Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_13745111501008100853070.0
PPTG_09255111501008100851400.0
PHYSO_560347111501010101051090.0
PHYCA_570034111501011101150930.0
PHALS_11566111501009100950370.0
HYAP_08497111501007101248670.0
PHYRA_8167811150975101448430.0
PYVX_13921111501041104346390.0
PYU1_G005966111501030103445830.0
PYIW_14752111501031103545540.0
PYIR_15175111501030103345450.0
PYAP_248831115098099641650.0
CCA179911115096599238480.0
CCI4083111150116398136720.0
SDRG_14094111501003104033870.0
H310_11729111501002104133340.0
H257_1278711150968103032980.0
SPRG_03282111501004104132950.0
PHYKE_64071115093463131080.0
PYAR_247791115069969627680.0
PYAR_2437410571032532612718e-167
PHALS_11598136771421111870.33
PYAP_13607481027038820.85
SPRG_1363913724917962800.89
SPRG_1487013028824662810.97
PYAP_197456156725108821.1
PYIR_1752579041023156821.3
PYIR_167906156744121811.8
H310_1052314050926264792.1
PYIW_1485779041013156802.5
SPRG_037106156678104792.7
PYVX_16007966009043722.7
PYAP_25178535528681773.5
CCA20583329736544773.8
H257_0392513993329062764.1
PHALS_03538929190384784.2
PYU1_G005575149159590774.3
PYU1_G00795579041018111784.3
SDRG_1014613376122043754.7
SDRG_072936156687104774.7
HYAP_07166645217632695.3
PYAP_13333503346124765.7
PYAP_21787154352046765.9
PYVX_1323979041021111766.2
H257_0504912647338136756.2
PYVX_132586156646143766.6
PYAR_20912481026641747.1
PYIR_16746503335180757.3
SPRG_1951913376114843718.5
SDRG_1211612945922674739.1
CCI42121329758244749.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_13745

Length=1008
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PITG_13745                                                            2048    0.0   
PPTG_09255                                                            1984    0.0   
PHYSO_560347                                                          1972    0.0   
PHYCA_570034                                                          1966    0.0   
PHALS_11566                                                           1944    0.0   
HYAP_08497                                                            1879    0.0   
PHYRA_81678                                                           1870    0.0   
PYVX_13921                                                            1791    0.0   
PYU1_G005966                                                          1769    0.0   
PYIW_14752                                                            1758    0.0   
PYIR_15175                                                            1755    0.0   
PYAP_24883                                                            1608    0.0   
CCA17991                                                              1486    0.0   
CCI40831                                                              1419    0.0   
SDRG_14094                                                            1309    0.0   
H310_11729                                                            1288    0.0   
H257_12787                                                            1274    0.0   
SPRG_03282                                                            1273    0.0   
PHYKE_6407                                                            1201    0.0   
PYAR_24779                                                            1070    0.0   
PYAR_24374                                                            494     8e-167
PHALS_11598                                                           38.1    0.33  
PYAP_13607                                                            36.2    0.85  
SPRG_13639                                                            35.4    0.89  
SPRG_14870                                                            35.8    0.97  
PYAP_19745                                                            36.2    1.1   
PYIR_17525                                                            36.2    1.3   
PYIR_16790                                                            35.8    1.8   
H310_10523                                                            35.0    2.1   
PYIW_14857                                                            35.4    2.5   
SPRG_03710                                                            35.0    2.7   
PYVX_16007                                                            32.3    2.7   
PYAP_25178                                                            34.3    3.5   
CCA20583                                                              34.3    3.8   
H257_03925                                                            33.9    4.1   
PHALS_03538                                                           34.7    4.2   
PYU1_G005575                                                          34.3    4.3   
PYU1_G007955                                                          34.7    4.3   
SDRG_10146                                                            33.5    4.7   
SDRG_07293                                                            34.3    4.7   
HYAP_07166                                                            31.2    5.3   
PYAP_13333                                                            33.9    5.7   
PYAP_21787                                                            33.9    5.9   
PYVX_13239                                                            33.9    6.2   
H257_05049                                                            33.5    6.2   
PYVX_13258                                                            33.9    6.6   
PYAR_20912                                                            33.1    7.1   
PYIR_16746                                                            33.5    7.3   
SPRG_19519                                                            32.0    8.5   
SDRG_12116                                                            32.7    9.1   
CCI42121                                                              33.1    9.6   

>PITG_13745
Length=1008

 Score = 2048 bits (5307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1008/1008 (100%), Positives = 1008/1008 (100%), Gaps = 0/1008 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120
             AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180

Query  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240
             RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360
             GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA
Sbjct  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGELT  540
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGELT
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGELT  540

Query  541   PRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsaal  600
             PRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAAL
Sbjct  541   PRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAAL  600

Query  601   sesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPS  660
             SESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPS
Sbjct  601   SESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPS  660

Query  661   MKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRSIE  720
             MKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRSIE
Sbjct  661   MKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRSIE  720

Query  721   EKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDDQS  780
             EKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDDQS
Sbjct  721   EKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDDQS  780

Query  781   ILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQV  840
             ILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQV
Sbjct  781   ILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQV  840

Query  841   VQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSRAVV  900
             VQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKNDTKQMKDEIAQLSSRAVV
Sbjct  841   VQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKNDTKQMKDEIAQLSSRAVV  900

Query  901   FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAG  960
             FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAG
Sbjct  901   FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAG  960

Query  961   NHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
             NHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  961   NHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008

>PPTG_09255
Length=1008

 Score = 1984 bits (5140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 985/1008 (98%), Positives = 998/1008 (99%), Gaps = 0/1008 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVD+TSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120
             AHELFVSHVVMMKRSNVLVTIGDGIDPR +ELREQSKAIAEAGR+PNAEEMYTSKP+GKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPDELREQSKAIAEAGRSPNAEEMYTSKPSGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIP+FAKKYPEEAVTAFA NDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240
             RSDLKRR DRPP LLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRADRPPHLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360
             GEKK+L FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA
Sbjct  301   GEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R+PGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGELT  540
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTK+DSDSG+LT
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKSDSDSGDLT  540

Query  541   PRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsaal  600
             PRNGA ANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAAL
Sbjct  541   PRNGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAAL  600

Query  601   sesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPS  660
             SESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPS
Sbjct  601   SESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPS  660

Query  661   MKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRSIE  720
             +KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDE E G RS+E
Sbjct  661   LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEEEGGTRSVE  720

Query  721   EKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDDQS  780
             EKEEAVLRILDNPRVKYDEDHALIHLQMHGMK+GKRYLYNKLHMYHMLVQFHIEENDDQS
Sbjct  721   EKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQS  780

Query  781   ILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQV  840
             ILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQV
Sbjct  781   ILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQV  840

Query  841   VQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSRAVV  900
             VQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFK DTKQMK+EIAQLSSRAVV
Sbjct  841   VQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSSRAVV  900

Query  901   FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAG  960
             FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAG
Sbjct  901   FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAG  960

Query  961   NHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
             NHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  961   NHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008

>PHYSO_560347
Length=1010

 Score = 1972 bits (5109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 979/1010 (97%), Positives = 994/1010 (98%), Gaps = 2/1010 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVD+TSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120
             AHELFVSHVVMMKRSNVLVTIGDGIDPR EELREQSKAIAEAGR PNAEEMYTSKP GKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIP+FAKKYPEEAVTAFA NDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240
             +SDLKRR DRPPQLLQPAGQYPVTGL+FTSKPVTATV+HVFLYASTRRGLTCYHCSHDDP
Sbjct  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360
             GEKK+LRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLA NA
Sbjct  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360

Query  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R PGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGELT  540
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTK  SDSG+LT
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGDLT  540

Query  541   PRNG--AVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsa  598
             PRNG  A ANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS 
Sbjct  541   PRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSV  600

Query  599   alsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGN  658
             ALS+SEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMP PTTELLKRLCTGKFVPGN
Sbjct  601   ALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGN  660

Query  659   PSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRS  718
             PS+KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG RS
Sbjct  661   PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARS  720

Query  719   IEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDD  778
             +EEKEEAVLRILDNPRVKYDEDHALIHLQMHGMK+GKRYLYNKLHMYHMLVQFHIEENDD
Sbjct  721   VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD  780

Query  779   QSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPL  838
             QSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT GEEWKELKQLLALIDTNPAIPPL
Sbjct  781   QSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPL  840

Query  839   QVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSRA  898
             QVVQVLSQSRELPVSVIKQYVVNQLA+DEKKIEEDEEKIKAFK+DTKQMK+EIAQLSSRA
Sbjct  841   QVVQVLSQSRELPVSVIKQYVVNQLANDEKKIEEDEEKIKAFKSDTKQMKEEIAQLSSRA  900

Query  899   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  958
             VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK
Sbjct  901   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  960

Query  959   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
             AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  961   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010

>PHYCA_570034
Length=1011

 Score = 1966 bits (5093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 980/1011 (97%), Positives = 995/1011 (98%), Gaps = 3/1011 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVD+TSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120
             AHELFVSHVVMMKRSNVLVTIGDGIDPR EELREQSKAIAEAGR PNAEEMYTSKP GKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPEELREQSKAIAEAGRTPNAEEMYTSKPTGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFA NDDL+QFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLTQFAVGLKNGAVILF  180

Query  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240
             RSDLKRRTDRPP LLQPAGQYPVTGLSF SKPVTATVSHVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRTDRPPHLLQPAGQYPVTGLSFASKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVD+NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDVNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360
             GEK++L FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA
Sbjct  301   GEKRYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R+PGARFGLDEMEEVRHVVCEFGAIFVVSSMGH+YRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHIYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK--TKTDSDSGE  538
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK  TK+ SDSG+
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKNGTKSGSDSGD  540

Query  539   LTPRN-GAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdseds  597
             LTPRN GA ANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS
Sbjct  541   LTPRNGGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS  600

Query  598   aalsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPG  657
             AALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTH+P PTTELLKRLCTGKFVPG
Sbjct  601   AALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHLPGPTTELLKRLCTGKFVPG  660

Query  658   NPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKR  717
             NPS+KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDD+GENG R
Sbjct  661   NPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDDGENGTR  720

Query  718   SIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEEND  777
             S+EEKEEAVLRILDNPRVKYDEDHALIHLQMHGMK+GKRYLYNKLHMYHMLVQFHIEEND
Sbjct  721   SVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEEND  780

Query  778   DQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPP  837
             DQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPP
Sbjct  781   DQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPP  840

Query  838   LQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSR  897
             LQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFK DTKQMK+EI QLSSR
Sbjct  841   LQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEITQLSSR  900

Query  898   AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQ  957
             AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQ
Sbjct  901   AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQ  960

Query  958   KAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
             KAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  961   KAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1011

>PHALS_11566
Length=1009

 Score = 1944 bits (5037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 951/1009 (94%), Positives = 984/1009 (98%), Gaps = 1/1009 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVD+TSMSANRGLICVGDADG V+LANRS+EARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGSVYLANRSMEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120
             AHE+FVSHVVMMKRSNVLVTIGDGIDPR EELREQSK IAEAGRAPNAE+MYT+KP GKS
Sbjct  61    AHEMFVSHVVMMKRSNVLVTIGDGIDPRSEELREQSKVIAEAGRAPNAEDMYTAKPTGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180
             TA+VRFWRTDQQDREGKPKL+QQIPIFAKKYPEEAVTAFA NDDLSQFAVGLKNGAVILF
Sbjct  121   TAIVRFWRTDQQDREGKPKLMQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240
             RSDLKRR DRPP LLQPAGQYPVTGL+FTSKPVT T+SHVFLYAST RGLTCYHCSHDDP
Sbjct  181   RSDLKRRADRPPHLLQPAGQYPVTGLAFTSKPVTVTLSHVFLYASTGRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGV+MNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVEMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360
             GEKKF+ FFKHYL+VAHVDPRGRHQVNVYDLQNKFIAFNWTLTST+ KGP+RK PL+ NA
Sbjct  301   GEKKFVCFFKHYLIVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTSSKGPIRKAPLSLNA  360

Query  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R+PGARFG+DEMEE+RHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGIDEMEEIRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGELT  540
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDV+KLDKFIQLDEVIDAKKTKTD +SG+L 
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVQKLDKFIQLDEVIDAKKTKTDRNSGDLM  540

Query  541   PRN-GAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsaa  599
              RN GA ANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAA
Sbjct  541   LRNGGATANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAA  600

Query  600   lsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNP  659
             LSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVP NP
Sbjct  601   LSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPSNP  660

Query  660   SMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRSI  719
             S+KSDPGDFLHLFVSHRAQLKEFLQYIVEVET+SNTSIGNTLLEMVLSDDDEGENG RS+
Sbjct  661   SLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETISNTSIGNTLLEMVLSDDDEGENGLRSV  720

Query  720   EEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDDQ  779
             EEKE+AVLRILDNPRVKYDEDHALIHLQMH MK+GKRYLYNKLHMYHMLVQFHIEE+DDQ
Sbjct  721   EEKEDAVLRILDNPRVKYDEDHALIHLQMHSMKKGKRYLYNKLHMYHMLVQFHIEESDDQ  780

Query  780   SILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQ  839
             SILEEVRKHGEKDPNLWSLALKYFAERGPLPKGA  GEEWKELKQLL LIDTNPAIPPLQ
Sbjct  781   SILEEVRKHGEKDPNLWSLALKYFAERGPLPKGAIDGEEWKELKQLLVLIDTNPAIPPLQ  840

Query  840   VVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSRAV  899
             VVQVLSQSRELPVSVIKQYVV+QLA+DEKKIEEDEEKIKAFK+DTKQMKDEIAQLSSRAV
Sbjct  841   VVQVLSQSRELPVSVIKQYVVSQLANDEKKIEEDEEKIKAFKSDTKQMKDEIAQLSSRAV  900

Query  900   VFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKA  959
             VFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDREC+TCSMDHRHILGLK+QLEQKA
Sbjct  901   VFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECLTCSMDHRHILGLKSQLEQKA  960

Query  960   GNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
             GNHEQFYNQLETA DGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  961   GNHEQFYNQLETAVDGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1009

>HYAP_08497
Length=1007

 Score = 1879 bits (4867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 940/1012 (93%), Positives = 971/1012 (96%), Gaps = 9/1012 (1%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVD+TSMSANRGLICVGDADG+VHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120
             AHELFVSHVVMMKRSNVL TIGDGIDPR +ELREQSKAIAEAGRAPNAEE     P GKS
Sbjct  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEE-----PTGKS  115

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTD QDREGKPKLLQQIPIFAKKYPEEAVTAFA NDDLSQFAVGLKNGAVILF
Sbjct  116   TAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  175

Query  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240
             RSDLKRRTDRP  LLQPAGQYPVTGLSF SKPVTAT  HVFLYASTRRGLTCYHCSHDDP
Sbjct  176   RSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDP  235

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKS GGAAALPPRTTVLDERGVD+NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FE
Sbjct  236   ALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFE  295

Query  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360
             GEKK+L FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASN+
Sbjct  296   GEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNS  355

Query  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R+  ARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  356   RTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  415

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  416   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  475

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT---KTDSDSG  537
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT   K D+D+ 
Sbjct  476   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDAS  535

Query  538   ELTPRNGA-VANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsed  596
             +L  ++G   ANLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSED
Sbjct  536   DLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVDSED  595

Query  597   saalsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVP  656
             SAALSESEKERVADALEYI+HLSFSEADSNLRKYGRTLVTHMP P TELLKRLCTGK+VP
Sbjct  596   SAALSESEKERVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVP  655

Query  657   GNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGK  716
              +PS+KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG 
Sbjct  656   EDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGG  715

Query  717   RSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEEN  776
             RS+EEKEE+VLRILDNPRVKYDEDHALIHLQM GMK+GKRYLYNKLHMYHMLVQFHIEEN
Sbjct  716   RSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEEN  775

Query  777   DDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIP  836
             DDQSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT G+EW+EL+QLL LIDTN AIP
Sbjct  776   DDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIP  835

Query  837   PLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSS  896
             PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAF++DTKQMK+EIAQLSS
Sbjct  836   PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFRSDTKQMKEEIAQLSS  895

Query  897   RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLE  956
             RAVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDRECI+CSMDHRHILGLKTQLE
Sbjct  896   RAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLE  955

Query  957   QKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
             QKAGNHEQFYNQLETAADGF+TIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  956   QKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007

>PHYRA_81678
Length=975

 Score = 1870 bits (4843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 941/1014 (93%), Positives = 956/1014 (94%), Gaps = 45/1014 (4%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDA+GPWMKGVD+TSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDASGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120
             AHELFVSHVVMM                                       YTSKP GK+
Sbjct  61    AHELFVSHVVMM---------------------------------------YTSKPTGKT  81

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIP+FAKKYPEEAVTAFA NDDLSQFAVGLKNGAVILF
Sbjct  82    TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  141

Query  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240
             RSDLKRRTDRPP LLQPAGQYPVTGL FTSKPVTATV+HVFLYASTRRGLTCYHCSHDDP
Sbjct  142   RSDLKRRTDRPPHLLQPAGQYPVTGLEFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  201

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  202   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  261

Query  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360
             GEKK+LRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA
Sbjct  262   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  321

Query  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R+PGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  322   RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  381

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGD+DGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  382   LAFSSNYDVNSIIDIFRMYGDHLYQKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  441

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK---TKTDSDSG  537
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDA+K   TK+ SDSG
Sbjct  442   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDARKANGTKSGSDSG  501

Query  538   ELTPRNG---AVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVds  594
             + TPRNG   A ANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDS
Sbjct  502   DTTPRNGGGGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDS  561

Query  595   edsaalsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKF  654
             EDS ALSE+EKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMP PTTELLKRLCTGKF
Sbjct  562   EDSVALSENEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKF  621

Query  655   VPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGEN  714
             VPGNPS+KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGEN
Sbjct  622   VPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGEN  681

Query  715   GKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIE  774
             G RSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMK+GKRYLYNKLHMYHMLVQFHIE
Sbjct  682   GARSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIE  741

Query  775   ENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPA  834
             ENDDQSILEEVRKHGEKD NLWSLALKYFAERGPLPKGAT GEEWKELKQLLALIDTNPA
Sbjct  742   ENDDQSILEEVRKHGEKDLNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPA  801

Query  835   IPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQL  894
             IPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFK DTKQMK+EIAQL
Sbjct  802   IPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQL  861

Query  895   SSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQ  954
             SSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQ
Sbjct  862   SSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQ  921

Query  955   LEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
             LEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  922   LEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  975

>PYVX_13921
Length=1041

 Score = 1791 bits (4639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 896/1043 (86%), Positives = 955/1043 (92%), Gaps = 37/1043 (4%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMK-----------------GVDVTSMSANRGLICVGDA  43
             MAQWRRFAFFDKEVLKDANGPWMK                 GVD+TSMSANRG+ICVGDA
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKSLDANFFRRLVVPDAIQGVDITSMSANRGMICVGDA  60

Query  44    DGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAG  103
             DGFVHLANR LEARKFQAHE FVSHVVMMKRSNVLVT+GDGIDPR EEL+ QSKAIAEAG
Sbjct  61    DGFVHLANRQLEARKFQAHENFVSHVVMMKRSNVLVTVGDGIDPRSEELKAQSKAIAEAG  120

Query  104   RAPNAEEMYTSKPAGKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAAND  163
             R+ NAEEM+T K +GKSTAVVRFWRTDQQDR+GKPKLLQQ+PIFAKKYPEEAVTAFA +D
Sbjct  121   RSGNAEEMFTPKQSGKSTAVVRFWRTDQQDRDGKPKLLQQVPIFAKKYPEEAVTAFAVHD  180

Query  164   DLSQFAVGLKNGAVILFRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLY  223
             D+SQFAVGLKNGAVILFRSDLKRR+DRPP LLQPAGQYPVTGL+FTSKP+TATVSHVFLY
Sbjct  181   DVSQFAVGLKNGAVILFRSDLKRRSDRPPHLLQPAGQYPVTGLAFTSKPITATVSHVFLY  240

Query  224   ASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTD  283
             ASTRRGLTCYHC+HDDPA+ K+AG AA +PPRT VLDERGVDM+CSCVN+EGE+AVGQTD
Sbjct  241   ASTRRGLTCYHCTHDDPAVTKAAG-AAGMPPRTVVLDERGVDMSCSCVNDEGELAVGQTD  299

Query  284   AVYFYTTEDRSVCFGFEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT  343
             AVYFYTTEDRSVCFGFEGEKK+L FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT
Sbjct  300   AVYFYTTEDRSVCFGFEGEKKYLSFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT  359

Query  344   STN--PKGPMRKPPLASNARSP-------GARFGLDEMEEVRHVVCEFGAIFVVSSMGHV  394
             STN   KG  R+PPLA NAR         GARFGLDEMEE+RHVVCEFGAIFVVSS+GHV
Sbjct  360   STNSNAKGGARRPPLAPNARXXXXXXXXXGARFGLDEMEEIRHVVCEFGAIFVVSSVGHV  419

Query  395   YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLR  454
             YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLYQKGD+DGSLR
Sbjct  420   YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDFDGSLR  479

Query  455   QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK  514
             QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK
Sbjct  480   QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK  539

Query  515   LDKFIQLDEVIDAKKTKTDSDSGELTPR-------NGAVANLNFDVETAISVLWENYPQH  567
             LDKFIQLDEVID+ K   D +S    PR       +G   N NFDVETAISVLWENYP+H
Sbjct  540   LDKFIQLDEVIDSSKKAADRNSIAKLPRSSDETGLDGKRDNPNFDVETAISVLWENYPKH  599

Query  568   ALTLAKKHEEHSWYLKIQLDHISYVdsedsaalsesekeRVADALEYIEHLSFSEADSNL  627
             ALTLAKK+EEHSWYLKIQLD ISYV+SEDS ALS+ EKERV DALEYI+HLSFSEADSNL
Sbjct  600   ALTLAKKYEEHSWYLKIQLDRISYVESEDSVALSDHEKERVTDALEYIKHLSFSEADSNL  659

Query  628   RKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIV  687
             RKYGRTLVTH+P PTTELLK+LCTGKFVPGN S+KSDPGDFLHLFVSHRAQLKEFLQYIV
Sbjct  660   RKYGRTLVTHLPGPTTELLKQLCTGKFVPGNSSLKSDPGDFLHLFVSHRAQLKEFLQYIV  719

Query  688   EVETVSNTSIGNTLLEMVLSDDDEGENGK--RSIEEKEEAVLRILDNPRVKYDEDHALIH  745
             EVETV+NTSIGNTLLEMVLSDD E   G   R+  EKE+AV+ ILDNPRVKYDEDHALIH
Sbjct  720   EVETVTNTSIGNTLLEMVLSDDSEDAEGSAPRTDAEKEDAVMLILDNPRVKYDEDHALIH  779

Query  746   LQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAE  805
             LQMHGMK+GKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHGEKDPNLWSLALKYFAE
Sbjct  780   LQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAE  839

Query  806   RGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLAS  865
             RGPLPKGAT GEEWKELKQLLALIDTNP IPPLQVVQVLSQSRELPVSV+KQY+VNQLA+
Sbjct  840   RGPLPKGATSGEEWKELKQLLALIDTNPVIPPLQVVQVLSQSRELPVSVVKQYIVNQLAN  899

Query  866   dekkieedeekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHS  925
             DE+KI EDEEKIKAFK DTKQMK+EI+QLSS+AVVFQATKCDLCNHDLDLPAVHFMCQHS
Sbjct  900   DERKIAEDEEKIKAFKGDTKQMKEEISQLSSKAVVFQATKCDLCNHDLDLPAVHFMCQHS  959

Query  926   FHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGK  985
             FHLNCISET+REC+TCS+DHRHI+GLKTQLEQKAGNHEQFYNQLETAADGF+TIAEYFGK
Sbjct  960   FHLNCISETERECMTCSLDHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGK  1019

Query  986   GIFKSNEVVLDEGSFETRFSAEF  1008
             GIFKSNEV  D+GSFETRFSAEF
Sbjct  1020  GIFKSNEVA-DDGSFETRFSAEF  1041

>PYU1_G005966
Length=1030

 Score = 1769 bits (4583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 881/1034 (85%), Positives = 941/1034 (91%), Gaps = 30/1034 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKD NG W+KGVD+TSMSANRG+ICVGD DGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDGNGLWLKGVDITSMSANRGMICVGDGDGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPN-AEEMYTSKPAGK  119
             AHE FVSHVVMMKRSN+LV+IGDGIDPR  ELR QSKA+A+AGR+ N AEEM+ SK  GK
Sbjct  61    AHENFVSHVVMMKRSNILVSIGDGIDPRSAELRAQSKAVADAGRSANSAEEMFASKQTGK  120

Query  120   STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVIL  179
             +TAVVR WRTDQQDR+GKPKLLQQIP+FAKKYPEEAVTAFA NDD+SQ AVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQLAVGLKNGAVIL  180

Query  180   FRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDD  239
             FR+DLKRR+DRPP LLQPAGQYPVTGL FTSKPVT TVSHVFLYASTRRGLTCYHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVFLYASTRRGLTCYHCTHDD  240

Query  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG A+ LPPRT VLDERGVD NCSCVN+EGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  241   PALVKSAG-ASGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357
             EGEKK+L FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KGP   RKPP+A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTSKGPAGGRKPPIA  359

Query  358   SNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417
              N+R+PGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  360   PNSRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419

Query  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT-------  530
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE++D KK        
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIVDGKKNDLSGGDA  539

Query  531   ---------------KTDSDSGELTPRNG-AVANLNFDVETAISVLWENYPQHALTLAKK  574
                            K DS +G  T + G   A LNFDVETAISVLWENYPQHALTLAKK
Sbjct  540   LSAVNGTGAAGDKLAKRDSSAGAETAQKGPGTAALNFDVETAISVLWENYPQHALTLAKK  599

Query  575   HEEHSWYLKIQLDHISYVdsedsaalsesekeRVADALEYIEHLSFSEADSNLRKYGRTL  634
             HEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLRKYGRTL
Sbjct  600   HEEHSWYLKIQLDRISYVESEDSVALSTHEKERVADALEYIKHLSFSEADSNLRKYGRTL  659

Query  635   VTHMPAPTTELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN  694
             VTH+P PTTELLK+LCTGKFVP N  +KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN
Sbjct  660   VTHLPEPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN  719

Query  695   TSIGNTLLEMVLSDDDEGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRG  754
             TSIGNTLLEMVLS   E  + KR+ EE E+AV+ ILDNPRVKYDEDHALIHLQM G+K+G
Sbjct  720   TSIGNTLLEMVLS---ETADEKRTEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKG  776

Query  755   KRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGAT  814
             KRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHGEKDPNLWSLALKYFAERGPLPKGAT
Sbjct  777   KRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGAT  836

Query  815   GGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieede  874
              GEEW+ELKQLLALID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DEKKIEEDE
Sbjct  837   TGEEWRELKQLLALIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEEDE  896

Query  875   ekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET  934
             EKIKAFK+DTKQMK+EI QLS +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET
Sbjct  897   EKIKAFKSDTKQMKEEITQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET  956

Query  935   DRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVV  994
             +RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKSNEV 
Sbjct  957   ERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVP  1016

Query  995   LDEGSFETRFSAEF  1008
             +D+GSF+ RFS EF
Sbjct  1017  IDDGSFDARFSNEF  1030

>PYIW_14752
Length=1031

 Score = 1758 bits (4554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 879/1035 (85%), Positives = 935/1035 (90%), Gaps = 31/1035 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVD+TSMSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNA-EEMYTSKPAGK  119
             AHE FVSHVVMMKRSN+LV+IGDG+D R EELR QSKA+AEAGR+ N+ EEMY SK  GK
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120

Query  120   STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVIL  179
             +TAVVR WRTDQQDR+GKPKLLQQIP+FAKKYPEEAVTAFA NDD+SQFAVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180

Query  180   FRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDD  239
             FR+DLKRR+DRPP LLQPAGQYPVTGL FTSKPVT T SHVFLYASTRRGLTCYHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240

Query  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG  + LPPRT VLDERGVD NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  241   PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357
             EGEKK+L FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGSTGGRKLSVA  359

Query  358   SNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417
              N R+PGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419

Query  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSD--  535
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK     D  
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLL  539

Query  536   --------------SGELTPRNGA--------VANLNFDVETAISVLWENYPQHALTLAK  573
                           SG+     GA         A LNFD+ETAISVLWENYPQHALTLAK
Sbjct  540   IANGSSSGDRKVSHSGQDGLSGGADGGKKRAGAAALNFDIETAISVLWENYPQHALTLAK  599

Query  574   KHEEHSWYLKIQLDHISYVdsedsaalsesekeRVADALEYIEHLSFSEADSNLRKYGRT  633
             KHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLRKYGRT
Sbjct  600   KHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT  659

Query  634   LVTHMPAPTTELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  693
             LVTH+P PTTELLK+LCTGKFVPGN  +KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS
Sbjct  660   LVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  719

Query  694   NTSIGNTLLEMVLSDDDEGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKR  753
             NTSIGNTLLEMVLS      +  RS EE E+AV+ ILDNPRVKYDEDHALIHLQM G+K+
Sbjct  720   NTSIGNTLLEMVLSG---SADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKK  776

Query  754   GKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGA  813
             GKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHGEKDPNLWSLALKYFAERGPLPKGA
Sbjct  777   GKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGA  836

Query  814   TGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieed  873
             T GEEWKELKQLL LID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DEKKIEED
Sbjct  837   TSGEEWKELKQLLVLIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEED  896

Query  874   eekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  933
             +EKIKAFK+DTKQMK+EIAQL  +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE
Sbjct  897   DEKIKAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  956

Query  934   TDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEV  993
             T+RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKSNEV
Sbjct  957   TERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEV  1016

Query  994   VLDEGSFETRFSAEF  1008
              +D+GSF+ RFSAEF
Sbjct  1017  PVDDGSFDMRFSAEF  1031

>PYIR_15175
Length=1030

 Score = 1755 bits (4545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 879/1033 (85%), Positives = 943/1033 (91%), Gaps = 28/1033 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVD+T+MSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITTMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPN-AEEMYTSKPAGK  119
             AHE FVSHVVMMKRSN+LV+IGDGIDPR +ELR QSKA+AEAGR+ N AEEMY SK  GK
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGIDPRSDELRAQSKAVAEAGRSANSAEEMYASKQTGK  120

Query  120   STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVIL  179
             +TAVVR WRTDQQDR+GKPKLLQQIP+FAKKYPEEAVTAFA NDD+SQFAVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180

Query  180   FRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDD  239
             FR+DLKRR+DRPP LLQPAGQYPVTGL FTSKPVT TVSHV+LYASTRRGLT YHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVYLYASTRRGLTVYHCTHDD  240

Query  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG AA LPPRT VLDERGVD NCSCVN+EGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  241   PALVKSAG-AAGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357
             EGEKK+L FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KGP+  RKPP+A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGPVGGRKPPVA  359

Query  358   SNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417
              N R+PGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNL+SI
Sbjct  360   PNTRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLFSI  419

Query  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSD--  535
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE++D KK+  + D  
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEILDGKKSDLNGDLL  539

Query  536   ---------------SGELTPRNGA-----VANLNFDVETAISVLWENYPQHALTLAKKH  575
                             G +   +G       A LNFDVETAISVLWENYPQHALTLAKKH
Sbjct  540   IANGNGTAGDKKAKQDGSVGGADGGKKGPGTAALNFDVETAISVLWENYPQHALTLAKKH  599

Query  576   EEHSWYLKIQLDHISYVdsedsaalsesekeRVADALEYIEHLSFSEADSNLRKYGRTLV  635
             EEHSWYLKIQLD ISYV+SEDSAALS  EKERVADALEYI+HLSFSEADSNLRKYGRTLV
Sbjct  600   EEHSWYLKIQLDRISYVESEDSAALSAHEKERVADALEYIKHLSFSEADSNLRKYGRTLV  659

Query  636   THMPAPTTELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT  695
             TH+P PTTELLK+LCTGKFVP N  +KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT
Sbjct  660   THLPGPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT  719

Query  696   SIGNTLLEMVLSDDDEGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGK  755
             SIGNTLLEMVLS    G+  KRS EE E+AV+ ILDNPRVKYDEDHALIHLQM G+K+GK
Sbjct  720   SIGNTLLEMVLSG--SGDEEKRSEEETEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK  777

Query  756   RYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATG  815
             RYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHGEKDPNLWSLALKYFAERGPLPKGAT 
Sbjct  778   RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATS  837

Query  816   GEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedee  875
             GEEWKELKQLL LID NP IPPLQVVQVLSQSRELPV+V+KQY+VNQL +DEKKIEED+E
Sbjct  838   GEEWKELKQLLVLIDNNPVIPPLQVVQVLSQSRELPVAVLKQYIVNQLLNDEKKIEEDDE  897

Query  876   kikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETD  935
             KIKAFK+DTKQMK+EI+QLS +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET+
Sbjct  898   KIKAFKSDTKQMKEEISQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE  957

Query  936   RECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVL  995
             RECITCSMDHRHI+GLK+QLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKSNEV +
Sbjct  958   RECITCSMDHRHIMGLKSQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPV  1017

Query  996   DEGSFETRFSAEF  1008
             D+GSF+ RFS EF
Sbjct  1018  DDGSFDMRFSNEF  1030

>PYAP_24883
Length=980

 Score = 1608 bits (4165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/996 (81%), Positives = 883/996 (89%), Gaps = 34/996 (3%)

Query  31    MSANRGLICVGDADGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPRLE  90
             MSANRG++CVGDADGFVHLANR LEARKF+AHE FVSH+VMMKRSNVLVTIGDGIDPR +
Sbjct  1     MSANRGMLCVGDADGFVHLANRQLEARKFRAHEHFVSHIVMMKRSNVLVTIGDGIDPRSD  60

Query  91    ELREQSKAIAEAGRAPNA--------EEMYT-SKPAGKSTAVVRFWRTDQQDREGKPKLL  141
             ELREQS+AIAEAGRA  A        ++M+T S  +GKSTAVVR WRTDQQDR+G+PKLL
Sbjct  61    ELREQSRAIAEAGRAAGAAGAGAATADDMFTRSADSGKSTAVVRIWRTDQQDRDGRPKLL  120

Query  142   QQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILFRSDLKRRTDRPPQLLQPAGQY  201
             QQ+P+FAKKYPEEAVTAFA +DD+ QFAVGL+NGAVILFR DLKRR +RPPQLLQPAGQ+
Sbjct  121   QQVPVFAKKYPEEAVTAFAVSDDIGQFAVGLRNGAVILFRIDLKRRAERPPQLLQPAGQF  180

Query  202   PVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDE  261
             PVTGLSFTSKP++ TV+HVFLYASTRRGLTCYHC+HDDPALVK+AG AA LP RT VLDE
Sbjct  181   PVTGLSFTSKPISNTVAHVFLYASTRRGLTCYHCNHDDPALVKAAG-AAGLPSRTVVLDE  239

Query  262   RGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFEGEKKFLRFFKHYLLVAHVDPR  321
             RGVD +CSCVN+EGEIAVGQ DAVYFY  EDRSVCFGFEGEKK+L+FFKHYLLVAHVDPR
Sbjct  240   RGVDHHCSCVNDEGEIAVGQVDAVYFYNNEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPR  299

Query  322   GRHQVNVYDLQNKFIAFNWTLTSTNPK-GPMRKPPLASNARSPGARFGLDEMEEVRHVVC  380
             GRHQVNVYDLQNKFIAFNW+LT T  + G MR+PPL +N R+PGARFGLD+MEE+RHVVC
Sbjct  300   GRHQVNVYDLQNKFIAFNWSLTQTASRNGGMRRPPLPTNNRAPGARFGLDDMEEIRHVVC  359

Query  381   EFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYG  440
                          VYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYG
Sbjct  360   ------------CVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG  407

Query  441   DHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  500
             DHLY+KGD+DGSLRQY RTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT
Sbjct  408   DHLYEKGDFDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  467

Query  501   LLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDS--------DSGELTPRNGAVANLNFD  552
             LLLNCYTKLKDVKKLD FIQLDE  D    +T           S +    NG    +NFD
Sbjct  468   LLLNCYTKLKDVKKLDNFIQLDENTDKLNGETKGIAAVANGGTSNDKAHENGGKTGMNFD  527

Query  553   VETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsaalsesekeRVADAL  612
             +ETAISVLWENYPQHAL LAKKHEEHSWYLKIQLD ISYV+SEDS  LS SE+ERVADAL
Sbjct  528   IETAISVLWENYPQHALILAKKHEEHSWYLKIQLDRISYVESEDSVGLSASEQERVADAL  587

Query  613   EYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPSMKSDPGDFLHLF  672
             EYI+HLSFSEAD+NLRKYGRTLVTH+P PTT+LLKRLCTGKFVPGNPS+KSDP DFLHLF
Sbjct  588   EYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGKFVPGNPSLKSDPADFLHLF  647

Query  673   VSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRSIEEKEEAVLRILDN  732
             VSHR QLKEFLQYIVEVETV+N  IGNTLLEMVLSDD +    K S  E+E+AV+ ILDN
Sbjct  648   VSHREQLKEFLQYIVEVETVTNPLIGNTLLEMVLSDDGDT---KLSDAEREDAVMAILDN  704

Query  733   PRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKD  792
             PRV+YDEDHALIHLQM GMK+GKRYLYNKLH+YHMLVQFHIEENDDQ+I++EVRKHGEKD
Sbjct  705   PRVRYDEDHALIHLQMRGMKKGKRYLYNKLHLYHMLVQFHIEENDDQAIIDEVRKHGEKD  764

Query  793   PNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPV  852
             PNLWSLALKYFAERGPLPKG   GEEWK+LKQLLALIDTNP IPPLQVV VLSQSRELPV
Sbjct  765   PNLWSLALKYFAERGPLPKGVKAGEEWKDLKQLLALIDTNPVIPPLQVVHVLSQSRELPV  824

Query  853   SVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHD  912
             SV+KQY+VNQL SDEKKIEEDEEKIK +K DTKQMK+EIAQL+SRAVVFQATKC+LCNHD
Sbjct  825   SVVKQYIVNQLVSDEKKIEEDEEKIKTYKADTKQMKEEIAQLNSRAVVFQATKCELCNHD  884

Query  913   LDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETA  972
             LDLPAVHFMC+HSFHLNCISET+RECITCS+DHRHI+GLKTQLEQKAGNHEQFYNQLETA
Sbjct  885   LDLPAVHFMCKHSFHLNCISETERECITCSLDHRHIMGLKTQLEQKAGNHEQFYNQLETA  944

Query  973   ADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
             ADGF TIAEYFGKGIFK++    D+ +F+ RFSAEF
Sbjct  945   ADGFQTIAEYFGKGIFKTDIAAEDDSAFDARFSAEF  980

>CCA17991
Length=965

 Score = 1486 bits (3848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/992 (73%), Positives = 843/992 (85%), Gaps = 41/992 (4%)

Query  31    MSANRGLICVGDADGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPRLE  90
             MSANRGLIC GDA+G++HL+N  LE RKFQAH  FVS +VMMKRSN+LV++GDGIDPR  
Sbjct  1     MSANRGLICAGDAEGYIHLSNSQLEVRKFQAHNHFVSQIVMMKRSNILVSVGDGIDPRPS  60

Query  91    ELREQSKAIAEAGRAPNAEEMYTSKPAG--KSTAVVRFWRTDQQDREGKPKLLQQIPIFA  148
              +  +   +          ++ +SK AG  +STA++R WRTDQQDREGKPK+LQQI +FA
Sbjct  61    MIHAEKADV----------DINSSKAAGDSESTAMIRIWRTDQQDREGKPKMLQQIQVFA  110

Query  149   KKYPEEAVTAFAANDDLSQFAVGLKNGAVILFRSDLKRRTDR-PPQLLQPAGQYPVTGLS  207
             K++PEEAVTAFA +DD+SQ++VGLKNGAVIL+RSD + R +R  P LLQPAGQ+PVTGL+
Sbjct  111   KRFPEEAVTAFAVSDDVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGLA  170

Query  208   FTSKPVTATVSHVFLYASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMN  267
             FT+KP+T +++HVFLYASTRRGLTCYHC+ DD  +VK A GA+ +PPR   LDERGVD +
Sbjct  171   FTTKPITNSLNHVFLYASTRRGLTCYHCNQDDQYIVK-AVGASRMPPRCVTLDERGVDFH  229

Query  268   CSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFEGEKKFLRFFKHYLLVAHVDPRGRHQVN  327
             CSCVN++GEIAVGQ DAVYFYTT+D+SVCF F+GEKK+L FFK YL+VAHVD RGRHQVN
Sbjct  230   CSCVNDDGEIAVGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVN  289

Query  328   VYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNAR------SPGARFGLDEMEEVRHVVCE  381
             VYDLQNKFIAFNWTLT + P         A+ AR      +P +RFGLD ME+++H+V E
Sbjct  290   VYDLQNKFIAFNWTLTHSVPSESSPNVSKATAARGKQSQPNPSSRFGLDRMEQIQHIVSE  349

Query  382   FGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGD  441
             FG+IFVVSS GHVYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGD
Sbjct  350   FGSIFVVSSAGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGD  409

Query  442   HLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTL  501
             HLYQKGDYDGSLRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTL
Sbjct  410   HLYQKGDYDGSLRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTL  469

Query  502   LLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGELTPRNGAVANLNFDVETAISVLW  561
             LLNC+TKLKDVKKLD FIQL++   AK               G   +LNFDVETAISVLW
Sbjct  470   LLNCFTKLKDVKKLDAFIQLEDGNAAKA--------------GGQTSLNFDVETAISVLW  515

Query  562   ENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsaalsesekeRVADALEYIEHLSFS  621
             E YPQHALTLA+KHEEHSWYLKIQLD ISYVDS+ S  LS +EKERV DALEYI+HLSF+
Sbjct  516   EMYPQHALTLARKHEEHSWYLKIQLDQISYVDSDGSTTLSSAEKERVIDALEYIKHLSFA  575

Query  622   EADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKE  681
             EAD+NLRKYGRTLVTH+P PTTELLKRLCTGKFVP  P +KSDP DFLHLFVSHRAQL+E
Sbjct  576   EADANLRKYGRTLVTHLPGPTTELLKRLCTGKFVPEKPELKSDPADFLHLFVSHRAQLRE  635

Query  682   FLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRSIEEKEEAVLRILDNPRVKYDEDH  741
             FLQYIVEVET+++ SIGNTLLEMVL+D  EG     S + KE+AV+ ILDNPRV+YDEDH
Sbjct  636   FLQYIVEVETITDPSIGNTLLEMVLTD--EGSEESPSADMKEDAVMAILDNPRVRYDEDH  693

Query  742   ALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALK  801
             ALIHLQMHGM++GKRYL+NKLHMYHMLVQ HIEE+DDQSI+EEVRKHG+KDPNLWSLALK
Sbjct  694   ALIHLQMHGMRKGKRYLFNKLHMYHMLVQHHIEEHDDQSIIEEVRKHGDKDPNLWSLALK  753

Query  802   YFAERGPLPK-----GATGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIK  856
             YFAERGPLPK     G    EEWKEL+QLL +IDTNP IPPLQVVQVLSQ+R+LP+SVIK
Sbjct  754   YFAERGPLPKYVSKSGNASNEEWKELRQLLIMIDTNPVIPPLQVVQVLSQARDLPLSVIK  813

Query  857   QYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLP  916
              Y++NQL+ +++ ++ DEEKI+AFK DT+QMK+EIAQL+S+A+VFQATKCDLCNHDLDLP
Sbjct  814   PYILNQLSHNQELVDNDEEKIRAFKADTRQMKEEIAQLNSKAIVFQATKCDLCNHDLDLP  873

Query  917   AVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGF  976
             AVHFMCQHSFHLNCISETDREC+TCS++HRHILGLKTQLEQKAGNHEQFYNQLET+ DGF
Sbjct  874   AVHFMCQHSFHLNCISETDRECMTCSVEHRHILGLKTQLEQKAGNHEQFYNQLETSMDGF  933

Query  977   HTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008
              TIAEYFGKGIFK NE+ +D+ +F+ +   +F
Sbjct  934   ETIAEYFGKGIFKKNEIPVDDPTFDFQSGVDF  965

>CCI40831
Length=1163

 Score = 1419 bits (3672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/981 (71%), Positives = 822/981 (84%), Gaps = 48/981 (5%)

Query  40    VGDADGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAI  99
             +GDAD  +H+ +      +F+AH     H VM KRSN+LV++GDGIDPR   +  +   +
Sbjct  219   MGDADD-LHIQS----DLQFRAH----GHRVM-KRSNILVSVGDGIDPRTSMIHAEKSDV  268

Query  100   AEAGRAPNAEEMYTSKPAGKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAF  159
                 R  +  +        +STA++R WRTDQQDREGKPK+LQQI +FAK++PEEAVTAF
Sbjct  269   DTTSRKGDTGD-------SESTAMIRIWRTDQQDREGKPKMLQQIQVFAKRFPEEAVTAF  321

Query  160   AANDDLSQFAVGLKNGAVILFRSDLKRRTDR-PPQLLQPAGQYPVTGLSFTSKPVTATVS  218
             A +D++SQ++VGLKNGAVIL+RSD + R +R  P LLQPAGQ+PVTGL+FT+KP+  +++
Sbjct  322   AVSDEVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGLAFTTKPINNSLN  381

Query  219   HVFLYASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIA  278
             HVFLYASTRRGLTCYHC+ DD  +VK A G   +PPR   LDERGVD  CSCVN+EGEIA
Sbjct  382   HVFLYASTRRGLTCYHCNQDDQYIVK-AVGTTGMPPRCVTLDERGVDFCCSCVNDEGEIA  440

Query  279   VGQTDAVYFYTTEDRSVCFGFEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAF  338
             VGQ DAVYFYTT+D+SVCF F+GEKK+L FFK YL+VAHVD RGRHQVNVYDLQNKFIAF
Sbjct  441   VGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVNVYDLQNKFIAF  500

Query  339   NWTLTSTNPK---GPMRKPPLASNARS---PGARFGLDEMEEVRHVVCEFGAIFVVSSMG  392
             NWTLT + P      + K  +A   +S   PGARFGLD+ME+++H+V EFG+IFVVSS G
Sbjct  501   NWTLTHSVPSESSANVSKTMVARGKQSQPNPGARFGLDKMEQIQHIVSEFGSIFVVSSAG  560

Query  393   HVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGS  452
             HVYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGS
Sbjct  561   HVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGDHLYQKGDYDGS  620

Query  453   LRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDV  512
             LRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTLLLNC+TKLKDV
Sbjct  621   LRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTLLLNCFTKLKDV  680

Query  513   KKLDKFIQLDEVIDAKKTKTDSDSGELTPRNGAVANLNFDVETAISVLWENYPQHALTLA  572
             KKLD FIQL++             G +    G   +LNFDVETAISVLWE YPQHALTLA
Sbjct  681   KKLDAFIQLED-------------GNVA---GGHTSLNFDVETAISVLWEMYPQHALTLA  724

Query  573   KKHEEHSWYLKIQLDHISYVdsedsaalsesekeRVADALEYIEHLSFSEADSNLRKYGR  632
             +KHEEHSWYLKIQLD ISYV+S+ S  LS +EKERV DAL+YIEHLSF+EAD+NLRKYGR
Sbjct  725   RKHEEHSWYLKIQLDQISYVESDGSTTLSGAEKERVIDALKYIEHLSFAEADANLRKYGR  784

Query  633   TLVTHMPAPTTELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETV  692
             TLVTH+P PTTELLKRLCTGKFVP  P +KS+P DFLHLFVSHRAQL+EFLQYIVEVET+
Sbjct  785   TLVTHLPGPTTELLKRLCTGKFVPEKPELKSNPADFLHLFVSHRAQLREFLQYIVEVETI  844

Query  693   SNTSIGNTLLEMVLSDDDEGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMK  752
             ++ SIGNTLLEMVL+D  EG     + + KE+AV+ ILDNPRV+YDEDHALIHLQMHGM+
Sbjct  845   TDPSIGNTLLEMVLTD--EGSEESPNTDRKEDAVMAILDNPRVRYDEDHALIHLQMHGMR  902

Query  753   RGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKG  812
             +GKRYL+NKLHMYHMLVQ HIEENDDQSI+EEVRKHG+KDPNLWSLALKYFAERGPLPK 
Sbjct  903   KGKRYLFNKLHMYHMLVQHHIEENDDQSIIEEVRKHGDKDPNLWSLALKYFAERGPLPKN  962

Query  813   ATG-----GEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASde  867
             A+       EEWKEL+QLL++IDTNP IPPLQVVQVLSQ+R+LP+SVIK Y++NQL+ ++
Sbjct  963   ASKSSKSSTEEWKELRQLLSMIDTNPVIPPLQVVQVLSQARDLPLSVIKPYILNQLSHNQ  1022

Query  868   kkieedeekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFH  927
             + IE DEEKI+AFK DT+QMK+EI+QL+S+A+VFQATKCDLCNHDLDLPAVHFMCQHSFH
Sbjct  1023  ELIESDEEKIRAFKADTRQMKEEISQLNSKAIVFQATKCDLCNHDLDLPAVHFMCQHSFH  1082

Query  928   LNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGI  987
             LNCISETDREC+TCS++HRHILGLKTQL+QKAGNHEQFYNQLET+ DGF TIAEYFGKGI
Sbjct  1083  LNCISETDRECMTCSVEHRHILGLKTQLDQKAGNHEQFYNQLETSMDGFETIAEYFGKGI  1142

Query  988   FKSNEVVLDEGSFETRFSAEF  1008
             FK NE+ +D+ +F+ +   +F
Sbjct  1143  FKRNEIPVDDPAFDFQSGVDF  1163

>SDRG_14094
Length=1003

 Score = 1309 bits (3387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/1040 (65%), Positives = 802/1040 (77%), Gaps = 69/1040 (7%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRF FFD+++LKD NG W++GVDVT MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRA---PNAEEMYTSKPA  117
             AH+ FVSHVVMMK++NVLV+IGDG DPR  +L + SKA+AEA R     + ++MYTS  +
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYTSTGS  120

Query  118   GK-STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGA  176
              + STA+V+ WRTDQQDREGKPKL+ Q+ IFAK +PEEAVTAFA ++D SQ AVGL NGA
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  177   VILFRSDLKRRT-----DRPPQLLQPAGQYPVTGLSFTSKPV-------TATVSHVFLYA  224
             +ILFRS++KRR        PP LLQ A   PVT LSF  KP        T+T + ++LYA
Sbjct  180   IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  225   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  284
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291

Query  285   VYFYTTEDRSVCFGFEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344
             VYFYT EDR+ CFGFEG+KK+L FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351

Query  345   TNPKGPMRKPPLASNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  404
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G VYRLSEKDT S
Sbjct  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVYRLSEKDTAS  406

Query  405   KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  464
             KL ILF KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHVE
Sbjct  407   KLSILFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVE  466

Query  465   PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  524
             PSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+ 
Sbjct  467   PSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD-  525

Query  525   IDAKKTKTDSDSGELTPRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKI  584
                      S++ E TP+      L FDVETA++VL ENYPQHAL LA+KH EHSWYLKI
Sbjct  526   -------DGSNAKEGTPQ-----ALTFDVETALTVLRENYPQHALALARKHAEHSWYLKI  573

Query  585   QLDHISYVdsedsaalsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTE  644
             QLD IS         LS++E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH+P PTTE
Sbjct  574   QLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTTE  626

Query  645   LLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEM  704
             LL++LCTG+F     + KSDPGDFLHLFVSHR QL+EFL+YIV+VE+VSNTSIGNTLLEM
Sbjct  627   LLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLREFLEYIVQVESVSNTSIGNTLLEM  685

Query  705   VLSD--------DDEGENGK----RSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMK  752
             VL+D        DD+ E  +     S    E AVL +LDNPRVKYDEDHALI +QMHG+K
Sbjct  686   VLNDTHKRDVPKDDDSEEPEVHEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHGLK  745

Query  753   RGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKG  812
             +GKRYLY KLHMYHML+Q H+EE +D ++LE V++  + D NLW LAL+YFAERGP PKG
Sbjct  746   QGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVKQ--QTDSNLWLLALRYFAERGPYPKG  803

Query  813   AT--GGEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLASdek  868
             ++    +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+QL  D+ 
Sbjct  804   SSVRSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKDQA  863

Query  869   kieedeekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHL  928
              I+ D ++IK +K DT +M+ ++A LSS+A+VFQATKCDLC+HDLDLP VHFMC HSFH 
Sbjct  864   HIDADSDEIKKYKQDTAKMRTQMAGLSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQ  923

Query  929   NCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIF  988
             NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAEYFGKGIF
Sbjct  924   NCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKGIF  983

Query  989   KSNEVVLDEGSFETRFSAEF  1008
             KS   V    S   RFS E 
Sbjct  984   KSEAAVDRRPSGVPRFSNEL  1003

>H310_11729
Length=1002

 Score = 1288 bits (3334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/1041 (63%), Positives = 797/1041 (77%), Gaps = 72/1041 (7%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFF+KE+LKD NG W++G+DVTSMS NRGL+ +GDA G +HLANR LE R F+
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHLANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGR--APNAEEMYTSKPAG  118
             AHE FVSHV+MMK++N+LV+IGDG DPR  +L + SKA+AEA R  A   E+++TS  + 
Sbjct  61    AHEHFVSHVIMMKKANLLVSIGDGKDPRDPDLIKASKAVAEASRTQAQQDEQLFTSSDSR  120

Query  119   KSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVI  178
              STA+V+ WRTDQQDR+GKPKLLQQI IF+K + EEAVTAFA +DDLSQ A+GL NGA+I
Sbjct  121   GSTALVKIWRTDQQDRDGKPKLLQQIKIFSK-FAEEAVTAFAVSDDLSQIAIGLLNGAII  179

Query  179   LFRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHD  238
             LFRSD KRR+D+PP LLQPA QYPVT L F +K     V+ + LYA+T+RGLTCYHC   
Sbjct  180   LFRSDAKRRSDKPPLLLQPATQYPVTSLHFATK-----VNILTLYAATKRGLTCYHC---  231

Query  239   DPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFG  298
             D A  KS      +P R+ VLDERGV ++C  V+E+G++AVGQ+DAVYFYT E+RSVCFG
Sbjct  232   DDASSKSNASNNGMP-RSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEERSVCFG  290

Query  299   FEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAS  358
             FEG+KK+L FFK YLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T           A 
Sbjct  291   FEGDKKYLGFFKQYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNT-----------AK  339

Query  359   NARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIA  418
                  G RFG D  EE+RHVV EFGA+FV+SS+G+VYRL E DTTSKL+ILFRK+LYSIA
Sbjct  340   IGAGGGGRFGDDAAEEIRHVVSEFGAVFVLSSLGYVYRLMEIDTTSKLDILFRKHLYSIA  399

Query  419   ISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRI  478
             ISLAFSSNYD+ SI+DIFR YGDHLYQKGD+DGSLRQY RTIG+VEPSYVIR+FLDAQRI
Sbjct  400   ISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQRI  459

Query  479   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGE  538
             HNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+ +D+        T +D+  
Sbjct  460   HNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDDEQTTDDAPTTADT--  517

Query  539   LTPRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsa  598
                R      L FDVETA++VL + YP HAL LAKKH EHSWYLKIQLD I       S 
Sbjct  518   ---RKQPKQQLTFDVETALTVLRDYYPTHALALAKKHHEHSWYLKIQLDRI------HSE  568

Query  599   alsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGN  658
              LS+++  RV DAL YIE LSF+EA+ NLRKYGRTLVTH+P PTTELLK LCTG+F   N
Sbjct  569   TLSDADHARVQDALTYIEGLSFTEANLNLRKYGRTLVTHVPGPTTELLKALCTGRFHDSN  628

Query  659   PSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSD----------  708
                K+DP +FLHLFVSHRAQL+EFL+YIV VETV+N  IGNTLLEMVLSD          
Sbjct  629   GE-KADPANFLHLFVSHRAQLREFLEYIVHVETVANPQIGNTLLEMVLSDVGRGGPNAAV  687

Query  709   ---DDEGENGKR---------SIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKR  756
                D+E + G R         S  + E AVL +LDNPRVKYDEDHALI +QMHG+K+GKR
Sbjct  688   DELDEEHDEGGRAPGGGTASTSAAKNESAVLALLDNPRVKYDEDHALILMQMHGLKQGKR  747

Query  757   YLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGG  816
             YLY KLHMYHMLVQ H+EE D+ ++LE+V++HGE +PNLW LALKYF+E+          
Sbjct  748   YLYQKLHMYHMLVQHHMEEGDNVAVLEQVKQHGESNPNLWLLALKYFSEK------KDND  801

Query  817   EEWKELKQLLALIDTNPA---IPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieed  873
               +  L+ LL+ +D++     IPPLQVV +LSQ+R+LP+SV++QYVVNQL  D+  I+++
Sbjct  802   PTYTHLQTLLSWMDSSSKSLQIPPLQVVAILSQARDLPLSVVRQYVVNQLKQDQIHIDKE  861

Query  874   eekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  933
              ++IK FK DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HSFH NCISE
Sbjct  862   NDEIKKFKQDTAKMRAQLTTLSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISE  921

Query  934   TDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEV  993
             TDREC+TC  +HRH + LKT LE KA NHE F+NQLE+A DGF+TIAEYFGKGIFK+++ 
Sbjct  922   TDRECMTCGPEHRHFVALKTSLETKASNHELFFNQLESATDGFNTIAEYFGKGIFKADDP  981

Query  994   VL------DEGSFETRFSAEF  1008
             ++      DE + E RFS E+
Sbjct  982   MMAQLGLGDEHASEARFSNEY  1002

>H257_12787
Length=968

 Score = 1274 bits (3298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 653/1030 (63%), Positives = 794/1030 (77%), Gaps = 84/1030 (8%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFF+KE+LKD NG W++G+DVTSMS NRGL+ +GDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGR--APNAEEMYTSKPAG  118
             AH+ FVSHV+MMK++N+LV+IGDG DPR  EL + SKAIA+A R  A   E+++T+  + 
Sbjct  61    AHDHFVSHVIMMKKANLLVSIGDGKDPRDPELIKASKAIADASRTQAQQDEQLFTASDSQ  120

Query  119   KSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVI  178
              STA+V+ WRTDQQDR+GKPKLLQQI IFAK +PEEAVTAF+ +DDL+Q AVGL NGA+I
Sbjct  121   GSTALVKIWRTDQQDRDGKPKLLQQIKIFAK-FPEEAVTAFSVSDDLAQIAVGLLNGAII  179

Query  179   LFRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHD  238
             LFRSD KRR+D+PP LLQPA QYPVT L F +K    T     LYA+T+RGLTCYHC  D
Sbjct  180   LFRSDAKRRSDKPPLLLQPATQYPVTSLHFATKLNVPT-----LYAATKRGLTCYHC--D  232

Query  239   DPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFG  298
             D +    +GG     PR+ VLDERGV ++C  V+E+G++AVGQ+DAVYFYT EDRSVCFG
Sbjct  233   DSS---RSGGM----PRSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEDRSVCFG  285

Query  299   FEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAS  358
             F+G+KK+L FFK YLLVAHVDPRGRHQVN+YDLQNKFIAFNWTLT+T           A 
Sbjct  286   FDGDKKYLGFFKQYLLVAHVDPRGRHQVNLYDLQNKFIAFNWTLTNT-----------AK  334

Query  359   NARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIA  418
                  G RFG D  EE+RHVV EFGA+FV SS+G+VYRL E DTTSKL+ILFRK+LYSIA
Sbjct  335   GGGGGGGRFGDDAAEEIRHVVSEFGAVFVQSSLGYVYRLLEVDTTSKLDILFRKHLYSIA  394

Query  419   ISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRI  478
             ISLAFSSNYD+ SI+DIFR YGDHLYQKGD+DGSLRQY RTIG+VEPSYVIR+FLDAQRI
Sbjct  395   ISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQRI  454

Query  479   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGE  538
             HNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+ +D+  D K+ K       
Sbjct  455   HNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDD--DPKEKKQP-----  507

Query  539   LTPRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsa  598
                       L FDVETA++VL +NYP HALTLAKKH EHSWYLKIQLD I       S 
Sbjct  508   ----------LTFDVETALTVLRDNYPTHALTLAKKHHEHSWYLKIQLDRIH------SE  551

Query  599   alsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGN  658
              LSES++ RV DAL YIE LSF EA+ NLRKYGRTLVTH+P PTTELLK LCTG+F   +
Sbjct  552   TLSESDQARVLDALTYIEGLSFGEANLNLRKYGRTLVTHVPGPTTELLKALCTGRF--HD  609

Query  659   PSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSD--------DD  710
              + K+DP +FLHLFVSHRAQL+EFL+YIV+VETV+N  IGNTLLEMVL D        ++
Sbjct  610   STDKADPANFLHLFVSHRAQLREFLEYIVDVETVANPQIGNTLLEMVLGDVGRSPATAEE  669

Query  711   EGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQ  770
             + E+    +   E AVL +LDNPRVKYDEDHALI +QMHG+K+GKRYLY KLHMYHML+Q
Sbjct  670   DAEDKPIIMATNEAAVLALLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQ  729

Query  771   FHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLA-LI  829
              H+EE DD ++L++V++HGE +PNLW LALKYF+++          ++   L+ LL+ ++
Sbjct  730   HHMEEGDDLAVLDQVKQHGESNPNLWLLALKYFSDQ----------KDPGHLQTLLSWMM  779

Query  830   DTN---PAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQ  886
             DT+   P IPPLQVV +LSQ+R+LP+SV++ YVV+QL  D+  I++++ +IK F+ DT +
Sbjct  780   DTSVPAPPIPPLQVVAILSQARDLPLSVVRPYVVSQLKQDQAHIDKEKGEIKKFQQDTAK  839

Query  887   MKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHR  946
             M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HSFH NCISETDREC+TC  +HR
Sbjct  840   MRAQVTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETDRECMTCGPEHR  899

Query  947   HILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFK--------SNEVVLDEG  998
             H + L++ L+ KA NHE F+NQLETA DGF+TIAEYFGKGIFK         N V    G
Sbjct  900   HFVALQSSLQAKASNHELFFNQLETATDGFNTIAEYFGKGIFKPVDDDDDDENRVAESVG  959

Query  999   SFETRFSAEF  1008
             S E RFS E+
Sbjct  960   SNE-RFSNEY  968

>SPRG_03282
Length=1004

 Score = 1273 bits (3295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/1041 (63%), Positives = 792/1041 (76%), Gaps = 70/1041 (7%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRF FFD+++LKD NG W++GVDVT MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRA---PNAEEMYTSKPA  117
             AH+ FVSHVVMMK++NVLV+IGDG DPR  +L + SKA+AEA R     + ++MY S  +
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120

Query  118   GK-STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGA  176
              + STA+V+ WRTDQQDREGKPKL+ Q+ IFAK +PEEAVTAFA ++D SQ AVGL NGA
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  177   VILFRSDLKRRT-----DRPPQLLQPAGQYPVTGLSFTSKPV-------TATVSHVFLYA  224
             +ILFRS++KRR        PP LLQ A   PVT LSF  KP        T+T + ++LYA
Sbjct  180   IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  225   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  284
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291

Query  285   VYFYTTEDRSVCFGFEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344
             VYFYT EDR+ CFGFEG+KK+L FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351

Query  345   TNPKGPMRKPPLASNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  403
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406

Query  404   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466

Query  464   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+
Sbjct  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  526

Query  524   VIDAKKTKTDSDSGELTPRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLK  583
                       S + E TP+      L FDVETA++VL ENYPQHAL LAKKH EHSWYLK
Sbjct  527   --------DGSSAKEGTPQA-----LTFDVETALTVLRENYPQHALALAKKHGEHSWYLK  573

Query  584   IQLDHISYVdsedsaalsesekeRVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTT  643
             IQLD IS         LS++E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH+P PTT
Sbjct  574   IQLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTT  626

Query  644   ELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLE  703
             ELL++LCTG+F     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSIGNTLLE
Sbjct  627   ELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTLLE  685

Query  704   MVLSD--------DDEGENGK----RSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGM  751
             MVL+D        DDEG+  +     S    E AVL +LDNPRVKYDEDHALI +QMHG+
Sbjct  686   MVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHGL  745

Query  752   KRGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPK  811
             K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++  + D NLW LAL+YFAERGP PK
Sbjct  746   KQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVKQ--QTDSNLWLLALRYFAERGPYPK  803

Query  812   GATG--GEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLASde  867
             GA+    +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+QL  D+
Sbjct  804   GASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKDQ  863

Query  868   kkieedeekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFH  927
               I+ D ++IK +K DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HSFH
Sbjct  864   AHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFH  923

Query  928   LNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGI  987
              NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAEYFGKGI
Sbjct  924   QNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKGI  983

Query  988   FKSNEVVLDEGSFETRFSAEF  1008
             FKS   +    S   RFS E 
Sbjct  984   FKSEAALDRRPSGVARFSNEL  1004

>PHYKE_6407
Length=934

 Score = 1201 bits (3108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/631 (95%), Positives = 612/631 (97%), Gaps = 3/631 (0%)

Query  1    MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
            MAQWRRFAFFDKEVLKDANGPWMKGVD+TSMSANRGLICVGDADGFVHL+NRSLEARKFQ
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLSNRSLEARKFQ  60

Query  61   AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120
            AHELFVSHVVMM+RSNVLVTIGDGIDPR EELR QSKAIAEAGRAPNAE+MYTSKP+GKS
Sbjct  61   AHELFVSHVVMMQRSNVLVTIGDGIDPRSEELRAQSKAIAEAGRAPNAEDMYTSKPSGKS  120

Query  121  TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180
            TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFA NDDLSQFAVGLKNGAVILF
Sbjct  121  TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  181  RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240
            RSDLKRRTDRPP LLQPAGQYPVTGLSFTSKPVTA+VSHVFLYASTRRGLTCYHCSHDDP
Sbjct  181  RSDLKRRTDRPPHLLQPAGQYPVTGLSFTSKPVTASVSHVFLYASTRRGLTCYHCSHDDP  240

Query  241  ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
            ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241  ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301  GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360
            GEKK+L FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T+ K  MRKPPLA+NA
Sbjct  301  GEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTSSKAGMRKPPLAANA  360

Query  361  RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
            R+PGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361  RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421  LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
            LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421  LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481  LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK---TKTDSDSG  537
            LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK   TK+ SDSG
Sbjct  481  LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKSGSDSG  540

Query  538  ELTPRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdseds  597
              TPR    +NLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS
Sbjct  541  MTTPRGAGASNLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS  600

Query  598  aalsesekeRVADALEYIEHLSFSEADSNLR  628
             ALSE+EKERVADALEYIEHLSFSEADSNLR
Sbjct  601  VALSENEKERVADALEYIEHLSFSEADSNLR  631

 Score = 589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/301 (97%), Positives = 298/301 (99%), Gaps = 0/301 (0%)

Query  708   DDDEGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHM  767
             DD++GENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMK+GKRYLYNKLHMYHM
Sbjct  634   DDEDGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHM  693

Query  768   LVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLA  827
             LVQFHIEENDDQSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT GEEWKELKQLLA
Sbjct  694   LVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLA  753

Query  828   LIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQM  887
             LIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFK DTKQM
Sbjct  754   LIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQM  813

Query  888   KDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRH  947
             K+EIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRH
Sbjct  814   KEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRH  873

Query  948   ILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAE  1007
             ILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEV+LDEGSFE RFSAE
Sbjct  874   ILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVLLDEGSFEARFSAE  933

Query  1008  F  1008
             F
Sbjct  934   F  934

>PYAR_24779
Length=699

 Score = 1070 bits (2768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/696 (79%), Positives = 604/696 (87%), Gaps = 42/696 (6%)

Query  1    MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
            MAQWRRFAFFDKEVLKDANG WMKGVD+T+MSANRG+ICVGDADGFVHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60

Query  61   AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPN---AEEMYTSKP-  116
            AHE FVSH+VMMKRSNVLVTIGDG+DPR EELREQS+AIAEAGRA     +E+MY +K  
Sbjct  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120

Query  117  AGKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGA  176
            AGKS+A+VR WRTDQQDR+G PKLLQQ+P+FAKKYPEEAVTAFA +DD+ QFAVGLKNGA
Sbjct  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180

Query  177  VILFRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCS  236
            VILFR DLKR+ DRPP LLQPAGQ+PVTGLSFTSKPVTATV+H FLYA+TRRGL+CYHC+
Sbjct  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240

Query  237  HDDPALVKSAGGAAA-----LPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTE  291
            H+D ALVK+ G AAA     +PPRT VLDERGVD+N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  241  HEDQALVKAVGQAAAAGGGGMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300

Query  292  DRSVCFGFEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT--STNPKG  349
            DRSVCFGFEGEKK+L+FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT  +  P G
Sbjct  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360

Query  350  PM-----RKPPLASNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  404
             +     R+    SNAR+PGARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTTS
Sbjct  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420

Query  405  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  464
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHVE
Sbjct  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480

Query  465  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  524
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540

Query  525  IDAKK------------------TKTD-SDSGELTP--RNGAVA-----NLNFDVETAIS  558
            +DA K                   KT+  D+    P  + G +A      +NFD+ETAIS
Sbjct  541  VDANKLNGAAGGDAGATANGKALAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600

Query  559  VLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVdsedsaalsesekeRVADALEYIEHL  618
            VLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HL
Sbjct  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660

Query  619  SFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKF  654
            SFSEAD+NLRKYGRTLVTH+P PTT+LLKRLCTG F
Sbjct  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696

>PYAR_24374
Length=325

 Score = 494 bits (1271),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 249/326 (76%), Positives = 283/326 (87%), Gaps = 22/326 (7%)

Query  704   MVLSDDDEGENGK-RSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKL  762
             MVLS D E +  K R++ EKE+AV+ ILDNPRV+YDEDHALIHLQMHGMK+GKRYLYNKL
Sbjct  1     MVLSADGESDEAKERTVAEKEDAVMAILDNPRVRYDEDHALIHLQMHGMKKGKRYLYNKL  60

Query  763   HMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKEL  822
             H+YHMLVQFHIEENDD SI++EVRKHG+KDPNLWSLALKYFAERGPLPKG   GEEW +L
Sbjct  61    HLYHMLVQFHIEENDDSSIIDEVRKHGDKDPNLWSLALKYFAERGPLPKGVKTGEEWHDL  120

Query  823   KQLLALIDTNPAIPPLQVVQ-----------------VLSQSRELPVSVIKQYVVNQLAS  865
             KQLLALIDTNPAIPPL VVQ                 VLSQSRELPV+V+KQY+VNQL S
Sbjct  121   KQLLALIDTNPAIPPLHVVQVLSQSRELPVAVVKQYIVLSQSRELPVAVVKQYIVNQLLS  180

Query  866   dekkieedeekikAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHS  925
             DE+KIEEDE+KIK +K DTK+MK+EI +L+S+AVVFQATKC+LCNHDLDLPAVHFMC+HS
Sbjct  181   DERKIEEDEDKIKTYKADTKKMKEEIGELNSKAVVFQATKCELCNHDLDLPAVHFMCKHS  240

Query  926   FHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGK  985
             FHLNCISET+RECITCS++HRHI+GLKTQLEQKAGNHEQFYNQLETAADGF TIAEYFGK
Sbjct  241   FHLNCISETERECITCSLEHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFQTIAEYFGK  300

Query  986   GIFKSNEVVL---DEGSFETRFSAEF  1008
             GIFK+ E+     D+G+F+ RFSAEF
Sbjct  301   GIFKT-EIASGDDDDGAFDHRFSAEF  325

>PHALS_11598
Length=1421

 Score = 38.1 bits (87),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 59/111 (53%), Gaps = 11/111 (10%)

Query  355  PLASNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSM-GHVYRLSEKDTTSK--LEILFR  411
            PLAS A   GA    D++  ++  V EFG  FV+SS+ G +Y+L+E  +  K  ++ +F+
Sbjct  280  PLASGAV--GAFLSSDDVNHLKAFVREFGLRFVLSSLEGRIYQLNEIVSAMKKGVKNVFK  337

Query  412  ------KNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQY  456
                  K+L    +S + + +Y  ++I    R+  D  +   DY+ +L+ Y
Sbjct  338  SWLRKPKDLRMSNVSASGNVSYKSDAIESQTRLLADTAFLVRDYELALQMY  388

>PYAP_13607
Length=270

 Score = 36.2 bits (82),  Expect = 0.85, Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 0/38 (0%)

Query  904  TKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITC  941
            T C +C   +D P V   C H FH+ CI    R   TC
Sbjct  73   TSCVVCMETMDQPCVQLPCHHYFHVGCIEPWLRMHSTC  110

>SPRG_13639
Length=179

 Score = 35.4 bits (80),  Expect = 0.89, Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 26/62 (42%), Gaps = 7/62 (11%)

Query  894  LSSRAVVFQATKCDLC-----NHDLDLPAV--HFMCQHSFHLNCISETDRECITCSMDHR  946
              SR  V   T+C +C       D ++P V     C H FH  CI+E      TC +   
Sbjct  101  FQSRRNVPSETECSICLVPFSRDDFEVPGVVVETQCTHVFHQGCIAEWIETAATCPICRH  160

Query  947  HI  948
            HI
Sbjct  161  HI  162

>SPRG_14870
Length=246

 Score = 35.8 bits (81),  Expect = 0.97, Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 26/62 (42%), Gaps = 7/62 (11%)

Query  894  LSSRAVVFQATKCDLC-----NHDLDLPAV--HFMCQHSFHLNCISETDRECITCSMDHR  946
              SR+ +   T+C +C       D  LP V     C H FH  CI+E      TC +   
Sbjct  168  FQSRSSLPSETECSICLVPFSRDDFHLPGVVVETQCTHVFHQGCIAEWIETAATCPICRH  227

Query  947  HI  948
            HI
Sbjct  228  HI  229

>PYAP_19745
Length=725

 Score = 36.2 bits (82),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 47/108 (44%), Gaps = 10/108 (9%)

Query  118  GKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAV  177
            G    VV  W T  Q R G    +           E  VTA   +DD   FAVG  NG  
Sbjct  196  GCEDGVVECWDTRSQSRVGVLDSVVGHCGGGVGDAEVGVTALEFDDDGLTFAVGTSNGHC  255

Query  178  ILFRSDLKRRTDRPPQLLQPAGQY--PVTGLSF--TSKPVTATVSHVF  221
            +L+  DL  R+ +P  LLQ   QY  P+  + F   S+ V +T + V 
Sbjct  256  LLY--DL--RSSKP--LLQKTHQYGLPIVDVKFHDYSRKVLSTDAKVI  297

>PYIR_17525
Length=1023

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 37/156 (24%), Positives = 63/156 (40%), Gaps = 24/156 (15%)

Query  790  EKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRE  849
            E D NLW   +             T  E  +EL +      +   I P+++++ + +  E
Sbjct  813  ENDENLWDYLIDL---------SLTSKENVEELLKFA----SQHKIDPIKLIRKIPEDME  859

Query  850  LPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSRAV-VFQATKCDL  908
              +  +KQ +V+ +A+   +        K F+ND  Q+     +   +A  V   T+C +
Sbjct  860  --IDNLKQKLVDIIANYRIQQNLCTGCSKVFENDRVQLLQRQVKTHKKARRVSVKTQCLI  917

Query  909  CNHDLDLP--------AVHFMCQHSFHLNCISETDR  936
            CN  L  P           F C H +HL C+ E  R
Sbjct  918  CNEVLRAPTSGKESFHVCVFECGHCYHLPCLEEKMR  953

>PYIR_16790
Length=744

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 54/121 (45%), Gaps = 18/121 (15%)

Query  118  GKSTAVVRFWRTDQQDREGKPKLLQQIPIFA--KKYPEEA---VTAFAANDDLSQFAVGL  172
            G     V  W T  Q R G   +L  I  FA      +EA   VTA   +DD   F VG 
Sbjct  196  GCEDGTVECWDTRSQRRVG---ILDGISTFAGGPAGADEAPVQVTALEFDDDGLTFGVGT  252

Query  173  KNGAVILFRSDLKRRTDRPPQLLQPAGQY--PVTGLSF--TSKPVTATVSHVFLYASTRR  228
             NG  +L+  DL  R+ +P  LLQ + QY  P+  L F   ++ V +T + V      R 
Sbjct  253  SNGHCLLY--DL--RSSKP--LLQKSHQYGLPIIDLKFHDYARKVISTDAKVIKIWDKRD  306

Query  229  G  229
            G
Sbjct  307  G  307

>H310_10523
Length=262

 Score = 35.0 bits (79),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 17/64 (27%), Positives = 30/64 (47%), Gaps = 1/64 (2%)

Query  879  AFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLD-LPAVHFMCQHSFHLNCISETDRE  937
            ++K  +  + +++A     A       C +C + LD    V   C+HS+H +CI +    
Sbjct  56   SYKPTSHSILEKLATWQVPATKLDDATCAVCMNSLDDATVVALPCKHSYHTDCIRQWLAR  115

Query  938  CITC  941
            C TC
Sbjct  116  CNTC  119

>PYIW_14857
Length=1013

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 64/156 (41%), Gaps = 24/156 (15%)

Query  790  EKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRE  849
            E D NLW     Y  +     K        + ++QLL     +  I P+++++ + +  E
Sbjct  803  ENDENLWD----YLIDLSLTSK--------ENVEQLLKFASQH-KIDPIKLIRKIPEDME  849

Query  850  LPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQLSSRAV-VFQATKCDL  908
              +  +KQ +V+ +A+   +        K F+ND  Q+     +   RA  V   T C +
Sbjct  850  --IDDLKQKLVDIIANYRIQQNLCNGCSKVFENDRVQLLQRQVKTHKRARRVAVKTACLI  907

Query  909  CNHDLDLP--------AVHFMCQHSFHLNCISETDR  936
            CN  L  P           F C H +HL C+ +  R
Sbjct  908  CNEVLRAPTSGKESFHVCVFECGHCYHLPCLEDKMR  943

>SPRG_03710
Length=678

 Score = 35.0 bits (79),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 42/104 (40%), Gaps = 18/104 (17%)

Query  117  AGKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGA  176
            AG    VV  W T  Q R G   +   +PI A  +  + +T          FAVG   G 
Sbjct  186  AGGDNGVVEMWDTRSQARVGSLSVSPDVPISALNFDTDGLT----------FAVGTHTGE  235

Query  177  VILFRSDLKRRTDRPPQLLQPAGQY--PVTGLSFTSKPVTATVS  218
            V L+  DL+  T     LL    QY  P+  ++F   P    +S
Sbjct  236  VRLY--DLRSST----PLLTKQHQYELPIVDVTFHEGPSKQVLS  273

>PYVX_16007
Length=90

 Score = 32.3 bits (72),  Expect = 2.7, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 19/43 (44%), Gaps = 1/43 (2%)

Query  906  CDLCNHDLDLP-AVHFMCQHSFHLNCISETDRECITCSMDHRH  947
            C +C     +   V   C H FHL+CIS  +R  I     H H
Sbjct  43   CSICREPFGVKEQVILSCSHMFHLDCISSFERSDIIAYWHHNH  85

>PYAP_25178
Length=286

 Score = 34.3 bits (77),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (51%), Gaps = 17/81 (21%)

Query  700  TLLEMVLSDDDEGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHG---MKRGKR  756
            T+ ++VLSD D G+ G R++ +    +LR+          +H L H+ ++G      G  
Sbjct  67   TVKQLVLSDHDIGDKGARAVAD----MLRV----------NHTLQHVDLYGNAITDAGCE  112

Query  757  YLYNKLHMYHMLVQFHIEEND  777
             + N L+ +  LV+ H+  ND
Sbjct  113  AIANSLYGHESLVELHLWSND  133

>CCA20583
Length=365

 Score = 34.3 bits (77),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (7%)

Query  901  FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET---DRECITC  941
            FQ+ +C +C ++L        C H FHL CI E     ++C  C
Sbjct  102  FQSQECLICLNELQTNLAAVQCGHVFHLICIKEAFEYKKQCPVC  145

>H257_03925
Length=290

 Score = 33.9 bits (76),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 28/62 (45%), Gaps = 6/62 (10%)

Query  901  FQATKCDLCNH---DLDL---PAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQ  954
             + T C +C     D+D    P  H  C H FHL+CI E  +   TC +  R +  ++  
Sbjct  133  IKTTSCAICWESCGDIDFCSSPPHHLPCGHGFHLSCIREWMKRDATCPLCRRALPSVQDT  192

Query  955  LE  956
             E
Sbjct  193  FE  194

>PHALS_03538
Length=903

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (49%), Gaps = 10/84 (12%)

Query  101  EAGRAPNAEEMYTSKPAGKSTAVVRFWR-------TDQQDREGKPKLLQQIPIFAKKYPE  153
            +A   P++ +++TSKP   S+   R+WR        DQ+D E K  LL+Q   F +   E
Sbjct  124  KATVVPSSNDVWTSKPRNVSSPKRRYWRLVHRKKVNDQEDNE-KLTLLRQSHPFHEMKIE  182

Query  154  EAVTAFAANDDLSQFAVGLKNGAV  177
              V +   N DLS+       G+V
Sbjct  183  STVESM--NSDLSKNGYMYSRGSV  204

>PYU1_G005575
Length=595

 Score = 34.3 bits (77),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 48/90 (53%), Gaps = 11/90 (12%)

Query  139  KLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILFRSDLKRRTDRPPQ-LLQP  197
            +LLQ IP+      ++++T+   + ++   A G  +G+V ++R D K+R +R  Q  L  
Sbjct  443  QLLQTIPLLG----QQSITSLILSPNMKYMATGGSDGSVRIWRWDEKQRFNRVQQCFLGQ  498

Query  198  AGQYPVTGLSFTSKP----VTATVSHVFLY  223
             G+  +T + FTS       T + S +F++
Sbjct  499  TGE--LTRVCFTSDGKFIVATGSSSTIFIW  526

>PYU1_G007955
Length=1018

 Score = 34.7 bits (78),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (46%), Gaps = 11/111 (10%)

Query  835  IPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKND-TKQMKDEIAQ  893
            I P+++++ + +  E  +  +KQ +++ +A+   +        K F+ND    ++ ++  
Sbjct  840  IDPIKLIRKIPEDME--IDDLKQKLIDIIANYRIQQNLCTGCNKVFENDRVTLLQRQVKS  897

Query  894  LSSRAVVFQATKCDLCNHDLDLP-----AVH---FMCQHSFHLNCISETDR  936
                  V   T C +CN  L  P     +VH   F C H +HL C+ E  R
Sbjct  898  HKKARRVASKTMCLICNDVLRAPTSGKASVHVCVFECGHCYHLPCLEENMR  948

>SDRG_10146
Length=220

 Score = 33.5 bits (75),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (49%), Gaps = 0/43 (0%)

Query  891  IAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  933
            +AQL S  V      C +C   +D   +   CQH+FH  CI E
Sbjct  65   LAQLPSWQVAASDDACVICMSPMDDDRIALPCQHAFHHTCIRE  107

>SDRG_07293
Length=687

 Score = 34.3 bits (77),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 42/104 (40%), Gaps = 18/104 (17%)

Query  117  AGKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGA  176
            AG    VV  W T  Q R G   +   +P+ A  +  + +T          FAVG   G 
Sbjct  196  AGGDNGVVEMWDTRSQARVGSLSVSPDVPVSALNFDTDGLT----------FAVGTHTGE  245

Query  177  VILFRSDLKRRTDRPPQLLQPAGQY--PVTGLSFTSKPVTATVS  218
            V L+  DL+  T     LL    QY  P+  ++F   P    +S
Sbjct  246  VRLY--DLRSST----PLLTKQHQYELPIVDVTFHEGPSKQVLS  283

>HYAP_07166
Length=76

 Score = 31.2 bits (69),  Expect = 5.3, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 4/32 (13%)

Query  910  NHDLDLPAVHFMCQHSFHLNCISETDRECITC  941
            NH+LD+  V   C H+FH +C+   D+ C TC
Sbjct  38   NHNLDV--VLLPCGHAFHDDCLD--DKSCPTC  65

>PYAP_13333
Length=346

 Score = 33.9 bits (76),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 46/124 (37%), Gaps = 15/124 (12%)

Query  84   GIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKSTAVVRFWRTDQQDREGKPKLLQQ  143
            G+ P L+E      A AE  + P      T  P         FWR  ++ +  K   L  
Sbjct  75   GVTPELKERARNHCARAE--KLPKEHAPVTLCPPELDKKSRFFWRMGERPKNTKFAELNA  132

Query  144  IPIFAKKYPEEAVTAF--------AANDDLSQFAVGLKNGAVILFRSDLKRRTDRPPQLL  195
             P+  K++PE   T          A  D +   A+GL      L +  L +R    P LL
Sbjct  133  EPVIPKEFPEWETTMNMWGGKMLDAITDLVEMAAIGLG-----LEKDALSKRIQNAPHLL  187

Query  196  QPAG  199
             P G
Sbjct  188  APTG  191

>PYAP_21787
Length=520

 Score = 33.9 bits (76),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  416  SIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIG  461
            S+  + +   +YD     DI R  G+  Y++GDY  +++ Y R++G
Sbjct  145  SVTTTSSAVKSYDGRPREDIEREEGNEHYKRGDYVAAIKSYTRSLG  190

>PYVX_13239
Length=1021

 Score = 33.9 bits (76),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 11/111 (10%)

Query  835  IPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFKNDTKQMKDEIAQL  894
            I P+++++ + +  E  +  +K+ ++  +A+   +        K F+ND  ++       
Sbjct  842  IDPIKLIRKIPEGME--IENLKEKMIAIIANYRIQQSLCVGCNKVFENDRVELLRRQVTA  899

Query  895  SSRAVVFQATK-CDLCNHDLDLP-----AVH---FMCQHSFHLNCISETDR  936
              RA    A K C +CN  L  P     ++H   F C H +HL C+ E  R
Sbjct  900  HKRARRVSAKKACAICNEVLRAPTSGKESIHVCVFECGHCYHLPCLEEKMR  950

>H257_05049
Length=338

 Score = 33.5 bits (75),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 51/136 (38%), Gaps = 22/136 (16%)

Query  1    MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
            M  W   A +  E L DA G     VDVT       +  VG  + FV    RS+  R F 
Sbjct  49   MDSWPAMAKWTNEYLVDALGETQVTVDVTPFGYGDAVTTVGTENVFVMPEERSMAFRDFL  108

Query  61   A--HELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEM--YTSKP  116
            A  H+     V  +   N             + LR+Q  A+ +     + + M  + S+ 
Sbjct  109  AILHDPCFDGVPYLSHQN-------------DSLRDQFPALVD-----DVDPMLAFASEA  150

Query  117  AGKSTAVVRFWRTDQQ  132
             G +   V  W  D++
Sbjct  151  FGNTPEAVNLWIGDER  166

>PYVX_13258
Length=646

 Score = 33.9 bits (76),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 60/143 (42%), Gaps = 24/143 (17%)

Query  118  GKSTAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAV  177
            G    VV  W T Q  R G+             +    VTA A +DD   FA G  +G V
Sbjct  199  GCEDGVVECWDTRQATRVGE----------LDAHSGSQVTALAFDDDGLTFATGSSDGIV  248

Query  178  ILFRSDLKRRTDRPPQLLQPAGQY--PVTGLSF--TSKPVTATVSHVFLYASTRRG--LT  231
             LF  DL  R+ RP  LL    QY  P+  + F   ++ V +T + V      R G  LT
Sbjct  249  KLF--DL--RSSRP--LLSKTHQYGLPIVNVQFHDYARKVLSTDAKVIKIWDPRDGQALT  302

Query  232  CYHCSHD--DPALVKSAGGAAAL  252
                  D  D  +V+SA G + +
Sbjct  303  NVETPADVNDVCVVESAQGQSGV  325

>PYAR_20912
Length=266

 Score = 33.1 bits (74),  Expect = 7.1, Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%)

Query  904  TKCDLCNHDLDLPAVHFMCQHSFHLNCIS---ETDRECITC  941
            T C +C   +  P     CQH FH++CI    +    C TC
Sbjct  72   TNCVVCMETMREPCAKLPCQHHFHIHCIEPWLKLHSTCPTC  112

>PYIR_16746
Length=335

 Score = 33.5 bits (75),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 68/180 (38%), Gaps = 34/180 (19%)

Query  36   GLICV-------GDADGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPR  88
            G++C+        D D F+++  R  E   F          V   R +    +G  + P 
Sbjct  32   GVLCLRDERAADSDNDTFLNMMERYFETTDF----------VEDARPDFHYQVG--VTPE  79

Query  89   LEELREQSKAIAEAGRAPNAEEMYTSKPAGKSTAVVRFWRTDQQDREGKPKLLQQIPIFA  148
            L+E      A AEA    +A        A K +    FWR   + +E K   L   P+  
Sbjct  80   LKENARNHCARAEALPKEHAPVSICPPEADKKSRF--FWRIGDRPKETKFSELNAEPVVP  137

Query  149  KKYPE-EAVTAF-------AANDDLSQFAVGLKNGAVILFRSDLKRRTDRPPQLLQPAGQ  200
            K +PE E+V          A  D +   A+GL      L +  L +R +  P LL P G 
Sbjct  138  KAFPEWESVMNMWGGKMMNAIRDLVEIAAIGLG-----LEKDTLSKRLEYGPHLLAPTGS  192

>SPRG_19519
Length=148

 Score = 32.0 bits (71),  Expect = 8.5, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 20/43 (47%), Gaps = 0/43 (0%)

Query  891  IAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  933
            +AQL S         C +C   +D   +   CQH+FH  CI E
Sbjct  56   LAQLPSWQAAPTDDACVICMSPMDDDRIALPCQHAFHHACIRE  98

>SDRG_12116
Length=226

 Score = 32.7 bits (73),  Expect = 9.1, Method: Composition-based stats.
 Identities = 19/74 (26%), Positives = 33/74 (45%), Gaps = 12/74 (16%)

Query  893  QLSSRAVVFQATKCDLCNHDLDLP-------AVHFMCQHSFHLNCISE---TDRECITCS  942
            Q ++RA++ +A  C +C  ++  P        V   C+H +H  C+ +   T + C  C 
Sbjct  152  QFTTRAILDEA--CAICLDEIQAPDLVDGRHVVQLPCRHVYHQRCVGQWLRTKQTCPLCR  209

Query  943  MDHRHILGLKTQLE  956
                 I GL+   E
Sbjct  210  DPTTQITGLRLACE  223

>CCI42121
Length=582

 Score = 33.1 bits (74),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (48%), Gaps = 3/44 (7%)

Query  901  FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET---DRECITC  941
            FQ+ +C +C ++L        C H FHL CI E      +C  C
Sbjct  227  FQSQECLICLNELQTNLATIQCGHVFHLICIKEALKYKEQCPIC  270

Lambda      K        H        a         alpha
   0.319    0.135    0.398    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 84058723350

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40