT+ +     I
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKY----GYVITVTEVRDEDI  56

Query  55  GDAFVHPSDGTSHSQVEFRLVVFRPFVGEVL  85
           G   +  + G     + +R ++FRPF  EVL
Sbjct  57  GKGVIQDNSGYVCFNIRYRAILFRPFKNEVL  87

>CCI50307
Length=443

 Score = 30.8 bits (68),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (44%), Gaps = 10/91 (11%)

Query  1    MFVLTRISDVIPVAPELFDADYTQV----LIEEIDRKYANKVIADVGLCITLYDF--VSI  54
            MF L ++S  + + P  F      +    LIEE++     K     G  IT+ +     I
Sbjct  265  MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKY----GYVITVTEVRDEDI  320

Query  55   GDAFVHPSDGTSHSQVEFRLVVFRPFVGEVL  85
            G   +  S G     + +R ++FRPF  +VL
Sbjct  321  GKGVIQDSSGYVCFNIRYRAILFRPFKNQVL  351

Lambda      K        H        a         alpha
   0.322    0.137    0.408    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11574829044

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40