Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_560347111501010101053910.0
PPTG_09255111501008101052510.0
PITG_13745111501008101051820.0
PHYCA_570034111501011101251770.0
PHALS_11566111501009101051090.0
PHYRA_8167811150975101450160.0
HYAP_08497111501007101349660.0
PYVX_13921111501041104347240.0
PYIW_14752111501031103546760.0
PYU1_G005966111501030103446660.0
PYIR_15175111501030103346470.0
PYAP_248831115098099842450.0
CCA179911115096599439250.0
CCI4083111150116398637440.0
SDRG_14094111501003104234360.0
H310_11729111501002104333610.0
SPRG_03282111501004104333450.0
H257_1278711150968103233270.0
PHYKE_64071115093463331730.0
PYAR_247791115069969728460.0
PYAR_2437410571032532612813e-168
PYAP_197456156725109870.37
H310_1052314050926264830.53
PYIR_167906156744122850.55
PYIR_1752579041023156850.61
PYAP_25178535528681830.64
SPRG_1363913724917962800.82
PYAP_13607481027038820.85
SPRG_1487013028824662810.93
PYAP_2293179041059163831.2
PHALS_11598136771421111821.3
PHALS_035389291903116821.3
PYIW_1485779041013156811.6
PYAP_13333503346125801.6
PYU1_G0112626156730124811.6
PYVX_1323979041021179811.7
PYVX_132586156646170802.0
PYU1_G00795579041018156802.4
PYVX_16007966009043722.5
SDRG_1014613376122054763.3
CCA20583329736544773.7
H257_0392513993329062764.5
PYIR_1674650333583764.9
HYAP_07166645217632695.7
SDRG_017811475633573765.8
H310_13109140806348109765.8
PHYRA_765928344488550765.9
PHYRA_737466974226891756.4
PYAP_21787154352046766.7
PYAR_20912481026641746.7
SPRG_1951913376114843718.3
CCI42121329758244758.9
SDRG_1211612945922674739.2
SPRG_063361475633571749.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_560347

Length=1011
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYSO_560347                                                          2081    0.0   
PPTG_09255                                                            2027    0.0   
PITG_13745                                                            2000    0.0   
PHYCA_570034                                                          1998    0.0   
PHALS_11566                                                           1972    0.0   
PHYRA_81678                                                           1936    0.0   
HYAP_08497                                                            1917    0.0   
PYVX_13921                                                            1824    0.0   
PYIW_14752                                                            1805    0.0   
PYU1_G005966                                                          1801    0.0   
PYIR_15175                                                            1794    0.0   
PYAP_24883                                                            1639    0.0   
CCA17991                                                              1516    0.0   
CCI40831                                                              1446    0.0   
SDRG_14094                                                            1328    0.0   
H310_11729                                                            1299    0.0   
SPRG_03282                                                            1293    0.0   
H257_12787                                                            1286    0.0   
PHYKE_6407                                                            1226    0.0   
PYAR_24779                                                            1100    0.0   
PYAR_24374                                                            498     3e-168
PYAP_19745                                                            38.1    0.37  
H310_10523                                                            36.6    0.53  
PYIR_16790                                                            37.4    0.55  
PYIR_17525                                                            37.4    0.61  
PYAP_25178                                                            36.6    0.64  
SPRG_13639                                                            35.4    0.82  
PYAP_13607                                                            36.2    0.85  
SPRG_14870                                                            35.8    0.93  
PYAP_22931                                                            36.6    1.2   
PHALS_11598                                                           36.2    1.3   
PHALS_03538                                                           36.2    1.3   
PYIW_14857                                                            35.8    1.6   
PYAP_13333                                                            35.4    1.6   
PYU1_G011262                                                          35.8    1.6   
PYVX_13239                                                            35.8    1.7   
PYVX_13258                                                            35.4    2.0   
PYU1_G007955                                                          35.4    2.4   
PYVX_16007                                                            32.3    2.5   
SDRG_10146                                                            33.9    3.3   
CCA20583                                                              34.3    3.7   
H257_03925                                                            33.9    4.5   
PYIR_16746                                                            33.9    4.9   
HYAP_07166                                                            31.2    5.7   
SDRG_01781                                                            33.9    5.8   
H310_13109                                                            33.9    5.8   
PHYRA_76592                                                           33.9    5.9   
PHYRA_73746                                                           33.5    6.4   
PYAP_21787                                                            33.9    6.7   
PYAR_20912                                                            33.1    6.7   
SPRG_19519                                                            32.0    8.3   
CCI42121                                                              33.5    8.9   
SDRG_12116                                                            32.7    9.2   
SPRG_06336                                                            33.1    9.4   

>PHYSO_560347
Length=1010

 Score = 2081 bits (5391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1010/1010 (100%), Positives = 1010/1010 (100%), Gaps = 0/1010 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120
             AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240
             KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP
Sbjct  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360
             GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA
Sbjct  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360

Query  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGDLT  540
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGDLT
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGDLT  540

Query  541   PRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSV  600
             PRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSV
Sbjct  541   PRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSV  600

Query  601   ALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGN  660
             ALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGN
Sbjct  601   ALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGN  660

Query  661   PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARS  720
             PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARS
Sbjct  661   PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARS  720

Query  721   VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD  780
             VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD
Sbjct  721   VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD  780

Query  781   QSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPL  840
             QSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPL
Sbjct  781   QSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPL  840

Query  841   QVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRA  900
             QVVQVLSQSRELPVSVIKQYVVNQLANDEKKIEEDEEKIKAFKSDTKQMKEEIAQLSSRA
Sbjct  841   QVVQVLSQSRELPVSVIKQYVVNQLANDEKKIEEDEEKIKAFKSDTKQMKEEIAQLSSRA  900

Query  901   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  960
             VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK
Sbjct  901   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  960

Query  961   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  961   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010

>PPTG_09255
Length=1008

 Score = 2027 bits (5251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 985/1010 (98%), Positives = 993/1010 (98%), Gaps = 2/1010 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120
             AHELFVSHVVMMKRSNVLVTIGDGIDPR +ELREQSKAIAEAGR PNAEEMYTSKP+GKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPDELREQSKAIAEAGRSPNAEEMYTSKPSGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240
             +SDLKRRADRPP LLQPAGQYPVTGL+FTSKPVTATV+HVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRADRPPHLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360
             GEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLA NA
Sbjct  301   GEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R PGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGDLT  540
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTK  SDSGDLT
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKSDSDSGDLT  540

Query  541   PRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSV  600
             PRNG  AAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS 
Sbjct  541   PRNG--AAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSA  598

Query  601   ALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGN  660
             ALS+SEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMP PTTELLKRLCTGKFVPGN
Sbjct  599   ALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGN  658

Query  661   PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARS  720
             PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDE E G RS
Sbjct  659   PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEEEGGTRS  718

Query  721   VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD  780
             VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD
Sbjct  719   VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD  778

Query  781   QSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPL  840
             QSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT GEEWKELKQLLALIDTNPAIPPL
Sbjct  779   QSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPL  838

Query  841   QVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRA  900
             QVVQVLSQSRELPVSVIKQYVVNQLA+DEKKIEEDEEKIKAFK DTKQMKEEIAQLSSRA
Sbjct  839   QVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSSRA  898

Query  901   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  960
             VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK
Sbjct  899   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  958

Query  961   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  959   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008

>PITG_13745
Length=1008

 Score = 2000 bits (5182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 979/1010 (97%), Positives = 994/1010 (98%), Gaps = 2/1010 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVD+TSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120
             AHELFVSHVVMMKRSNVLVTIGDGIDPR EELREQSKAIAEAGR PNAEEMYTSKP GKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIP+FAKKYPEEAVTAFA NDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180

Query  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240
             +SDLKRR DRPPQLLQPAGQYPVTGL+FTSKPVTATV+HVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360
             GEKK+LRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLA NA
Sbjct  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R PGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGDLT  540
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTK  SDSG+LT
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSGELT  540

Query  541   PRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSV  600
             PRNG  A ANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS 
Sbjct  541   PRNG--AVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSA  598

Query  601   ALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGN  660
             ALS+SEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMP PTTELLKRLCTGKFVPGN
Sbjct  599   ALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGN  658

Query  661   PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARS  720
             PS+KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG RS
Sbjct  659   PSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGKRS  718

Query  721   VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD  780
             +EEKEEAVLRILDNPRVKYDEDHALIHLQMHGMK+GKRYLYNKLHMYHMLVQFHIEENDD
Sbjct  719   IEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEENDD  778

Query  781   QSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPL  840
             QSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT GEEWKELKQLLALIDTNPAIPPL
Sbjct  779   QSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPL  838

Query  841   QVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRA  900
             QVVQVLSQSRELPVSVIKQYVVNQLA+DEKKIEEDEEKIKAFK+DTKQMK+EIAQLSSRA
Sbjct  839   QVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKNDTKQMKDEIAQLSSRA  898

Query  901   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  960
             VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK
Sbjct  899   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  958

Query  961   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  959   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008

>PHYCA_570034
Length=1011

 Score = 1998 bits (5177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 982/1012 (97%), Positives = 995/1012 (98%), Gaps = 3/1012 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120
             AHELFVSHVVMMKRSNVLVTIGDGIDPR EELREQSKAIAEAGR PNAEEMYTSKPTGKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPEELREQSKAIAEAGRTPNAEEMYTSKPTGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIP+FAKKYPEEAVTAFAVNDDL+QFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLTQFAVGLKNGAVILF  180

Query  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240
             +SDLKRR DRPP LLQPAGQYPVTGL+F SKPVTATV+HVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRTDRPPHLLQPAGQYPVTGLSFASKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVD+NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDVNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360
             GEK+YL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLA NA
Sbjct  301   GEKRYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R PGARFGLDEMEEVRHVVCEFGAIFVVSSMGH+YRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHIYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK--TKGGSDSGD  538
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK  TK GSDSGD
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKNGTKSGSDSGD  540

Query  539   LTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  598
             LTPRNGG AAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED
Sbjct  541   LTPRNGG-AAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  599

Query  599   SVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVP  658
             S ALS+SEKERVADALEYIEHLSFSEADSNLRKYGRTLVTH+PGPTTELLKRLCTGKFVP
Sbjct  600   SAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHLPGPTTELLKRLCTGKFVP  659

Query  659   GNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGA  718
             GNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDD+GENG 
Sbjct  660   GNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDDGENGT  719

Query  719   RSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEEN  778
             RSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEEN
Sbjct  720   RSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEEN  779

Query  779   DDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIP  838
             DDQSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT GEEWKELKQLLALIDTNPAIP
Sbjct  780   DDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIP  839

Query  839   PLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSS  898
             PLQVVQVLSQSRELPVSVIKQYVVNQLA+DEKKIEEDEEKIKAFK DTKQMKEEI QLSS
Sbjct  840   PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEITQLSS  899

Query  899   RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLE  958
             RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLE
Sbjct  900   RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLE  959

Query  959   QKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             QKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  960   QKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1011

>PHALS_11566
Length=1009

 Score = 1972 bits (5109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 951/1010 (94%), Positives = 982/1010 (97%), Gaps = 1/1010 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADG V+LANRS+EARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGSVYLANRSMEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120
             AHE+FVSHVVMMKRSNVLVTIGDGIDPR EELREQSK IAEAGR PNAE+MYT+KPTGKS
Sbjct  61    AHEMFVSHVVMMKRSNVLVTIGDGIDPRSEELREQSKVIAEAGRAPNAEDMYTAKPTGKS  120

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180
             TA+VRFWRTDQQDREGKPKL+QQIP+FAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  121   TAIVRFWRTDQQDREGKPKLMQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240
             +SDLKRRADRPP LLQPAGQYPVTGLAFTSKPVT T++HVFLYAST RGLTCYHCSHDDP
Sbjct  181   RSDLKRRADRPPHLLQPAGQYPVTGLAFTSKPVTVTLSHVFLYASTGRGLTCYHCSHDDP  240

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGV+MNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVEMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360
             GEKK++ FFKHYL+VAHVDPRGRHQVNVYDLQNKFIAFNWTLTST+ KGP+RK PL+ NA
Sbjct  301   GEKKFVCFFKHYLIVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTSSKGPIRKAPLSLNA  360

Query  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R PGARFG+DEMEE+RHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGIDEMEEIRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGDLT  540
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDV+KLDKFIQLDEVIDAKKTK   +SGDL 
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVQKLDKFIQLDEVIDAKKTKTDRNSGDLM  540

Query  541   PRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSV  600
              RNGG A ANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS 
Sbjct  541   LRNGG-ATANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSA  599

Query  601   ALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGN  660
             ALS+SEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMP PTTELLKRLCTGKFVP N
Sbjct  600   ALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPSN  659

Query  661   PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARS  720
             PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVET+SNTSIGNTLLEMVLSDDDEGENG RS
Sbjct  660   PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETISNTSIGNTLLEMVLSDDDEGENGLRS  719

Query  721   VEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDD  780
             VEEKE+AVLRILDNPRVKYDEDHALIHLQMH MKKGKRYLYNKLHMYHMLVQFHIEE+DD
Sbjct  720   VEEKEDAVLRILDNPRVKYDEDHALIHLQMHSMKKGKRYLYNKLHMYHMLVQFHIEESDD  779

Query  781   QSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPL  840
             QSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGA  GEEWKELKQLL LIDTNPAIPPL
Sbjct  780   QSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGAIDGEEWKELKQLLVLIDTNPAIPPL  839

Query  841   QVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRA  900
             QVVQVLSQSRELPVSVIKQYVV+QLANDEKKIEEDEEKIKAFKSDTKQMK+EIAQLSSRA
Sbjct  840   QVVQVLSQSRELPVSVIKQYVVSQLANDEKKIEEDEEKIKAFKSDTKQMKDEIAQLSSRA  899

Query  901   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  960
             VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDREC+TCSMDHRHILGLK+QLEQK
Sbjct  900   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECLTCSMDHRHILGLKSQLEQK  959

Query  961   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             AGNHEQFYNQLETA DGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  960   AGNHEQFYNQLETAVDGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1009

>PHYRA_81678
Length=975

 Score = 1936 bits (5016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 951/1014 (94%), Positives = 961/1014 (95%), Gaps = 43/1014 (4%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDA+GPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDASGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120
             AHELFVSHVVMM                                       YTSKPTGK+
Sbjct  61    AHELFVSHVVMM---------------------------------------YTSKPTGKT  81

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  82    TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  141

Query  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240
             +SDLKRR DRPP LLQPAGQYPVTGL FTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP
Sbjct  142   RSDLKRRTDRPPHLLQPAGQYPVTGLEFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  201

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  202   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  261

Query  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360
             GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLA NA
Sbjct  262   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  321

Query  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R PGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  322   RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  381

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGD+DGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  382   LAFSSNYDVNSIIDIFRMYGDHLYQKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  441

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK---TKGGSDSG  537
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDA+K   TK GSDSG
Sbjct  442   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDARKANGTKSGSDSG  501

Query  538   DLTPRNGGA-AAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDS  596
             D TPRNGG  AAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDS
Sbjct  502   DTTPRNGGGGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDS  561

Query  597   EDSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKF  656
             EDSVALS++EKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKF
Sbjct  562   EDSVALSENEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKF  621

Query  657   VPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGEN  716
             VPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGEN
Sbjct  622   VPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGEN  681

Query  717   GARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIE  776
             GARS+EEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIE
Sbjct  682   GARSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIE  741

Query  777   ENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPA  836
             ENDDQSILEEVRKHG+KD NLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPA
Sbjct  742   ENDDQSILEEVRKHGEKDLNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPA  801

Query  837   IPPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQL  896
             IPPLQVVQVLSQSRELPVSVIKQYVVNQLA+DEKKIEEDEEKIKAFK DTKQMKEEIAQL
Sbjct  802   IPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQL  861

Query  897   SSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQ  956
             SSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQ
Sbjct  862   SSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQ  921

Query  957   LEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             LEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  922   LEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  975

>HYAP_08497
Length=1007

 Score = 1917 bits (4966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 945/1013 (93%), Positives = 971/1013 (96%), Gaps = 9/1013 (1%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADG+VHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120
             AHELFVSHVVMMKRSNVL TIGDGIDPR +ELREQSKAIAEAGR PNAEE     PTGKS
Sbjct  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEE-----PTGKS  115

Query  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180
             TAVVRFWRTD QDREGKPKLLQQIP+FAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  116   TAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  175

Query  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240
             +SDLKRR DRP  LLQPAGQYPVTGL+F SKPVTAT  HVFLYASTRRGLTCYHCSHDDP
Sbjct  176   RSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDP  235

Query  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             ALVKS GGAAALPPRTTVLDERGVD+NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FE
Sbjct  236   ALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFE  295

Query  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360
             GEKKYL FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLA N+
Sbjct  296   GEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNS  355

Query  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
             R   ARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  356   RTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  415

Query  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  416   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  475

Query  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKG---GSDSG  537
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT G    +D+ 
Sbjct  476   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDAS  535

Query  538   DLTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSE  597
             DL  ++GG AA NLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSE
Sbjct  536   DLALKDGGGAA-NLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVDSE  594

Query  598   DSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFV  657
             DS ALS+SEKERVADALEYI+HLSFSEADSNLRKYGRTLVTHMPGP TELLKRLCTGK+V
Sbjct  595   DSAALSESEKERVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYV  654

Query  658   PGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG  717
             P +PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG
Sbjct  655   PEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG  714

Query  718   ARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEE  777
              RSVEEKEE+VLRILDNPRVKYDEDHALIHLQM GMKKGKRYLYNKLHMYHMLVQFHIEE
Sbjct  715   GRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEE  774

Query  778   NDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAI  837
             NDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSG+EW+EL+QLL LIDTN AI
Sbjct  775   NDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAI  834

Query  838   PPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLS  897
             PPLQVVQVLSQSRELPVSVIKQYVVNQLA+DEKKIEEDEEKIKAF+SDTKQMKEEIAQLS
Sbjct  835   PPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFRSDTKQMKEEIAQLS  894

Query  898   SRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQL  957
             SRAVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDRECI+CSMDHRHILGLKTQL
Sbjct  895   SRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQL  954

Query  958   EQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             EQKAGNHEQFYNQLETAADGF+TIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  955   EQKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007

>PYVX_13921
Length=1041

 Score = 1824 bits (4724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 903/1043 (87%), Positives = 958/1043 (92%), Gaps = 35/1043 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMK-----------------GVDITSMSANRGLICVGDA  43
             MAQWRRFAFFDKEVLKDANGPWMK                 GVDITSMSANRG+ICVGDA
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKSLDANFFRRLVVPDAIQGVDITSMSANRGMICVGDA  60

Query  44    DGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAG  103
             DGFVHLANR LEARKFQAHE FVSHVVMMKRSNVLVT+GDGIDPR EEL+ QSKAIAEAG
Sbjct  61    DGFVHLANRQLEARKFQAHENFVSHVVMMKRSNVLVTVGDGIDPRSEELKAQSKAIAEAG  120

Query  104   RGPNAEEMYTSKPTGKSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVND  163
             R  NAEEM+T K +GKSTAVVRFWRTDQQDR+GKPKLLQQ+P+FAKKYPEEAVTAFAV+D
Sbjct  121   RSGNAEEMFTPKQSGKSTAVVRFWRTDQQDRDGKPKLLQQVPIFAKKYPEEAVTAFAVHD  180

Query  164   DLSQFAVGLKNGAVILFKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLY  223
             D+SQFAVGLKNGAVILF+SDLKRR+DRPP LLQPAGQYPVTGLAFTSKP+TATV+HVFLY
Sbjct  181   DVSQFAVGLKNGAVILFRSDLKRRSDRPPHLLQPAGQYPVTGLAFTSKPITATVSHVFLY  240

Query  224   ASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTD  283
             ASTRRGLTCYHC+HDDPA+ K+AG AA +PPRT VLDERGVDM+CSCVN+EGE+AVGQTD
Sbjct  241   ASTRRGLTCYHCTHDDPAVTKAAG-AAGMPPRTVVLDERGVDMSCSCVNDEGELAVGQTD  299

Query  284   AVYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT  343
             AVYFYTTEDRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT
Sbjct  300   AVYFYTTEDRSVCFGFEGEKKYLSFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT  359

Query  344   STN--PKGPMRKPPLAPNARVP-------GARFGLDEMEEVRHVVCEFGAIFVVSSMGHV  394
             STN   KG  R+PPLAPNAR         GARFGLDEMEE+RHVVCEFGAIFVVSS+GHV
Sbjct  360   STNSNAKGGARRPPLAPNARXXXXXXXXXGARFGLDEMEEIRHVVCEFGAIFVVSSVGHV  419

Query  395   YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLR  454
             YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLYQKGD+DGSLR
Sbjct  420   YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDFDGSLR  479

Query  455   QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK  514
             QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK
Sbjct  480   QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK  539

Query  515   LDKFIQLDEVIDAKKTKGGSDSGDLTPRNGGAAAA-----NLNFDVETAISVLWENYPQH  569
             LDKFIQLDEVID+ K     +S    PR+           N NFDVETAISVLWENYP+H
Sbjct  540   LDKFIQLDEVIDSSKKAADRNSIAKLPRSSDETGLDGKRDNPNFDVETAISVLWENYPKH  599

Query  570   ALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNL  629
             ALTLAKK+EEHSWYLKIQLD ISYV+SEDSVALSD EKERV DALEYI+HLSFSEADSNL
Sbjct  600   ALTLAKKYEEHSWYLKIQLDRISYVESEDSVALSDHEKERVTDALEYIKHLSFSEADSNL  659

Query  630   RKYGRTLVTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIV  689
             RKYGRTLVTH+PGPTTELLK+LCTGKFVPGN SLKSDPGDFLHLFVSHRAQLKEFLQYIV
Sbjct  660   RKYGRTLVTHLPGPTTELLKQLCTGKFVPGNSSLKSDPGDFLHLFVSHRAQLKEFLQYIV  719

Query  690   EVETVSNTSIGNTLLEMVLSDDDEGENGA--RSVEEKEEAVLRILDNPRVKYDEDHALIH  747
             EVETV+NTSIGNTLLEMVLSDD E   G+  R+  EKE+AV+ ILDNPRVKYDEDHALIH
Sbjct  720   EVETVTNTSIGNTLLEMVLSDDSEDAEGSAPRTDAEKEDAVMLILDNPRVKYDEDHALIH  779

Query  748   LQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAE  807
             LQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAE
Sbjct  780   LQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAE  839

Query  808   RGPLPKGATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLAN  867
             RGPLPKGATSGEEWKELKQLLALIDTNP IPPLQVVQVLSQSRELPVSV+KQY+VNQLAN
Sbjct  840   RGPLPKGATSGEEWKELKQLLALIDTNPVIPPLQVVQVLSQSRELPVSVVKQYIVNQLAN  899

Query  868   dekkieedeekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHS  927
             DE+KI EDEEKIKAFK DTKQMKEEI+QLSS+AVVFQATKCDLCNHDLDLPAVHFMCQHS
Sbjct  900   DERKIAEDEEKIKAFKGDTKQMKEEISQLSSKAVVFQATKCDLCNHDLDLPAVHFMCQHS  959

Query  928   FHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGK  987
             FHLNCISET+REC+TCS+DHRHI+GLKTQLEQKAGNHEQFYNQLETAADGF+TIAEYFGK
Sbjct  960   FHLNCISETERECMTCSLDHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGK  1019

Query  988   GIFKSNEVVLDEGSFETRFSAEF  1010
             GIFKSNEV  D+GSFETRFSAEF
Sbjct  1020  GIFKSNEVA-DDGSFETRFSAEF  1041

>PYIW_14752
Length=1031

 Score = 1805 bits (4676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 893/1035 (86%), Positives = 942/1035 (91%), Gaps = 29/1035 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDITSMSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNA-EEMYTSKPTGK  119
             AHE FVSHVVMMKRSN+LV+IGDG+D R EELR QSKA+AEAGR  N+ EEMY SK TGK
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120

Query  120   STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  179
             +TAVVR WRTDQQDR+GKPKLLQQIPVFAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180

Query  180   FKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDD  239
             F++DLKRR+DRPP LLQPAGQYPVTGL FTSKPVT T +HVFLYASTRRGLTCYHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240

Query  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG  + LPPRT VLDERGVD NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  241   PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357
             EGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGSTGGRKLSVA  359

Query  358   PNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417
             PN R PGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419

Query  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK--------  529
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK        
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLL  539

Query  530   TKGGSDSGDLTPRNGG--------------AAAANLNFDVETAISVLWENYPQHALTLAK  575
                GS SGD    + G              A AA LNFD+ETAISVLWENYPQHALTLAK
Sbjct  540   IANGSSSGDRKVSHSGQDGLSGGADGGKKRAGAAALNFDIETAISVLWENYPQHALTLAK  599

Query  576   KHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRT  635
             KHEEHSWYLKIQLD ISYV+SEDSVALS  EKERVADALEYI+HLSFSEADSNLRKYGRT
Sbjct  600   KHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT  659

Query  636   LVTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  695
             LVTH+PGPTTELLK+LCTGKFVPGN  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS
Sbjct  660   LVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  719

Query  696   NTSIGNTLLEMVLSDDDEGENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKK  755
             NTSIGNTLLEMVLS      +  RS EE E+AV+ ILDNPRVKYDEDHALIHLQM G+KK
Sbjct  720   NTSIGNTLLEMVLSG---SADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKK  776

Query  756   GKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGA  815
             GKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAERGPLPKGA
Sbjct  777   GKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGA  836

Query  816   TSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieed  875
             TSGEEWKELKQLL LID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL NDEKKIEED
Sbjct  837   TSGEEWKELKQLLVLIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEED  896

Query  876   eekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  935
             +EKIKAFKSDTKQMKEEIAQL  +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE
Sbjct  897   DEKIKAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  956

Query  936   TDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEV  995
             T+RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKSNEV
Sbjct  957   TERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEV  1016

Query  996   VLDEGSFETRFSAEF  1010
              +D+GSF+ RFSAEF
Sbjct  1017  PVDDGSFDMRFSAEF  1031

>PYU1_G005966
Length=1030

 Score = 1801 bits (4666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 890/1034 (86%), Positives = 944/1034 (91%), Gaps = 28/1034 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKD NG W+KGVDITSMSANRG+ICVGD DGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDGNGLWLKGVDITSMSANRGMICVGDGDGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPN-AEEMYTSKPTGK  119
             AHE FVSHVVMMKRSN+LV+IGDGIDPR  ELR QSKA+A+AGR  N AEEM+ SK TGK
Sbjct  61    AHENFVSHVVMMKRSNILVSIGDGIDPRSAELRAQSKAVADAGRSANSAEEMFASKQTGK  120

Query  120   STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  179
             +TAVVR WRTDQQDR+GKPKLLQQIPVFAKKYPEEAVTAFAVNDD+SQ AVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQLAVGLKNGAVIL  180

Query  180   FKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDD  239
             F++DLKRR+DRPP LLQPAGQYPVTGL FTSKPVT TV+HVFLYASTRRGLTCYHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVFLYASTRRGLTCYHCTHDD  240

Query  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG A+ LPPRT VLDERGVD NCSCVN+EGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  241   PALVKSAG-ASGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357
             EGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KGP   RKPP+A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTSKGPAGGRKPPIA  359

Query  358   PNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417
             PN+R PGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  360   PNSRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419

Query  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK--------  529
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE++D KK        
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIVDGKKNDLSGGDA  539

Query  530   ---TKGGSDSGD-LTPRNGGAAA---------ANLNFDVETAISVLWENYPQHALTLAKK  576
                  G   +GD L  R+  A A         A LNFDVETAISVLWENYPQHALTLAKK
Sbjct  540   LSAVNGTGAAGDKLAKRDSSAGAETAQKGPGTAALNFDVETAISVLWENYPQHALTLAKK  599

Query  577   HEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTL  636
             HEEHSWYLKIQLD ISYV+SEDSVALS  EKERVADALEYI+HLSFSEADSNLRKYGRTL
Sbjct  600   HEEHSWYLKIQLDRISYVESEDSVALSTHEKERVADALEYIKHLSFSEADSNLRKYGRTL  659

Query  637   VTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN  696
             VTH+P PTTELLK+LCTGKFVP N  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN
Sbjct  660   VTHLPEPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN  719

Query  697   TSIGNTLLEMVLSDDDEGENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKG  756
             TSIGNTLLEMVLS   E  +  R+ EE E+AV+ ILDNPRVKYDEDHALIHLQM G+KKG
Sbjct  720   TSIGNTLLEMVLS---ETADEKRTEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKG  776

Query  757   KRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGAT  816
             KRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAERGPLPKGAT
Sbjct  777   KRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGAT  836

Query  817   SGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieede  876
             +GEEW+ELKQLLALID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL NDEKKIEEDE
Sbjct  837   TGEEWRELKQLLALIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEEDE  896

Query  877   ekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET  936
             EKIKAFKSDTKQMKEEI QLS +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET
Sbjct  897   EKIKAFKSDTKQMKEEITQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET  956

Query  937   DRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVV  996
             +RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKSNEV 
Sbjct  957   ERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVP  1016

Query  997   LDEGSFETRFSAEF  1010
             +D+GSF+ RFS EF
Sbjct  1017  IDDGSFDARFSNEF  1030

>PYIR_15175
Length=1030

 Score = 1794 bits (4647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 888/1033 (86%), Positives = 945/1033 (91%), Gaps = 26/1033 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDIT+MSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITTMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPN-AEEMYTSKPTGK  119
             AHE FVSHVVMMKRSN+LV+IGDGIDPR +ELR QSKA+AEAGR  N AEEMY SK TGK
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGIDPRSDELRAQSKAVAEAGRSANSAEEMYASKQTGK  120

Query  120   STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  179
             +TAVVR WRTDQQDR+GKPKLLQQIPVFAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180

Query  180   FKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDD  239
             F++DLKRR+DRPP LLQPAGQYPVTGL FTSKPVT TV+HV+LYASTRRGLT YHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVYLYASTRRGLTVYHCTHDD  240

Query  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG AA LPPRT VLDERGVD NCSCVN+EGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  241   PALVKSAG-AAGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357
             EGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KGP+  RKPP+A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGPVGGRKPPVA  359

Query  358   PNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417
             PN R PGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNL+SI
Sbjct  360   PNTRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLFSI  419

Query  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT-------  530
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE++D KK+       
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEILDGKKSDLNGDLL  539

Query  531   --KGGSDSGDLTPRNGGA-----------AAANLNFDVETAISVLWENYPQHALTLAKKH  577
                G   +GD   +  G+             A LNFDVETAISVLWENYPQHALTLAKKH
Sbjct  540   IANGNGTAGDKKAKQDGSVGGADGGKKGPGTAALNFDVETAISVLWENYPQHALTLAKKH  599

Query  578   EEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLV  637
             EEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLRKYGRTLV
Sbjct  600   EEHSWYLKIQLDRISYVESEDSAALSAHEKERVADALEYIKHLSFSEADSNLRKYGRTLV  659

Query  638   THMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT  697
             TH+PGPTTELLK+LCTGKFVP N  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT
Sbjct  660   THLPGPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT  719

Query  698   SIGNTLLEMVLSDDDEGENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGK  757
             SIGNTLLEMVLS    G+   RS EE E+AV+ ILDNPRVKYDEDHALIHLQM G+KKGK
Sbjct  720   SIGNTLLEMVLSG--SGDEEKRSEEETEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK  777

Query  758   RYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATS  817
             RYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAERGPLPKGATS
Sbjct  778   RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATS  837

Query  818   GEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieedee  877
             GEEWKELKQLL LID NP IPPLQVVQVLSQSRELPV+V+KQY+VNQL NDEKKIEED+E
Sbjct  838   GEEWKELKQLLVLIDNNPVIPPLQVVQVLSQSRELPVAVLKQYIVNQLLNDEKKIEEDDE  897

Query  878   kikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETD  937
             KIKAFKSDTKQMKEEI+QLS +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET+
Sbjct  898   KIKAFKSDTKQMKEEISQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE  957

Query  938   RECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVL  997
             RECITCSMDHRHI+GLK+QLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKSNEV +
Sbjct  958   RECITCSMDHRHIMGLKSQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPV  1017

Query  998   DEGSFETRFSAEF  1010
             D+GSF+ RFS EF
Sbjct  1018  DDGSFDMRFSNEF  1030

>PYAP_24883
Length=980

 Score = 1639 bits (4245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/998 (82%), Positives = 890/998 (89%), Gaps = 36/998 (4%)

Query  31    MSANRGLICVGDADGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPRDE  90
             MSANRG++CVGDADGFVHLANR LEARKF+AHE FVSH+VMMKRSNVLVTIGDGIDPR +
Sbjct  1     MSANRGMLCVGDADGFVHLANRQLEARKFRAHEHFVSHIVMMKRSNVLVTIGDGIDPRSD  60

Query  91    ELREQSKAIAEAGRGPNA--------EEMYT-SKPTGKSTAVVRFWRTDQQDREGKPKLL  141
             ELREQS+AIAEAGR   A        ++M+T S  +GKSTAVVR WRTDQQDR+G+PKLL
Sbjct  61    ELREQSRAIAEAGRAAGAAGAGAATADDMFTRSADSGKSTAVVRIWRTDQQDRDGRPKLL  120

Query  142   QQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFKSDLKRRADRPPQLLQPAGQY  201
             QQ+PVFAKKYPEEAVTAFAV+DD+ QFAVGL+NGAVILF+ DLKRRA+RPPQLLQPAGQ+
Sbjct  121   QQVPVFAKKYPEEAVTAFAVSDDIGQFAVGLRNGAVILFRIDLKRRAERPPQLLQPAGQF  180

Query  202   PVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDE  261
             PVTGL+FTSKP++ TVAHVFLYASTRRGLTCYHC+HDDPALVK+AG AA LP RT VLDE
Sbjct  181   PVTGLSFTSKPISNTVAHVFLYASTRRGLTCYHCNHDDPALVKAAG-AAGLPSRTVVLDE  239

Query  262   RGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPR  321
             RGVD +CSCVN+EGEIAVGQ DAVYFY  EDRSVCFGFEGEKKYL+FFKHYLLVAHVDPR
Sbjct  240   RGVDHHCSCVNDEGEIAVGQVDAVYFYNNEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPR  299

Query  322   GRHQVNVYDLQNKFIAFNWTLTSTNPK-GPMRKPPLAPNARVPGARFGLDEMEEVRHVVC  380
             GRHQVNVYDLQNKFIAFNW+LT T  + G MR+PPL  N R PGARFGLD+MEE+RHVVC
Sbjct  300   GRHQVNVYDLQNKFIAFNWSLTQTASRNGGMRRPPLPTNNRAPGARFGLDDMEEIRHVVC  359

Query  381   EFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYG  440
                          VYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYG
Sbjct  360   ------------CVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG  407

Query  441   DHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  500
             DHLY+KGD+DGSLRQY RTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT
Sbjct  408   DHLYEKGDFDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  467

Query  501   LLLNCYTKLKDVKKLDKFIQLDEVIDA--KKTKG------GSDSGDLTPRNGGAAAANLN  552
             LLLNCYTKLKDVKKLD FIQLDE  D    +TKG      G  S D    NGG     +N
Sbjct  468   LLLNCYTKLKDVKKLDNFIQLDENTDKLNGETKGIAAVANGGTSNDKAHENGGKTG--MN  525

Query  553   FDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVAD  612
             FD+ETAISVLWENYPQHAL LAKKHEEHSWYLKIQLD ISYV+SEDSV LS SE+ERVAD
Sbjct  526   FDIETAISVLWENYPQHALILAKKHEEHSWYLKIQLDRISYVESEDSVGLSASEQERVAD  585

Query  613   ALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLH  672
             ALEYI+HLSFSEAD+NLRKYGRTLVTH+PGPTT+LLKRLCTGKFVPGNPSLKSDP DFLH
Sbjct  586   ALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGKFVPGNPSLKSDPADFLH  645

Query  673   LFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARSVEEKEEAVLRIL  732
             LFVSHR QLKEFLQYIVEVETV+N  IGNTLLEMVLSDD + +    S  E+E+AV+ IL
Sbjct  646   LFVSHREQLKEFLQYIVEVETVTNPLIGNTLLEMVLSDDGDTK---LSDAEREDAVMAIL  702

Query  733   DNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGD  792
             DNPRV+YDEDHALIHLQM GMKKGKRYLYNKLH+YHMLVQFHIEENDDQ+I++EVRKHG+
Sbjct  703   DNPRVRYDEDHALIHLQMRGMKKGKRYLYNKLHLYHMLVQFHIEENDDQAIIDEVRKHGE  762

Query  793   KDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSREL  852
             KDPNLWSLALKYFAERGPLPKG  +GEEWK+LKQLLALIDTNP IPPLQVV VLSQSREL
Sbjct  763   KDPNLWSLALKYFAERGPLPKGVKAGEEWKDLKQLLALIDTNPVIPPLQVVHVLSQSREL  822

Query  853   PVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCN  912
             PVSV+KQY+VNQL +DEKKIEEDEEKIK +K+DTKQMKEEIAQL+SRAVVFQATKC+LCN
Sbjct  823   PVSVVKQYIVNQLVSDEKKIEEDEEKIKTYKADTKQMKEEIAQLNSRAVVFQATKCELCN  882

Query  913   HDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLE  972
             HDLDLPAVHFMC+HSFHLNCISET+RECITCS+DHRHI+GLKTQLEQKAGNHEQFYNQLE
Sbjct  883   HDLDLPAVHFMCKHSFHLNCISETERECITCSLDHRHIMGLKTQLEQKAGNHEQFYNQLE  942

Query  973   TAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             TAADGF TIAEYFGKGIFK++    D+ +F+ RFSAEF
Sbjct  943   TAADGFQTIAEYFGKGIFKTDIAAEDDSAFDARFSAEF  980

>CCA17991
Length=965

 Score = 1516 bits (3925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 734/994 (74%), Positives = 845/994 (85%), Gaps = 43/994 (4%)

Query  31    MSANRGLICVGDADGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPRDE  90
             MSANRGLIC GDA+G++HL+N  LE RKFQAH  FVS +VMMKRSN+LV++GDGIDPR  
Sbjct  1     MSANRGLICAGDAEGYIHLSNSQLEVRKFQAHNHFVSQIVMMKRSNILVSVGDGIDPRPS  60

Query  91    ELREQSKAIAEAGRGPNAEEMYTSKPTG--KSTAVVRFWRTDQQDREGKPKLLQQIPVFA  148
              +  +   +          ++ +SK  G  +STA++R WRTDQQDREGKPK+LQQI VFA
Sbjct  61    MIHAEKADV----------DINSSKAAGDSESTAMIRIWRTDQQDREGKPKMLQQIQVFA  110

Query  149   KKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFKSDLKRRADR-PPQLLQPAGQYPVTGLA  207
             K++PEEAVTAFAV+DD+SQ++VGLKNGAVIL++SD + R +R  P LLQPAGQ+PVTGLA
Sbjct  111   KRFPEEAVTAFAVSDDVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGLA  170

Query  208   FTSKPVTATVAHVFLYASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMN  267
             FT+KP+T ++ HVFLYASTRRGLTCYHC+ DD  +VK A GA+ +PPR   LDERGVD +
Sbjct  171   FTTKPITNSLNHVFLYASTRRGLTCYHCNQDDQYIVK-AVGASRMPPRCVTLDERGVDFH  229

Query  268   CSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVN  327
             CSCVN++GEIAVGQ DAVYFYTT+D+SVCF F+GEKKYL FFK YL+VAHVD RGRHQVN
Sbjct  230   CSCVNDDGEIAVGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVN  289

Query  328   VYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNAR------VPGARFGLDEMEEVRHVVCE  381
             VYDLQNKFIAFNWTLT + P         A  AR       P +RFGLD ME+++H+V E
Sbjct  290   VYDLQNKFIAFNWTLTHSVPSESSPNVSKATAARGKQSQPNPSSRFGLDRMEQIQHIVSE  349

Query  382   FGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGD  441
             FG+IFVVSS GHVYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGD
Sbjct  350   FGSIFVVSSAGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGD  409

Query  442   HLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTL  501
             HLYQKGDYDGSLRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTL
Sbjct  410   HLYQKGDYDGSLRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTL  469

Query  502   LLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGDLTPRNGGAAAANLNFDVETAISV  561
             LLNC+TKLKDVKKLD FIQL+   D    K G  +             +LNFDVETAISV
Sbjct  470   LLNCFTKLKDVKKLDAFIQLE---DGNAAKAGGQT-------------SLNFDVETAISV  513

Query  562   LWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLS  621
             LWE YPQHALTLA+KHEEHSWYLKIQLD ISYVDS+ S  LS +EKERV DALEYI+HLS
Sbjct  514   LWEMYPQHALTLARKHEEHSWYLKIQLDQISYVDSDGSTTLSSAEKERVIDALEYIKHLS  573

Query  622   FSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQL  681
             F+EAD+NLRKYGRTLVTH+PGPTTELLKRLCTGKFVP  P LKSDP DFLHLFVSHRAQL
Sbjct  574   FAEADANLRKYGRTLVTHLPGPTTELLKRLCTGKFVPEKPELKSDPADFLHLFVSHRAQL  633

Query  682   KEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARSVEEKEEAVLRILDNPRVKYDE  741
             +EFLQYIVEVET+++ SIGNTLLEMVL+D  EG   + S + KE+AV+ ILDNPRV+YDE
Sbjct  634   REFLQYIVEVETITDPSIGNTLLEMVLTD--EGSEESPSADMKEDAVMAILDNPRVRYDE  691

Query  742   DHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLA  801
             DHALIHLQMHGM+KGKRYL+NKLHMYHMLVQ HIEE+DDQSI+EEVRKHGDKDPNLWSLA
Sbjct  692   DHALIHLQMHGMRKGKRYLFNKLHMYHMLVQHHIEEHDDQSIIEEVRKHGDKDPNLWSLA  751

Query  802   LKYFAERGPLPK-----GATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSV  856
             LKYFAERGPLPK     G  S EEWKEL+QLL +IDTNP IPPLQVVQVLSQ+R+LP+SV
Sbjct  752   LKYFAERGPLPKYVSKSGNASNEEWKELRQLLIMIDTNPVIPPLQVVQVLSQARDLPLSV  811

Query  857   IKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLD  916
             IK Y++NQL+++++ ++ DEEKI+AFK+DT+QMKEEIAQL+S+A+VFQATKCDLCNHDLD
Sbjct  812   IKPYILNQLSHNQELVDNDEEKIRAFKADTRQMKEEIAQLNSKAIVFQATKCDLCNHDLD  871

Query  917   LPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAAD  976
             LPAVHFMCQHSFHLNCISETDREC+TCS++HRHILGLKTQLEQKAGNHEQFYNQLET+ D
Sbjct  872   LPAVHFMCQHSFHLNCISETDRECMTCSVEHRHILGLKTQLEQKAGNHEQFYNQLETSMD  931

Query  977   GFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010
             GF TIAEYFGKGIFK NE+ +D+ +F+ +   +F
Sbjct  932   GFETIAEYFGKGIFKKNEIPVDDPTFDFQSGVDF  965

>CCI40831
Length=1163

 Score = 1446 bits (3744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/986 (72%), Positives = 821/986 (83%), Gaps = 56/986 (6%)

Query  40    VGDADGFVHLANRSLEARKFQAHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAI  99
             +GDAD  +H+ +      +F+AH     H VM KRSN+LV++GDGIDPR   +  +   +
Sbjct  219   MGDADD-LHIQS----DLQFRAH----GHRVM-KRSNILVSVGDGIDPRTSMIHAEKSDV  268

Query  100   AEAGRGPNAEEMYTSKPTGKSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAF  159
                 R  +  +        +STA++R WRTDQQDREGKPK+LQQI VFAK++PEEAVTAF
Sbjct  269   DTTSRKGDTGD-------SESTAMIRIWRTDQQDREGKPKMLQQIQVFAKRFPEEAVTAF  321

Query  160   AVNDDLSQFAVGLKNGAVILFKSDLKRRADR-PPQLLQPAGQYPVTGLAFTSKPVTATVA  218
             AV+D++SQ++VGLKNGAVIL++SD + R +R  P LLQPAGQ+PVTGLAFT+KP+  ++ 
Sbjct  322   AVSDEVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGLAFTTKPINNSLN  381

Query  219   HVFLYASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIA  278
             HVFLYASTRRGLTCYHC+ DD  +VK A G   +PPR   LDERGVD  CSCVN+EGEIA
Sbjct  382   HVFLYASTRRGLTCYHCNQDDQYIVK-AVGTTGMPPRCVTLDERGVDFCCSCVNDEGEIA  440

Query  279   VGQTDAVYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAF  338
             VGQ DAVYFYTT+D+SVCF F+GEKKYL FFK YL+VAHVD RGRHQVNVYDLQNKFIAF
Sbjct  441   VGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVNVYDLQNKFIAF  500

Query  339   NWTLTSTNPKGP---------MRKPPLAPNARVPGARFGLDEMEEVRHVVCEFGAIFVVS  389
             NWTLT + P             R     PN   PGARFGLD+ME+++H+V EFG+IFVVS
Sbjct  501   NWTLTHSVPSESSANVSKTMVARGKQSQPN---PGARFGLDKMEQIQHIVSEFGSIFVVS  557

Query  390   SMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDY  449
             S GHVYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLYQKGDY
Sbjct  558   SAGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGDHLYQKGDY  617

Query  450   DGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKL  509
             DGSLRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTLLLNC+TKL
Sbjct  618   DGSLRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTLLLNCFTKL  677

Query  510   KDVKKLDKFIQLDEVIDAKKTKGGSDSGDLTPRNGGAAAANLNFDVETAISVLWENYPQH  569
             KDVKKLD FIQL++                   N      +LNFDVETAISVLWE YPQH
Sbjct  678   KDVKKLDAFIQLED------------------GNVAGGHTSLNFDVETAISVLWEMYPQH  719

Query  570   ALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNL  629
             ALTLA+KHEEHSWYLKIQLD ISYV+S+ S  LS +EKERV DAL+YIEHLSF+EAD+NL
Sbjct  720   ALTLARKHEEHSWYLKIQLDQISYVESDGSTTLSGAEKERVIDALKYIEHLSFAEADANL  779

Query  630   RKYGRTLVTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIV  689
             RKYGRTLVTH+PGPTTELLKRLCTGKFVP  P LKS+P DFLHLFVSHRAQL+EFLQYIV
Sbjct  780   RKYGRTLVTHLPGPTTELLKRLCTGKFVPEKPELKSNPADFLHLFVSHRAQLREFLQYIV  839

Query  690   EVETVSNTSIGNTLLEMVLSDDDEGENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQ  749
             EVET+++ SIGNTLLEMVL+D  EG   + + + KE+AV+ ILDNPRV+YDEDHALIHLQ
Sbjct  840   EVETITDPSIGNTLLEMVLTD--EGSEESPNTDRKEDAVMAILDNPRVRYDEDHALIHLQ  897

Query  750   MHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERG  809
             MHGM+KGKRYL+NKLHMYHMLVQ HIEENDDQSI+EEVRKHGDKDPNLWSLALKYFAERG
Sbjct  898   MHGMRKGKRYLFNKLHMYHMLVQHHIEENDDQSIIEEVRKHGDKDPNLWSLALKYFAERG  957

Query  810   PLPKGATS-----GEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQ  864
             PLPK A+       EEWKEL+QLL++IDTNP IPPLQVVQVLSQ+R+LP+SVIK Y++NQ
Sbjct  958   PLPKNASKSSKSSTEEWKELRQLLSMIDTNPVIPPLQVVQVLSQARDLPLSVIKPYILNQ  1017

Query  865   LANdekkieedeekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMC  924
             L+++++ IE DEEKI+AFK+DT+QMKEEI+QL+S+A+VFQATKCDLCNHDLDLPAVHFMC
Sbjct  1018  LSHNQELIESDEEKIRAFKADTRQMKEEISQLNSKAIVFQATKCDLCNHDLDLPAVHFMC  1077

Query  925   QHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEY  984
             QHSFHLNCISETDREC+TCS++HRHILGLKTQL+QKAGNHEQFYNQLET+ DGF TIAEY
Sbjct  1078  QHSFHLNCISETDRECMTCSVEHRHILGLKTQLDQKAGNHEQFYNQLETSMDGFETIAEY  1137

Query  985   FGKGIFKSNEVVLDEGSFETRFSAEF  1010
             FGKGIFK NE+ +D+ +F+ +   +F
Sbjct  1138  FGKGIFKRNEIPVDDPAFDFQSGVDF  1163

>SDRG_14094
Length=1003

 Score = 1328 bits (3436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/1042 (65%), Positives = 807/1042 (77%), Gaps = 71/1042 (7%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRG---PNAEEMYTSKPT  117
             AH+ FVSHVVMMK++NVLV+IGDG DPRD +L + SKA+AEA R     + ++MYTS  +
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYTSTGS  120

Query  118   GK-STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176
              + STA+V+ WRTDQQDREGKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  177   VILFKSDLKRRA-----DRPPQLLQPAGQYPVTGLAFTSKPV-------TATVAHVFLYA  224
             +ILF+S++KRRA       PP LLQ A   PVT L+F  KP        T+T   ++LYA
Sbjct  180   IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  225   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  284
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291

Query  285   VYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344
             VYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351

Query  345   TNPKGPMRKPPLAPNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  404
             T      +  P A +  V   RFG +E+EE+RHVV EFGA+FVV+S G VYRLSEKDT S
Sbjct  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVYRLSEKDTAS  406

Query  405   KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  464
             KL ILF KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHVE
Sbjct  407   KLSILFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVE  466

Query  465   PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  524
             PSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+ 
Sbjct  467   PSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD-  525

Query  525   IDAKKTKGGSDSGDLTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYL  584
                     GS++ + TP+        L FDVETA++VL ENYPQHAL LA+KH EHSWYL
Sbjct  526   -------DGSNAKEGTPQ-------ALTFDVETALTVLRENYPQHALALARKHAEHSWYL  571

Query  585   KIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPT  644
             KIQLD IS         LSD+E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH+PGPT
Sbjct  572   KIQLDRISDT-------LSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPT  624

Query  645   TELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLL  704
             TELL++LCTG+F     + KSDPGDFLHLFVSHR QL+EFL+YIV+VE+VSNTSIGNTLL
Sbjct  625   TELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLREFLEYIVQVESVSNTSIGNTLL  683

Query  705   EMVLSD--------DDEGE----NGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHG  752
             EMVL+D        DD+ E    + A S    E AVL +LDNPRVKYDEDHALI +QMHG
Sbjct  684   EMVLNDTHKRDVPKDDDSEEPEVHEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHG  743

Query  753   MKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLP  812
             +K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++    D NLW LAL+YFAERGP P
Sbjct  744   LKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVKQQ--TDSNLWLLALRYFAERGPYP  801

Query  813   KGAT--SGEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLANd  868
             KG++  S +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+QL  D
Sbjct  802   KGSSVRSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKD  861

Query  869   ekkieedeekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSF  928
             +  I+ D ++IK +K DT +M+ ++A LSS+A+VFQATKCDLC+HDLDLP VHFMC HSF
Sbjct  862   QAHIDADSDEIKKYKQDTAKMRTQMAGLSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSF  921

Query  929   HLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKG  988
             H NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAEYFGKG
Sbjct  922   HQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKG  981

Query  989   IFKSNEVVLDEGSFETRFSAEF  1010
             IFKS   V    S   RFS E 
Sbjct  982   IFKSEAAVDRRPSGVPRFSNEL  1003

>H310_11729
Length=1002

 Score = 1299 bits (3361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/1043 (63%), Positives = 800/1043 (77%), Gaps = 74/1043 (7%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFF+KE+LKD NG W++G+D+TSMS NRGL+ +GDA G +HLANR LE R F+
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHLANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGR--GPNAEEMYTSKPTG  118
             AHE FVSHV+MMK++N+LV+IGDG DPRD +L + SKA+AEA R      E+++TS  + 
Sbjct  61    AHEHFVSHVIMMKKANLLVSIGDGKDPRDPDLIKASKAVAEASRTQAQQDEQLFTSSDSR  120

Query  119   KSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVI  178
              STA+V+ WRTDQQDR+GKPKLLQQI +F+K + EEAVTAFAV+DDLSQ A+GL NGA+I
Sbjct  121   GSTALVKIWRTDQQDRDGKPKLLQQIKIFSK-FAEEAVTAFAVSDDLSQIAIGLLNGAII  179

Query  179   LFKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHD  238
             LF+SD KRR+D+PP LLQPA QYPVT L F +K     V  + LYA+T+RGLTCYHC   
Sbjct  180   LFRSDAKRRSDKPPLLLQPATQYPVTSLHFATK-----VNILTLYAATKRGLTCYHC---  231

Query  239   DPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFG  298
             D A  KS      +P R+ VLDERGV ++C  V+E+G++AVGQ+DAVYFYT E+RSVCFG
Sbjct  232   DDASSKSNASNNGMP-RSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEERSVCFG  290

Query  299   FEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAP  358
             FEG+KKYL FFK YLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T           A 
Sbjct  291   FEGDKKYLGFFKQYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNT-----------AK  339

Query  359   NARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIA  418
                  G RFG D  EE+RHVV EFGA+FV+SS+G+VYRL E DTTSKL+ILFRK+LYSIA
Sbjct  340   IGAGGGGRFGDDAAEEIRHVVSEFGAVFVLSSLGYVYRLMEIDTTSKLDILFRKHLYSIA  399

Query  419   ISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRI  478
             ISLAFSSNYD+ SI+DIFR YGDHLYQKGD+DGSLRQY RTIG+VEPSYVIR+FLDAQRI
Sbjct  400   ISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQRI  459

Query  479   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGD  538
             HNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+    +ID ++T   +D   
Sbjct  460   HNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFL----LIDDEQT---TDDAP  512

Query  539   LTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  598
              T          L FDVETA++VL + YP HAL LAKKH EHSWYLKIQLD I       
Sbjct  513   TTADTRKQPKQQLTFDVETALTVLRDYYPTHALALAKKHHEHSWYLKIQLDRIH------  566

Query  599   SVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVP  658
             S  LSD++  RV DAL YIE LSF+EA+ NLRKYGRTLVTH+PGPTTELLK LCTG+F  
Sbjct  567   SETLSDADHARVQDALTYIEGLSFTEANLNLRKYGRTLVTHVPGPTTELLKALCTGRFHD  626

Query  659   GNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSD--------  710
              N   K+DP +FLHLFVSHRAQL+EFL+YIV VETV+N  IGNTLLEMVLSD        
Sbjct  627   SNGE-KADPANFLHLFVSHRAQLREFLEYIVHVETVANPQIGNTLLEMVLSDVGRGGPNA  685

Query  711   -----DDEGENGAR---------SVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKG  756
                  D+E + G R         S  + E AVL +LDNPRVKYDEDHALI +QMHG+K+G
Sbjct  686   AVDELDEEHDEGGRAPGGGTASTSAAKNESAVLALLDNPRVKYDEDHALILMQMHGLKQG  745

Query  757   KRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGAT  816
             KRYLY KLHMYHMLVQ H+EE D+ ++LE+V++HG+ +PNLW LALKYF+E+        
Sbjct  746   KRYLYQKLHMYHMLVQHHMEEGDNVAVLEQVKQHGESNPNLWLLALKYFSEK------KD  799

Query  817   SGEEWKELKQLLALIDTNPA---IPPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkie  873
             +   +  L+ LL+ +D++     IPPLQVV +LSQ+R+LP+SV++QYVVNQL  D+  I+
Sbjct  800   NDPTYTHLQTLLSWMDSSSKSLQIPPLQVVAILSQARDLPLSVVRQYVVNQLKQDQIHID  859

Query  874   edeekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCI  933
             ++ ++IK FK DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HSFH NCI
Sbjct  860   KENDEIKKFKQDTAKMRAQLTTLSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCI  919

Query  934   SETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSN  993
             SETDREC+TC  +HRH + LKT LE KA NHE F+NQLE+A DGF+TIAEYFGKGIFK++
Sbjct  920   SETDRECMTCGPEHRHFVALKTSLETKASNHELFFNQLESATDGFNTIAEYFGKGIFKAD  979

Query  994   EVVL------DEGSFETRFSAEF  1010
             + ++      DE + E RFS E+
Sbjct  980   DPMMAQLGLGDEHASEARFSNEY  1002

>SPRG_03282
Length=1004

 Score = 1293 bits (3345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1043 (64%), Positives = 796/1043 (76%), Gaps = 72/1043 (7%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRG---PNAEEMYTSKPT  117
             AH+ FVSHVVMMK++NVLV+IGDG DPRD +L + SKA+AEA R     + ++MY S  +
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120

Query  118   GK-STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176
              + STA+V+ WRTDQQDREGKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  177   VILFKSDLKRRA-----DRPPQLLQPAGQYPVTGLAFTSKPV-------TATVAHVFLYA  224
             +ILF+S++KRRA       PP LLQ A   PVT L+F  KP        T+T   ++LYA
Sbjct  180   IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  225   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  284
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291

Query  285   VYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344
             VYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351

Query  345   TNPKGPMRKPPLAPNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  403
             T      +  P A +  V   RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406

Query  404   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466

Query  464   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+
Sbjct  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  526

Query  524   VIDAKKTKGGSDSGDLTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWY  583
                      GS + + TP+        L FDVETA++VL ENYPQHAL LAKKH EHSWY
Sbjct  527   --------DGSSAKEGTPQA-------LTFDVETALTVLRENYPQHALALAKKHGEHSWY  571

Query  584   LKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGP  643
             LKIQLD IS         LSD+E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH+PGP
Sbjct  572   LKIQLDRISDT-------LSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGP  624

Query  644   TTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTL  703
             TTELL++LCTG+F     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSIGNTL
Sbjct  625   TTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTL  683

Query  704   LEMVLSD--------DDEGE----NGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMH  751
             LEMVL+D        DDEG+      A S    E AVL +LDNPRVKYDEDHALI +QMH
Sbjct  684   LEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMH  743

Query  752   GMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPL  811
             G+K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++    D NLW LAL+YFAERGP 
Sbjct  744   GLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVKQQ--TDSNLWLLALRYFAERGPY  801

Query  812   PKGAT--SGEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLAN  867
             PKGA+  S +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+QL  
Sbjct  802   PKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKK  861

Query  868   dekkieedeekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHS  927
             D+  I+ D ++IK +K DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HS
Sbjct  862   DQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHS  921

Query  928   FHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGK  987
             FH NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAEYFGK
Sbjct  922   FHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGK  981

Query  988   GIFKSNEVVLDEGSFETRFSAEF  1010
             GIFKS   +    S   RFS E 
Sbjct  982   GIFKSEAALDRRPSGVARFSNEL  1004

>H257_12787
Length=968

 Score = 1286 bits (3327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/1032 (63%), Positives = 796/1032 (77%), Gaps = 86/1032 (8%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
             MAQWRRFAFF+KE+LKD NG W++G+D+TSMS NRGL+ +GDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGR--GPNAEEMYTSKPTG  118
             AH+ FVSHV+MMK++N+LV+IGDG DPRD EL + SKAIA+A R      E+++T+  + 
Sbjct  61    AHDHFVSHVIMMKKANLLVSIGDGKDPRDPELIKASKAIADASRTQAQQDEQLFTASDSQ  120

Query  119   KSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVI  178
              STA+V+ WRTDQQDR+GKPKLLQQI +FAK +PEEAVTAF+V+DDL+Q AVGL NGA+I
Sbjct  121   GSTALVKIWRTDQQDRDGKPKLLQQIKIFAK-FPEEAVTAFSVSDDLAQIAVGLLNGAII  179

Query  179   LFKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHD  238
             LF+SD KRR+D+PP LLQPA QYPVT L F +K    T     LYA+T+RGLTCYHC  D
Sbjct  180   LFRSDAKRRSDKPPLLLQPATQYPVTSLHFATKLNVPT-----LYAATKRGLTCYHC--D  232

Query  239   DPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFG  298
             D +    +GG     PR+ VLDERGV ++C  V+E+G++AVGQ+DAVYFYT EDRSVCFG
Sbjct  233   DSS---RSGGM----PRSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEDRSVCFG  285

Query  299   FEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAP  358
             F+G+KKYL FFK YLLVAHVDPRGRHQVN+YDLQNKFIAFNWTLT+T           A 
Sbjct  286   FDGDKKYLGFFKQYLLVAHVDPRGRHQVNLYDLQNKFIAFNWTLTNT-----------AK  334

Query  359   NARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIA  418
                  G RFG D  EE+RHVV EFGA+FV SS+G+VYRL E DTTSKL+ILFRK+LYSIA
Sbjct  335   GGGGGGGRFGDDAAEEIRHVVSEFGAVFVQSSLGYVYRLLEVDTTSKLDILFRKHLYSIA  394

Query  419   ISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRI  478
             ISLAFSSNYD+ SI+DIFR YGDHLYQKGD+DGSLRQY RTIG+VEPSYVIR+FLDAQRI
Sbjct  395   ISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQRI  454

Query  479   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSGD  538
             HNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+ +D+  D K+ K       
Sbjct  455   HNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDD--DPKEKK-------  505

Query  539   LTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  598
                         L FDVETA++VL +NYP HALTLAKKH EHSWYLKIQLD I       
Sbjct  506   ----------QPLTFDVETALTVLRDNYPTHALTLAKKHHEHSWYLKIQLDRIH------  549

Query  599   SVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVP  658
             S  LS+S++ RV DAL YIE LSF EA+ NLRKYGRTLVTH+PGPTTELLK LCTG+F  
Sbjct  550   SETLSESDQARVLDALTYIEGLSFGEANLNLRKYGRTLVTHVPGPTTELLKALCTGRF--  607

Query  659   GNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSD--------  710
              + + K+DP +FLHLFVSHRAQL+EFL+YIV+VETV+N  IGNTLLEMVL D        
Sbjct  608   HDSTDKADPANFLHLFVSHRAQLREFLEYIVDVETVANPQIGNTLLEMVLGDVGRSPATA  667

Query  711   DDEGENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHML  770
             +++ E+    +   E AVL +LDNPRVKYDEDHALI +QMHG+K+GKRYLY KLHMYHML
Sbjct  668   EEDAEDKPIIMATNEAAVLALLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHML  727

Query  771   VQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLA-  829
             +Q H+EE DD ++L++V++HG+ +PNLW LALKYF+++          ++   L+ LL+ 
Sbjct  728   LQHHMEEGDDLAVLDQVKQHGESNPNLWLLALKYFSDQ----------KDPGHLQTLLSW  777

Query  830   LIDTN---PAIPPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDT  886
             ++DT+   P IPPLQVV +LSQ+R+LP+SV++ YVV+QL  D+  I++++ +IK F+ DT
Sbjct  778   MMDTSVPAPPIPPLQVVAILSQARDLPLSVVRPYVVSQLKQDQAHIDKEKGEIKKFQQDT  837

Query  887   KQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMD  946
              +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HSFH NCISETDREC+TC  +
Sbjct  838   AKMRAQVTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETDRECMTCGPE  897

Query  947   HRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFK--------SNEVVLD  998
             HRH + L++ L+ KA NHE F+NQLETA DGF+TIAEYFGKGIFK         N V   
Sbjct  898   HRHFVALQSSLQAKASNHELFFNQLETATDGFNTIAEYFGKGIFKPVDDDDDDENRVAES  957

Query  999   EGSFETRFSAEF  1010
              GS E RFS E+
Sbjct  958   VGSNE-RFSNEY  968

>PHYKE_6407
Length=934

 Score = 1226 bits (3173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/633 (95%), Positives = 613/633 (97%), Gaps = 5/633 (1%)

Query  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
            MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHL+NRSLEARKFQ
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLSNRSLEARKFQ  60

Query  61   AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120
            AHELFVSHVVMM+RSNVLVTIGDGIDPR EELR QSKAIAEAGR PNAE+MYTSKP+GKS
Sbjct  61   AHELFVSHVVMMQRSNVLVTIGDGIDPRSEELRAQSKAIAEAGRAPNAEDMYTSKPSGKS  120

Query  121  TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180
            TAVVRFWRTDQQDREGKPKLLQQIP+FAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  121  TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  181  KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240
            +SDLKRR DRPP LLQPAGQYPVTGL+FTSKPVTA+V+HVFLYASTRRGLTCYHCSHDDP
Sbjct  181  RSDLKRRTDRPPHLLQPAGQYPVTGLSFTSKPVTASVSHVFLYASTRRGLTCYHCSHDDP  240

Query  241  ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
            ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241  ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301  GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360
            GEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T+ K  MRKPPLA NA
Sbjct  301  GEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTSSKAGMRKPPLAANA  360

Query  361  RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420
            R PGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361  RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  421  LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480
            LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421  LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  481  LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKG---GSDSG  537
            LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT G   GSDSG
Sbjct  481  LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKSGSDSG  540

Query  538  DLTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSE  597
              TPR  GA A+NLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSE
Sbjct  541  MTTPR--GAGASNLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSE  598

Query  598  DSVALSDSEKERVADALEYIEHLSFSEADSNLR  630
            DSVALS++EKERVADALEYIEHLSFSEADSNLR
Sbjct  599  DSVALSENEKERVADALEYIEHLSFSEADSNLR  631

 Score = 590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/301 (97%), Positives = 298/301 (99%), Gaps = 0/301 (0%)

Query  710   DDDEGENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHM  769
             DD++GENG RS+EEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHM
Sbjct  634   DDEDGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHM  693

Query  770   LVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLA  829
             LVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLA
Sbjct  694   LVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLA  753

Query  830   LIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQM  889
             LIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLA+DEKKIEEDEEKIKAFK DTKQM
Sbjct  754   LIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQM  813

Query  890   KEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRH  949
             KEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRH
Sbjct  814   KEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRH  873

Query  950   ILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAE  1009
             ILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEV+LDEGSFE RFSAE
Sbjct  874   ILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVLLDEGSFEARFSAE  933

Query  1010  F  1010
             F
Sbjct  934   F  934

>PYAR_24779
Length=699

 Score = 1100 bits (2846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/697 (79%), Positives = 601/697 (86%), Gaps = 42/697 (6%)

Query  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60
            MAQWRRFAFFDKEVLKDANG WMKGVDIT+MSANRG+ICVGDADGFVHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60

Query  61   AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGR---GPNAEEMYTSKPT  117
            AHE FVSH+VMMKRSNVLVTIGDG+DPR EELREQS+AIAEAGR   G  +E+MY +K T
Sbjct  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120

Query  118  -GKSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176
             GKS+A+VR WRTDQQDR+G PKLLQQ+PVFAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180

Query  177  VILFKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCS  236
            VILF+ DLKR+ DRPP LLQPAGQ+PVTGL+FTSKPVTATVAH FLYA+TRRGL+CYHC+
Sbjct  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240

Query  237  HDDPALVKSAGGAAA-----LPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTE  291
            H+D ALVK+ G AAA     +PPRT VLDERGVD+N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  241  HEDQALVKAVGQAAAAGGGGMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300

Query  292  DRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT--------  343
            DRSVCFGFEGEKKYL+FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT        
Sbjct  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360

Query  344  STNPKGPMRKPPLAPNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTT  403
               P G  R   ++ NAR PGARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTT
Sbjct  361  GVGPSGTRRTASVS-NARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTT  419

Query  404  SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463
            SKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHV
Sbjct  420  SKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHV  479

Query  464  EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523
            EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE
Sbjct  480  EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  539

Query  524  VIDAK--------------------KTKGGSDSGDLTPRNGGAAA----ANLNFDVETAI  559
            ++DA                     KT GG ++        G  A      +NFD+ETAI
Sbjct  540  LVDANKLNGAAGGDAGATANGKALAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAI  599

Query  560  SVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEH  619
            SVLWENYP HAL LAKKHEEHSWYLKIQLD ISYV+SEDSVALS  EKERVADALEYI+H
Sbjct  600  SVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQH  659

Query  620  LSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKF  656
            LSFSEAD+NLRKYGRTLVTH+PGPTT+LLKRLCTG F
Sbjct  660  LSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696

>PYAR_24374
Length=325

 Score = 498 bits (1281),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 252/326 (77%), Positives = 284/326 (87%), Gaps = 22/326 (7%)

Query  706   MVLSDDDEG-ENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKL  764
             MVLS D E  E   R+V EKE+AV+ ILDNPRV+YDEDHALIHLQMHGMKKGKRYLYNKL
Sbjct  1     MVLSADGESDEAKERTVAEKEDAVMAILDNPRVRYDEDHALIHLQMHGMKKGKRYLYNKL  60

Query  765   HMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKEL  824
             H+YHMLVQFHIEENDD SI++EVRKHGDKDPNLWSLALKYFAERGPLPKG  +GEEW +L
Sbjct  61    HLYHMLVQFHIEENDDSSIIDEVRKHGDKDPNLWSLALKYFAERGPLPKGVKTGEEWHDL  120

Query  825   KQLLALIDTNPAIPPLQVVQ-----------------VLSQSRELPVSVIKQYVVNQLAN  867
             KQLLALIDTNPAIPPL VVQ                 VLSQSRELPV+V+KQY+VNQL +
Sbjct  121   KQLLALIDTNPAIPPLHVVQVLSQSRELPVAVVKQYIVLSQSRELPVAVVKQYIVNQLLS  180

Query  868   dekkieedeekikAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHS  927
             DE+KIEEDE+KIK +K+DTK+MKEEI +L+S+AVVFQATKC+LCNHDLDLPAVHFMC+HS
Sbjct  181   DERKIEEDEDKIKTYKADTKKMKEEIGELNSKAVVFQATKCELCNHDLDLPAVHFMCKHS  240

Query  928   FHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGK  987
             FHLNCISET+RECITCS++HRHI+GLKTQLEQKAGNHEQFYNQLETAADGF TIAEYFGK
Sbjct  241   FHLNCISETERECITCSLEHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFQTIAEYFGK  300

Query  988   GIFKSNEVVL---DEGSFETRFSAEF  1010
             GIFK+ E+     D+G+F+ RFSAEF
Sbjct  301   GIFKT-EIASGDDDDGAFDHRFSAEF  325

>PYAP_19745
Length=725

 Score = 38.1 bits (87),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 47/109 (43%), Gaps = 10/109 (9%)

Query  117  TGKSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176
             G    VV  W T  Q R G    +           E  VTA   +DD   FAVG  NG 
Sbjct  195  VGCEDGVVECWDTRSQSRVGVLDSVVGHCGGGVGDAEVGVTALEFDDDGLTFAVGTSNGH  254

Query  177  VILFKSDLKRRADRPPQLLQPAGQY--PVTGLAF--TSKPVTATVAHVF  221
             +L+  DL  R+ +P  LLQ   QY  P+  + F   S+ V +T A V 
Sbjct  255  CLLY--DL--RSSKP--LLQKTHQYGLPIVDVKFHDYSRKVLSTDAKVI  297

>H310_10523
Length=262

 Score = 36.6 bits (83),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (47%), Gaps = 1/64 (2%)

Query  881  AFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLD-LPAVHFMCQHSFHLNCISETDRE  939
            ++K  +  + E++A     A       C +C + LD    V   C+HS+H +CI +    
Sbjct  56   SYKPTSHSILEKLATWQVPATKLDDATCAVCMNSLDDATVVALPCKHSYHTDCIRQWLAR  115

Query  940  CITC  943
            C TC
Sbjct  116  CNTC  119

>PYIR_16790
Length=744

 Score = 37.4 bits (85),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 54/122 (44%), Gaps = 18/122 (15%)

Query  117  TGKSTAVVRFWRTDQQDREGKPKLLQQIPVFA--KKYPEEA---VTAFAVNDDLSQFAVG  171
             G     V  W T  Q R G   +L  I  FA      +EA   VTA   +DD   F VG
Sbjct  195  VGCEDGTVECWDTRSQRRVG---ILDGISTFAGGPAGADEAPVQVTALEFDDDGLTFGVG  251

Query  172  LKNGAVILFKSDLKRRADRPPQLLQPAGQY--PVTGLAF--TSKPVTATVAHVFLYASTR  227
              NG  +L+  DL  R+ +P  LLQ + QY  P+  L F   ++ V +T A V      R
Sbjct  252  TSNGHCLLY--DL--RSSKP--LLQKSHQYGLPIIDLKFHDYARKVISTDAKVIKIWDKR  305

Query  228  RG  229
             G
Sbjct  306  DG  307

>PYIR_17525
Length=1023

 Score = 37.4 bits (85),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 37/156 (24%), Positives = 65/156 (42%), Gaps = 24/156 (15%)

Query  792  DKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRE  851
            + D NLW   +             TS E  +EL +      +   I P+++++ + +  E
Sbjct  813  ENDENLWDYLIDL---------SLTSKENVEELLKFA----SQHKIDPIKLIRKIPEDME  859

Query  852  LPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRAV-VFQATKCDL  910
              +  +KQ +V+ +AN   +        K F++D  Q+ +   +   +A  V   T+C +
Sbjct  860  --IDNLKQKLVDIIANYRIQQNLCTGCSKVFENDRVQLLQRQVKTHKKARRVSVKTQCLI  917

Query  911  CNHDLDLP--------AVHFMCQHSFHLNCISETDR  938
            CN  L  P           F C H +HL C+ E  R
Sbjct  918  CNEVLRAPTSGKESFHVCVFECGHCYHLPCLEEKMR  953

>PYAP_25178
Length=286

 Score = 36.6 bits (83),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 42/81 (52%), Gaps = 17/81 (21%)

Query  702  TLLEMVLSDDDEGENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHG---MKKGKR  758
            T+ ++VLSD D G+ GAR+V +    +LR+          +H L H+ ++G      G  
Sbjct  67   TVKQLVLSDHDIGDKGARAVAD----MLRV----------NHTLQHVDLYGNAITDAGCE  112

Query  759  YLYNKLHMYHMLVQFHIEEND  779
             + N L+ +  LV+ H+  ND
Sbjct  113  AIANSLYGHESLVELHLWSND  133

>SPRG_13639
Length=179

 Score = 35.4 bits (80),  Expect = 0.82, Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 26/62 (42%), Gaps = 7/62 (11%)

Query  896  LSSRAVVFQATKCDLC-----NHDLDLPAV--HFMCQHSFHLNCISETDRECITCSMDHR  948
              SR  V   T+C +C       D ++P V     C H FH  CI+E      TC +   
Sbjct  101  FQSRRNVPSETECSICLVPFSRDDFEVPGVVVETQCTHVFHQGCIAEWIETAATCPICRH  160

Query  949  HI  950
            HI
Sbjct  161  HI  162

>PYAP_13607
Length=270

 Score = 36.2 bits (82),  Expect = 0.85, Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 0/38 (0%)

Query  906  TKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITC  943
            T C +C   +D P V   C H FH+ CI    R   TC
Sbjct  73   TSCVVCMETMDQPCVQLPCHHYFHVGCIEPWLRMHSTC  110

>SPRG_14870
Length=246

 Score = 35.8 bits (81),  Expect = 0.93, Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 26/62 (42%), Gaps = 7/62 (11%)

Query  896  LSSRAVVFQATKCDLC-----NHDLDLPAV--HFMCQHSFHLNCISETDRECITCSMDHR  948
              SR+ +   T+C +C       D  LP V     C H FH  CI+E      TC +   
Sbjct  168  FQSRSSLPSETECSICLVPFSRDDFHLPGVVVETQCTHVFHQGCIAEWIETAATCPICRH  227

Query  949  HI  950
            HI
Sbjct  228  HI  229

>PYAP_22931
Length=1059

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 39/163 (24%), Positives = 71/163 (44%), Gaps = 31/163 (19%)

Query  792  DKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRE  851
            D DPNLW   +             +S E  +EL    A    +  I P+++++ + +  +
Sbjct  836  DHDPNLWDYLIDL---------SLSSKENVEELLSFAA----HHKIDPIKLIRKIPE--D  880

Query  852  LPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQM-KEEIAQLSSRAVVFQATKCDL  910
            + +  +K+ +V  +++   + +  E   K F+SD  Q+ K ++A       V   T C +
Sbjct  881  MQIDDLKEKLVEIVSSYRIQQKLCEGCNKVFESDRVQLLKRQVAVRKRGRRVAPRTACSI  940

Query  911  CNHDLDLP------------AVH---FMCQHSFHLNCISETDR  938
            CN  +  P            A+H   F C H++HL C+ E  R
Sbjct  941  CNELIRPPTSTGGRSGAVSAAMHVCIFECGHNYHLPCLEEKIR  983

>PHALS_11598
Length=1421

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 58/111 (52%), Gaps = 11/111 (10%)

Query  355  PLAPNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSM-GHVYRLSEKDTTSK--LEILFR  411
            PLA  A   GA    D++  ++  V EFG  FV+SS+ G +Y+L+E  +  K  ++ +F+
Sbjct  280  PLASGAV--GAFLSSDDVNHLKAFVREFGLRFVLSSLEGRIYQLNEIVSAMKKGVKNVFK  337

Query  412  ------KNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQY  456
                  K+L    +S + + +Y  ++I    R+  D  +   DY+ +L+ Y
Sbjct  338  SWLRKPKDLRMSNVSASGNVSYKSDAIESQTRLLADTAFLVRDYELALQMY  388

>PHALS_03538
Length=903

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 14/116 (12%)

Query  77   VLVTIGDGIDPRDEELREQSKAIA-EAGRGPNAEEMYTSKPTGKSTAVVRFWR-------  128
            V+    D     D+  R  S  I+ +A   P++ +++TSKP   S+   R+WR       
Sbjct  99   VISNASDTTAAVDDSRRVTSDMISFKATVVPSSNDVWTSKPRNVSSPKRRYWRLVHRKKV  158

Query  129  TDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFKSDL  184
             DQ+D E K  LL+Q   F +   E  V   ++N DLS+       G+V   +SDL
Sbjct  159  NDQEDNE-KLTLLRQSHPFHEMKIESTVE--SMNSDLSKNGYMYSRGSV---ESDL  208

>PYIW_14857
Length=1013

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 65/156 (42%), Gaps = 24/156 (15%)

Query  792  DKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRE  851
            + D NLW   +             TS E    ++QLL     +  I P+++++ + +  E
Sbjct  803  ENDENLWDYLIDL---------SLTSKEN---VEQLLKFASQH-KIDPIKLIRKIPEDME  849

Query  852  LPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRAV-VFQATKCDL  910
              +  +KQ +V+ +AN   +        K F++D  Q+ +   +   RA  V   T C +
Sbjct  850  --IDDLKQKLVDIIANYRIQQNLCNGCSKVFENDRVQLLQRQVKTHKRARRVAVKTACLI  907

Query  911  CNHDLDLP--------AVHFMCQHSFHLNCISETDR  938
            CN  L  P           F C H +HL C+ +  R
Sbjct  908  CNEVLRAPTSGKESFHVCVFECGHCYHLPCLEDKMR  943

>PYAP_13333
Length=346

 Score = 35.4 bits (80),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 50/125 (40%), Gaps = 17/125 (14%)

Query  84   GIDPRDEELREQSKA-IAEAGRGPNAEEMYTSKPTGKSTAVVRFWRTDQQDREGKPKLLQ  142
            G+ P   EL+E+++   A A + P      T  P         FWR  ++ +  K   L 
Sbjct  75   GVTP---ELKERARNHCARAEKLPKEHAPVTLCPPELDKKSRFFWRMGERPKNTKFAELN  131

Query  143  QIPVFAKKYPEEAVTAF--------AVNDDLSQFAVGLKNGAVILFKSDLKRRADRPPQL  194
              PV  K++PE   T          A+ D +   A+GL      L K  L +R    P L
Sbjct  132  AEPVIPKEFPEWETTMNMWGGKMLDAITDLVEMAAIGLG-----LEKDALSKRIQNAPHL  186

Query  195  LQPAG  199
            L P G
Sbjct  187  LAPTG  191

>PYU1_G011262
Length=730

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 52/124 (42%), Gaps = 20/124 (16%)

Query  117  TGKSTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEA-------VTAFAVNDDLSQFA  169
             G     V  W T  Q R G   +L  I  +A      +       VTA   +DD   F 
Sbjct  195  VGCEDGTVECWDTRSQRRVG---ILDGIVAYAGGVSASSFDEAPVQVTALEFDDDGLTFG  251

Query  170  VGLKNGAVILFKSDLKRRADRPPQLLQPAGQY--PVTGLAF--TSKPVTATVAHVFLYAS  225
            VG  NG  +L+  DL  R+ +P  LLQ + QY  P+  L F   SK V ++ A V     
Sbjct  252  VGTSNGHCMLY--DL--RSSKP--LLQKSHQYGLPIIDLKFHDYSKKVVSSDAKVIKIWD  305

Query  226  TRRG  229
             R G
Sbjct  306  KRDG  309

>PYVX_13239
Length=1021

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 74/179 (41%), Gaps = 31/179 (17%)

Query  769  MLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLL  828
            +L Q H    D    ++ V++H   D NLW   +             TS E  +EL +  
Sbjct  794  ILTQMH----DINQAIQFVQEH---DENLWDYLIDL---------SLTSKENVEELLKFA  837

Query  829  ALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQ  888
                +   I P+++++ + +  E  +  +K+ ++  +AN   +        K F++D  +
Sbjct  838  ----SQHKIDPIKLIRKIPEGME--IENLKEKMIAIIANYRIQQSLCVGCNKVFENDRVE  891

Query  889  MKEEIAQLSSRAVVFQATK-CDLCNHDLDLP-----AVH---FMCQHSFHLNCISETDR  938
            +         RA    A K C +CN  L  P     ++H   F C H +HL C+ E  R
Sbjct  892  LLRRQVTAHKRARRVSAKKACAICNEVLRAPTSGKESIHVCVFECGHCYHLPCLEEKMR  950

>PYVX_13258
Length=646

 Score = 35.4 bits (80),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 71/170 (42%), Gaps = 28/170 (16%)

Query  91   ELREQSKAIAEAGRGPNAEEMYTSKPTGKSTAVVRFWRTDQQDREGKPKLLQQIPVFAKK  150
            +LR +++A    G  P    ++     G    VV  W T Q  R G+             
Sbjct  176  QLRPEAQAANVVGLNP----VHQLLGVGCEDGVVECWDTRQATRVGE----------LDA  221

Query  151  YPEEAVTAFAVNDDLSQFAVGLKNGAVILFKSDLKRRADRPPQLLQPAGQY--PVTGLAF  208
            +    VTA A +DD   FA G  +G V LF  DL  R+ RP  LL    QY  P+  + F
Sbjct  222  HSGSQVTALAFDDDGLTFATGSSDGIVKLF--DL--RSSRP--LLSKTHQYGLPIVNVQF  275

Query  209  --TSKPVTATVAHVFLYASTRRG--LTCYHCSHD--DPALVKSAGGAAAL  252
               ++ V +T A V      R G  LT      D  D  +V+SA G + +
Sbjct  276  HDYARKVLSTDAKVIKIWDPRDGQALTNVETPADVNDVCVVESAQGQSGV  325

>PYU1_G007955
Length=1018

 Score = 35.4 bits (80),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 37/156 (24%), Positives = 66/156 (42%), Gaps = 24/156 (15%)

Query  792  DKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRE  851
            + D NLW   +             TS E  +EL +      +   I P+++++ + +  E
Sbjct  808  ENDENLWEYLIDL---------SLTSKENVEELLRFA----SQHKIDPIKLIRKIPEDME  854

Query  852  LPVSVIKQYVVNQLANdekkieedeekikAFKSDTKQMKEEIAQLSSRAV-VFQATKCDL  910
              +  +KQ +++ +AN   +        K F++D   + +   +   +A  V   T C +
Sbjct  855  --IDDLKQKLIDIIANYRIQQNLCTGCNKVFENDRVTLLQRQVKSHKKARRVASKTMCLI  912

Query  911  CNHDLDLP-----AVH---FMCQHSFHLNCISETDR  938
            CN  L  P     +VH   F C H +HL C+ E  R
Sbjct  913  CNDVLRAPTSGKASVHVCVFECGHCYHLPCLEENMR  948

>PYVX_16007
Length=90

 Score = 32.3 bits (72),  Expect = 2.5, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 19/43 (44%), Gaps = 1/43 (2%)

Query  908  CDLCNHDLDLP-AVHFMCQHSFHLNCISETDRECITCSMDHRH  949
            C +C     +   V   C H FHL+CIS  +R  I     H H
Sbjct  43   CSICREPFGVKEQVILSCSHMFHLDCISSFERSDIIAYWHHNH  85

>SDRG_10146
Length=220

 Score = 33.9 bits (76),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 0/54 (0%)

Query  882  FKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  935
             K+ T      +AQL S  V      C +C   +D   +   CQH+FH  CI E
Sbjct  54   LKAYTPTSTTILAQLPSWQVAASDDACVICMSPMDDDRIALPCQHAFHHTCIRE  107

>CCA20583
Length=365

 Score = 34.3 bits (77),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (7%)

Query  903  FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET---DRECITC  943
            FQ+ +C +C ++L        C H FHL CI E     ++C  C
Sbjct  102  FQSQECLICLNELQTNLAAVQCGHVFHLICIKEAFEYKKQCPVC  145

>H257_03925
Length=290

 Score = 33.9 bits (76),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 28/62 (45%), Gaps = 6/62 (10%)

Query  903  FQATKCDLCNH---DLDL---PAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQ  956
             + T C +C     D+D    P  H  C H FHL+CI E  +   TC +  R +  ++  
Sbjct  133  IKTTSCAICWESCGDIDFCSSPPHHLPCGHGFHLSCIREWMKRDATCPLCRRALPSVQDT  192

Query  957  LE  958
             E
Sbjct  193  FE  194

>PYIR_16746
Length=335

 Score = 33.9 bits (76),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 36/83 (43%), Gaps = 13/83 (16%)

Query  126  FWRTDQQDREGKPKLLQQIPVFAKKYPE-EAVTAF-------AVNDDLSQFAVGLKNGAV  177
            FWR   + +E K   L   PV  K +PE E+V          A+ D +   A+GL     
Sbjct  115  FWRIGDRPKETKFSELNAEPVVPKAFPEWESVMNMWGGKMMNAIRDLVEIAAIGLG----  170

Query  178  ILFKSDLKRRADRPPQLLQPAGQ  200
             L K  L +R +  P LL P G 
Sbjct  171  -LEKDTLSKRLEYGPHLLAPTGS  192

>HYAP_07166
Length=76

 Score = 31.2 bits (69),  Expect = 5.7, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 4/32 (13%)

Query  912  NHDLDLPAVHFMCQHSFHLNCISETDRECITC  943
            NH+LD+  V   C H+FH +C+   D+ C TC
Sbjct  38   NHNLDV--VLLPCGHAFHDDCLD--DKSCPTC  65

>SDRG_01781
Length=335

 Score = 33.9 bits (76),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 37/73 (51%), Gaps = 6/73 (8%)

Query  575  KKHEEHSW---YLKIQLD--HISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNL  629
            + H   SW   Y+ +  D   +SY DS+ ++  SD  KE+ +  L  IE   +S+    +
Sbjct  20   RGHVMKSWRRRYMVLDGDTLKVSYFDSK-TIYKSDKPKEKGSFILAEIEKHDYSDEGGGV  78

Query  630  RKYGRTLVTHMPG  642
            + YG  LV H PG
Sbjct  79   KPYGFKLVGHAPG  91

>H310_13109
Length=348

 Score = 33.9 bits (76),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 49/109 (45%), Gaps = 10/109 (9%)

Query  517  KFIQLDEVIDAKKTKGGSDSGDLTPRNGGAAAANL----NFDVETAISVLWENYPQHALT  572
            +FIQ+ EVI A   + G           G AA  L    +  V  A+S    +      T
Sbjct  240  RFIQVVEVIPADGDEVGFRDAAPPAAEQGIAAPPLPSVPSIVVTPALSTRPCSTCGGNFT  299

Query  573  LAKKHEEH---SWY---LKIQLDHISYVDSEDSVALSDSEKERVADALE  615
             A  H EH    W+   LK++    + VD    +ALSD+E +RV DAL+
Sbjct  300  DAAHHREHFRSRWHRYNLKMKARKDAVVDEASFLALSDAEVQRVFDALD  348

>PHYRA_76592
Length=885

 Score = 33.9 bits (76),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query  570  ALTLAKKHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEH  619
            A  LA  H+E SW+  I+ D ++YV+ E+S AL + E     D +E +EH
Sbjct  721  AAALAILHQEDSWFCSIK-DGLAYVNGENSTALPNCEVFENYD-MEALEH  768

>PHYRA_73746
Length=268

 Score = 33.5 bits (75),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 9/91 (10%)

Query  620  LSFSEADSNLRKYGRTLVTHMPG---PTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVS  676
             + S      + +  TL T  PG      +L +RL    F+P N   +         F++
Sbjct  64   FALSNLSGRAKNWAYTLETTSPGCFASWEQLCERL-RAAFLPANDEFRQR-----SRFLA  117

Query  677  HRAQLKEFLQYIVEVETVSNTSIGNTLLEMV  707
             R   +E  +Y+ E+ T++++ +GN LLE V
Sbjct  118  CRQGKRELYEYVQEMRTLASSLVGNPLLEDV  148

>PYAP_21787
Length=520

 Score = 33.9 bits (76),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  416  SIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIG  461
            S+  + +   +YD     DI R  G+  Y++GDY  +++ Y R++G
Sbjct  145  SVTTTSSAVKSYDGRPREDIEREEGNEHYKRGDYVAAIKSYTRSLG  190

>PYAR_20912
Length=266

 Score = 33.1 bits (74),  Expect = 6.7, Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%)

Query  906  TKCDLCNHDLDLPAVHFMCQHSFHLNCIS---ETDRECITC  943
            T C +C   +  P     CQH FH++CI    +    C TC
Sbjct  72   TNCVVCMETMREPCAKLPCQHHFHIHCIEPWLKLHSTCPTC  112

>SPRG_19519
Length=148

 Score = 32.0 bits (71),  Expect = 8.3, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 20/43 (47%), Gaps = 0/43 (0%)

Query  893  IAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  935
            +AQL S         C +C   +D   +   CQH+FH  CI E
Sbjct  56   LAQLPSWQAAPTDDACVICMSPMDDDRIALPCQHAFHHACIRE  98

>CCI42121
Length=582

 Score = 33.5 bits (75),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (48%), Gaps = 3/44 (7%)

Query  903  FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET---DRECITC  943
            FQ+ +C +C ++L        C H FHL CI E      +C  C
Sbjct  227  FQSQECLICLNELQTNLATIQCGHVFHLICIKEALKYKEQCPIC  270

>SDRG_12116
Length=226

 Score = 32.7 bits (73),  Expect = 9.2, Method: Composition-based stats.
 Identities = 19/74 (26%), Positives = 33/74 (45%), Gaps = 12/74 (16%)

Query  895  QLSSRAVVFQATKCDLCNHDLDLP-------AVHFMCQHSFHLNCISE---TDRECITCS  944
            Q ++RA++ +A  C +C  ++  P        V   C+H +H  C+ +   T + C  C 
Sbjct  152  QFTTRAILDEA--CAICLDEIQAPDLVDGRHVVQLPCRHVYHQRCVGQWLRTKQTCPLCR  209

Query  945  MDHRHILGLKTQLE  958
                 I GL+   E
Sbjct  210  DPTTQITGLRLACE  223

>SPRG_06336
Length=335

 Score = 33.1 bits (74),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 36/71 (51%), Gaps = 6/71 (8%)

Query  577  HEEHSW---YLKIQLD--HISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNLRK  631
            H   SW   Y+ +  D   +SY DS+ ++  SD  KE+ +  L  IE   +S+    ++ 
Sbjct  22   HVMKSWRRRYMVLDGDTLKVSYYDSK-TIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKP  80

Query  632  YGRTLVTHMPG  642
            YG  LV H PG
Sbjct  81   YGFKLVGHAPG  91

Lambda      K        H        a         alpha
   0.319    0.135    0.399    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 84344637375

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40