Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_13740111481661668892e-123
PPTG_09253111481661667989e-110
PHYSO_300767111481661667841e-107
PHYSO_300766485331661667841e-107
PHYCA_118037111481651657468e-102
PHALS_11565111481621576166e-82
PYIW_14755111481691606036e-80
PYU1_G005964111481761745681e-74
PYIR_15183111481871845483e-71
PYAP_22844111481781795431e-70
PHYRA_96081111481561074975e-64
SDRG_04481111481861624571e-57
SPRG_13308111481871604459e-56
H310_10665111481651614412e-55
PYAR_26061111481141114208e-53
H257_07013111481661624049e-50
SPRG_11879128323125953113e-36
PYVX_2085911148225952646e-28
PYAR_2450110578223978800.086
PYIR_1601138735561692.6
PHYKE_101162413413551654.7
H257_1261614495426127667.7
PYIW_19423795350346658.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_13740

Length=166
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PITG_13740                                                            347     2e-123
PPTG_09253                                                            311     9e-110
PHYSO_300767                                                          306     1e-107
PHYSO_300766                                                          306     1e-107
PHYCA_118037                                                          291     8e-102
PHALS_11565                                                           241     6e-82 
PYIW_14755                                                            236     6e-80 
PYU1_G005964                                                          223     1e-74 
PYIR_15183                                                            215     3e-71 
PYAP_22844                                                            213     1e-70 
PHYRA_96081                                                           196     5e-64 
SDRG_04481                                                            180     1e-57 
SPRG_13308                                                            176     9e-56 
H310_10665                                                            174     2e-55 
PYAR_26061                                                            166     8e-53 
H257_07013                                                            160     9e-50 
SPRG_11879                                                            124     3e-36 
PYVX_20859                                                            106     6e-28 
PYAR_24501                                                            35.4    0.086 
PYIR_16011                                                            31.2    2.6   
PHYKE_10116                                                           29.6    4.7   
H257_12616                                                            30.0    7.7   
PYIW_19423                                                            29.6    8.5   

>PITG_13740
Length=166

 Score = 347 bits (889),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
            INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI
Sbjct  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQSSSKQ  166
            SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQSSSKQ
Sbjct  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQSSSKQ  166

>PPTG_09253
Length=166

 Score = 311 bits (798),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MVRVKVRVFTFP DPRKQNSYVVGTIEGGLLPVVGTLNLDDKE +TVTFTQLRVRIEL+Q
Sbjct  1    MVRVKVRVFTFPPDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVSTVTFTQLRVRIELLQ  60

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
            + DVIRRS+MFQEVLAL+ATS NPH WPPNAMQTYWFGHF DESE++PHVIAA+DEDCPI
Sbjct  61   VKDVIRRSVMFQEVLALIATSPNPHNWPPNAMQTYWFGHFIDESETIPHVIAASDEDCPI  120

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQSSSKQ  166
            +Q+LNM TSK  GDLIL+PQTQLGPVCEQCCEGCTLCPPIQSS+ Q
Sbjct  121  NQFLNMITSKQTGDLILVPQTQLGPVCEQCCEGCTLCPPIQSSNNQ  166

>PHYSO_300767
Length=166

 Score = 306 bits (784),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKE ATVTF QLR RIEL+Q
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
              DVIRRS+MFQEVLAL+ATS+NPH WPPNAMQTY FGHF DE+E VPHVIAAADEDCPI
Sbjct  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQSSSKQ  166
            SQ+LNMTTSK  GDL+LIPQTQLGPVCE+CCEGC LCPPI+SSS Q
Sbjct  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ  166

>PHYSO_300766
Length=166

 Score = 306 bits (784),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKE ATVTF QLR RIEL+Q
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
              DVIRRS+MFQEVLAL+ATS+NPH WPPNAMQTY FGHF DE+E VPHVIAAADEDCPI
Sbjct  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQSSSKQ  166
            SQ+LNMTTSK  GDL+LIPQTQLGPVCE+CCEGC LCPPI+SSS Q
Sbjct  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ  166

>PHYCA_118037
Length=165

 Score = 291 bits (746),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 148/165 (90%), Gaps = 0/165 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MVRVKVRVFTFPSDPRKQNSYVVGT+EGGLLPVVGTLNLD+KE  TVTF QLR RIEL+Q
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTVEGGLLPVVGTLNLDEKETDTVTFAQLRPRIELLQ  60

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
              DVIRRS+MFQEVLAL+A S NPH WPPNAMQTYWFGHF DE+ES PHVI AADE+ PI
Sbjct  61   SKDVIRRSVMFQEVLALIAASPNPHGWPPNAMQTYWFGHFTDENESAPHVITAADENTPI  120

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQSSSK  165
            SQ+LNMTTSK  GDLIL+PQTQLGPVCEQCCEGC+LCP I S+++
Sbjct  121  SQFLNMTTSKQTGDLILVPQTQLGPVCEQCCEGCSLCPSINSNNQ  165

>PHALS_11565
Length=162

 Score = 241 bits (616),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 128/157 (82%), Gaps = 0/157 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            M+ VKVRVFTFPSDP+KQNSYVVG+IEGG LPVVGT+ +DDKEA T+TFTQLR RIEL+Q
Sbjct  1    MIHVKVRVFTFPSDPQKQNSYVVGSIEGGHLPVVGTILIDDKEATTITFTQLRQRIELLQ  60

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
            + D IRRS MFQEVLA +ATS N H WP   MQTYWFG+F DE   VPH+I AADE  P+
Sbjct  61   VKDEIRRSAMFQEVLAFIATSPNSHSWPQKFMQTYWFGYFADEGACVPHIITAADEIRPV  120

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLC  157
            SQ+ NM TSK + DLIL+PQTQ+GPVC QCC+ C +C
Sbjct  121  SQFTNMATSKQICDLILVPQTQIGPVCHQCCQSCKVC  157

>PYIW_14755
Length=169

 Score = 236 bits (603),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 2/160 (1%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MV VKVRVFTFPS PRKQNSYVVGT EGGLLP VGTL LDD E  +VTF QLR RIEL  
Sbjct  1    MVHVKVRVFTFPSSPRKQNSYVVGTWEGGLLPTVGTLKLDDSE--SVTFAQLRPRIELQN  58

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
             N +IRR++MFQEVLA++ATS NPH+WP +A+QTYWFG ++D  + VP V+  A ED P+
Sbjct  59   DNFMIRRALMFQEVLAIIATSPNPHRWPHSALQTYWFGFYEDLEQRVPTVLPVAVEDSPV  118

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPI  160
            S +LNM TSK  GDLILIPQTQ+GPVCE+CCEGC LCPPI
Sbjct  119  SAFLNMMTSKQTGDLILIPQTQVGPVCEKCCEGCALCPPI  158

>PYU1_G005964
Length=176

 Score = 223 bits (568),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 131/174 (75%), Gaps = 13/174 (7%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MV VK+RVFTFPS+PR+QNSYVVGT EGGLLP VGTL L++ E   +TF QLR RIEL  
Sbjct  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60

Query  61   INDVIR--------RSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIA  112
             N +IR        RS+MFQEVL +++TS NPH WP +A+QTYWFG+F D  + VP ++ 
Sbjct  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120

Query  113  A-----ADEDCPISQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQ  161
            A     ADED PIS +LNMTTSK  GDLILIPQTQ+GP+CE+CC+GC  CPP++
Sbjct  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVR  174

>PYIR_15183
Length=187

 Score = 215 bits (548),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 132/184 (72%), Gaps = 25/184 (14%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            M  +KVRVFTFPS PR+QNSYVVGT EGGLLP VGTL LD+ E   VTF QLR RIEL  
Sbjct  4    MAYLKVRVFTFPSSPREQNSYVVGTWEGGLLPTVGTLKLDNSEC--VTFAQLRPRIELQN  61

Query  61   INDVIRR-SIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAA------  113
             N +IR+  +MFQEVLA++ATS NPH+WP +A+QTYWFG F+D  +SVP +I+       
Sbjct  62   DNFMIRQVPLMFQEVLAIIATSPNPHQWPHSALQTYWFGFFEDLEQSVPTMISVRPSCGC  121

Query  114  ----------------ADEDCPISQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLC  157
                            +DED P+S +LNMTTSK  GDLILIPQTQ+GPVCE+CC+GC LC
Sbjct  122  DCTNPSTIDIAQWLQVSDEDSPVSTFLNMTTSKQTGDLILIPQTQVGPVCEKCCKGCALC  181

Query  158  PPIQ  161
            PPI+
Sbjct  182  PPIR  185

>PYAP_22844
Length=178

 Score = 213 bits (543),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 127/179 (71%), Gaps = 24/179 (13%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MVRVKVRVFTFPS+PR+QNSY+     GGLLP VG L L++ E  ++TF+QLR RIEL  
Sbjct  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAA------  114
             + +IRRS MFQEVL++++ S NPH+WP +A+QTYWFG+F D  ++VPH I         
Sbjct  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115

Query  115  -------------DEDCPISQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPI  160
                         +ED PIS+YL+MTTSKL GDLILIPQTQ GPVCE CC+GC  CPP+
Sbjct  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174

>PHYRA_96081
Length=156

 Score = 196 bits (497),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)

Query  6    VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQINDVI  65
            VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNL DKE ATVTF QLR+RIEL+Q  DVI
Sbjct  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106

Query  66   RRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIA  112
            RRS+MFQEVLAL+A SSNPH WPPNAMQTYWFGH+ DE++S+P VIA
Sbjct  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIA  153

>SDRG_04481
Length=186

 Score = 180 bits (457),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 113/162 (70%), Gaps = 2/162 (1%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            +VR+KVRVF FP DP  ++SYVVG+  GGL  V+G + ++D E   +TF  +R RIEL Q
Sbjct  2    VVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVVEDDE--DLTFQSVRPRIELQQ  59

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
               V+RR IM+QE L L+ + +NPH+WP  A+QTYW G++  E + VP +I  ADE    
Sbjct  60   DGSVLRRHIMYQEALFLMTSGANPHQWPVKALQTYWLGYYAHEDDLVPTIIPTADEHQSF  119

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQS  162
             ++L+M T+KL  DLILIPQ+Q+GPVC  CC+GC  CPPI +
Sbjct  120  REFLDMKTTKLTADLILIPQSQIGPVCNACCQGCAACPPIAA  161

>SPRG_13308
Length=187

 Score = 176 bits (445),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 111/160 (69%), Gaps = 2/160 (1%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            +VR+KVRVF FP DP  ++SYVVG+  GGL  V+G + +   +   +TF  +R RIEL Q
Sbjct  2    VVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVM--DDDDDLTFESVRPRIELQQ  59

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
               V RR IM+QE L L+ +S+NPH+WP  A+QTYW G++  E + VP VI  ADE  P+
Sbjct  60   DGSVQRRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIPTADEQKPL  119

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPI  160
               L+M T+KL  DLILIPQ+Q+GPVC  CC+GC +CPPI
Sbjct  120  RAVLDMKTTKLTADLILIPQSQIGPVCTACCQGCAVCPPI  159

>H310_10665
Length=165

 Score = 174 bits (441),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 111/161 (69%), Gaps = 2/161 (1%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            MVR+KVRVFTF  DP  ++SY+VG+  GGL   +G + LDD +   +TF  +R RIEL +
Sbjct  1    MVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLDDDD--DLTFASVRPRIELKE  58

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120
             N +IRR++MFQE L  +  + NPH+WP + +QTYW G++K+E +  P +I   DE   +
Sbjct  59   ENGLIRRNLMFQEALFQMTEARNPHQWPTHTLQTYWLGYYKNEDDMTPTIIPTEDEARSL  118

Query  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQ  161
               L+M ++K+  DLI++PQ+Q+GPVC  CC+GC LCP IQ
Sbjct  119  RDVLDMKSTKVTADLIIVPQSQIGPVCAMCCQGCALCPAIQ  159

>PYAR_26061
Length=114

 Score = 166 bits (420),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            ++RVKVRVFTFPSDPR QNSYVVGT+EGGLLP VGTL+LDD E  TVTF QLR R+EL  
Sbjct  2    VLRVKVRVFTFPSDPRLQNSYVVGTMEGGLLPTVGTLSLDDSEKDTVTFAQLRPRLELRD  61

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVI  111
             + +IRRS +FQEVLA+ + S NPH WP +A+QTYWFG F+D SE+VPH I
Sbjct  62   DDGMIRRSALFQEVLAIASASRNPHGWPVSALQTYWFGFFQDPSETVPHAI  112

>H257_07013
Length=166

 Score = 160 bits (404),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 108/162 (67%), Gaps = 3/162 (2%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
            +VR+KVRVFTF  DP  ++SY+VG+  GGL   +G + L+D E   +TF  +R RIEL +
Sbjct  2    VVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLEDDE--DLTFESVRPRIELKE  59

Query  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCP-  119
             N +IRR+ MFQE L  +  + NPH+WP + +QTYW G+++ E +  P +I   D     
Sbjct  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKC  119

Query  120  ISQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQ  161
            +   L+M ++K+  DLI+IPQ+Q+GPVC QCC+ C LCP IQ
Sbjct  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161

>SPRG_11879
Length=125

 Score = 124 bits (311),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 69/95 (73%), Gaps = 0/95 (0%)

Query  66   RRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPISQYLN  125
            RR IM+QE L L+ +S+NPH+WP  A+QTYW G++  E + VP VI  ADE  P+   L+
Sbjct  3    RRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIPTADEQKPLRAVLD  62

Query  126  MTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPI  160
            M ++KL  DLILIPQ+Q+GPVC  CC+GC  CPPI
Sbjct  63   MKSTKLTADLILIPQSQIGPVCNACCQGCAECPPI  97

>PYVX_20859
Length=225

 Score = 106 bits (264),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 4/95 (4%)

Query  1   MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60
           MVRVKVRVFTFPSDPR+QNSY+VGT EGGLLPVVGTLN++D E  T++F+QLR RIEL  
Sbjct  1   MVRVKVRVFTFPSDPREQNSYLVGTSEGGLLPVVGTLNVEDAEQDTISFSQLRPRIELKN  60

Query  61  INDVIR--RSIMFQEVLALVA--TSSNPHKWPPNA  91
            N+++R  RS      L ++A  T+  PH   P  
Sbjct  61  DNNMVRCVRSAALPVSLIMMAILTAPQPHTHVPGG  95

>PYAR_24501
Length=239

 Score = 35.4 bits (80),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 37/78 (47%), Gaps = 11/78 (14%)

Query  38   NLDDKEAATVTFTQLRVRIELVQIN--DVIRRSIMFQEVLALVATSSNPHKWPP----NA  91
             L+D     +T TQLR R+ L Q+   DV++R+ + Q V+         H WP       
Sbjct  84   KLNDDLVWDLTITQLRTRLLLAQVKTTDVLQRAQVAQAVILPKLLYIGRHVWPSATRLRT  143

Query  92   MQTY-----WFGHFKDES  104
            +Q Y     WFG F++ +
Sbjct  144  LQRYTHNYVWFGRFEERA  161

>PYIR_16011
Length=355

 Score = 31.2 bits (69),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 29/61 (48%), Gaps = 8/61 (13%)

Query  63   DVIRRSIMFQEVLALVATSSNPHKW-------PPNAMQTYWFGHFKDESESVPHVIAAAD  115
            D +RRS++  +  A +AT  N HK         P      WF  ++ E E+  HV+ A D
Sbjct  27   DAVRRSVVQGDAAAFIATL-NEHKLLAATKHNSPLLFLMDWFHTWQQEYEAFVHVLEAED  85

Query  116  E  116
            E
Sbjct  86   E  86

>PHYKE_10116
Length=135

 Score = 29.6 bits (65),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 6/51 (12%)

Query  14  DPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQINDV  64
           DP K  SYV G + G     VG   L D  AAT  F   ++  + V++N V
Sbjct  4   DPSKAGSYVAGLLVG-----VGWWVLADG-AATAAFHNSQIPFDFVKVNTV  48

>H257_12616
Length=4261

 Score = 30.0 bits (66),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  58    LVQINDVIRRSIMFQEVLALVATSSNP  84
             LVQ+ DV  R+I F+E +AL+  SS P
Sbjct  3916  LVQLGDVNVRNIGFRETIALIKGSSRP  3942

>PYIW_19423
Length=503

 Score = 29.6 bits (65),  Expect = 8.5, Method: Composition-based stats.
 Identities = 16/46 (35%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  74   VLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCP  119
            V +++A+S     + P  M  Y F     E ESVP ++  + EDCP
Sbjct  214  VASMLASSRASEHFLPGRMY-YTFSLNAKEIESVPVIVQRSKEDCP  258

Lambda      K        H        a         alpha
   0.320    0.135    0.410    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5981562426

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40