Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_4718861598224624611682e-163
PHYRA_847311598237124611508e-159
PHYCA_1230861598227124711364e-158
PITG_203131598224624611232e-156
PITG_206301617224624611203e-156
PPTG_101851598236324611315e-156
PHALS_051941598236324510708e-147
PHYKE_10819159823442469586e-130
PYIR_22643159824022459499e-128
PYAP_16572159824132459439e-127
PYIW_17753159823982459383e-126
PYU1_G001972159824002459221e-123
PYAR_24297159823862459071e-121
PYVX_14608159823852618801e-117
H310_07576161723512448632e-115
H257_07371161723512448598e-115
SPRG_12487161723462458511e-113
CCA18901161723732458504e-113
SDRG_05001161723462458458e-113
CCI45130159822482458341e-112
CCI45129161723722458322e-110
HYAP_13828159823732548262e-109
CCI451281617018312458361e-101
PYU1_G008336836514062355137e-62
PYVX_16542151513882335091e-61
PHYCA_533347836514172335084e-61
PYU1_G008337151514142335007e-60
PHYSO_552775151513952364917e-59
SDRG_12928151513412334861e-58
PHYCA_543819151514462334931e-58
PYVX_16559836513762414882e-58
PYIR_23853151514202334868e-58
PHYRA_83397151513842334822e-57
PPTG_17622151513952334822e-57
SPRG_06805151513412334773e-57
PHYRA_9659388456132334901e-56
PYIR_21123836513882184656e-55
PITG_19056151513902334491e-52
PYAR_21139836513572314226e-49
PYAR_21138151514552674078e-46
PYIW_28078167629108782731e-29
PYIW_26705836512301562454e-24
PYIW_27182151512761562195e-20
PYAP_1843715151451991185e-06
PYAR_21141884513939920.003
PYU1_G00182891031857770.58
CCA193581625868249751.4
SDRG_0423291049468713.2
PPTG_017665904669978714.2
SPRG_0743791049468704.5
PYIR_2332991043256705.1
PHYKE_68832637875113696.2
PPTG_075472045310855648.6
PYIW_2132691051760688.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_471886

Length=247
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYSO_471886                                                          454     2e-163
PHYRA_84731                                                           447     8e-159
PHYCA_123086                                                          442     4e-158
PITG_20313                                                            437     2e-156
PITG_20630                                                            436     3e-156
PPTG_10185                                                            440     5e-156
PHALS_05194                                                           416     8e-147
PHYKE_10819                                                           373     6e-130
PYIR_22643                                                            370     9e-128
PYAP_16572                                                            367     9e-127
PYIW_17753                                                            365     3e-126
PYU1_G001972                                                          359     1e-123
PYAR_24297                                                            353     1e-121
PYVX_14608                                                            343     1e-117
H310_07576                                                            337     2e-115
H257_07371                                                            335     8e-115
SPRG_12487                                                            332     1e-113
CCA18901                                                              332     4e-113
SDRG_05001                                                            330     8e-113
CCI45130                                                              325     1e-112
CCI45129                                                              325     2e-110
HYAP_13828                                                            322     2e-109
CCI45128                                                              326     1e-101
PYU1_G008336                                                          202     7e-62 
PYVX_16542                                                            200     1e-61 
PHYCA_533347                                                          200     4e-61 
PYU1_G008337                                                          197     7e-60 
PHYSO_552775                                                          193     7e-59 
SDRG_12928                                                            191     1e-58 
PHYCA_543819                                                          194     1e-58 
PYVX_16559                                                            192     2e-58 
PYIR_23853                                                            191     8e-58 
PHYRA_83397                                                           190     2e-57 
PPTG_17622                                                            190     2e-57 
SPRG_06805                                                            188     3e-57 
PHYRA_96593                                                           193     1e-56 
PYIR_21123                                                            183     6e-55 
PITG_19056                                                            177     1e-52 
PYAR_21139                                                            167     6e-49 
PYAR_21138                                                            161     8e-46 
PYIW_28078                                                            109     1e-29 
PYIW_26705                                                            99.0    4e-24 
PYIW_27182                                                            89.0    5e-20 
PYAP_18437                                                            50.1    5e-06 
PYAR_21141                                                            40.0    0.003 
PYU1_G001828                                                          34.3    0.58  
CCA19358                                                              33.5    1.4   
SDRG_04232                                                            32.0    3.2   
PPTG_01766                                                            32.0    4.2   
SPRG_07437                                                            31.6    4.5   
PYIR_23329                                                            31.6    5.1   
PHYKE_6883                                                            31.2    6.2   
PPTG_07547                                                            29.3    8.6   
PYIW_21326                                                            30.8    8.8   

>PHYSO_471886
Length=246

 Score = 454 bits (1168),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%), Gaps = 0/246 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTM
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTM  60

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            VVLLVAMVVKLALWYVCAKIASHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSSLWYL
Sbjct  61   VVLLVAMVVKLALWYVCAKIASHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSSLWYL  120

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240

Query  241  IRRDSP  246
            IRRDSP
Sbjct  241  IRRDSP  246

>PHYRA_84731
Length=371

 Score = 447 bits (1150),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 233/246 (95%), Positives = 240/246 (98%), Gaps = 0/246 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEAL+KGFNGHQR L IS FT+
Sbjct  126  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFNGHQRELNISTFTV  185

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VLLVA+V+KLALWYVCAKIA+HSPSADALAQDHRNDVFSNTVAVAAAFAAHWHS+LWY 
Sbjct  186  AVLLVAIVIKLALWYVCAKIAAHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSNLWYF  245

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH
Sbjct  246  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  305

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELD VERAFVHVDYLERNYDEHKDPT
Sbjct  306  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDQVERAFVHVDYLERNYDEHKDPT  365

Query  241  IRRDSP  246
            +RRDSP
Sbjct  366  LRRDSP  371

>PHYCA_123086
Length=271

 Score = 442 bits (1136),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 236/247 (96%), Positives = 242/247 (98%), Gaps = 1/247 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSV+YPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEAL+KGFNGHQR LEIS FTM
Sbjct  25   MHTPSVQYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFNGHQRELEISAFTM  84

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            +VLLVA+V+KL LWY CAKIASHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSSLWYL
Sbjct  85   LVLLVAIVIKLILWYFCAKIASHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSSLWYL  144

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH
Sbjct  145  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  204

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT
Sbjct  205  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  264

Query  241  IRR-DSP  246
            +RR DSP
Sbjct  265  LRRNDSP  271

>PITG_20313
Length=246

 Score = 437 bits (1123),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 231/246 (94%), Positives = 240/246 (98%), Gaps = 0/246 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEAL+KG  GHQR LEI++FT+
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGLKGHQRELEITSFTV  60

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            +VLLVA+VVKL LWY+CAKIASHSPSADALAQDHRNDVFSN VAVAAAFAAHWHSSLWYL
Sbjct  61   IVLLVAIVVKLLLWYICAKIASHSPSADALAQDHRNDVFSNFVAVAAAFAAHWHSSLWYL  120

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIR+LGDVHHPMMRTDIVRAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRVLGDVHHPMMRTDIVRAYH  180

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVE LDNVERAFVHVDYLERNYDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  240

Query  241  IRRDSP  246
            +RRDSP
Sbjct  241  VRRDSP  246

>PITG_20630
Length=246

 Score = 436 bits (1120),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 230/246 (93%), Positives = 241/246 (98%), Gaps = 0/246 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEAL++G  GHQR LEI++FT+
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVEGLKGHQRELEITSFTV  60

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            +VLLVA+VVKL LWY+CAKIASHSPSADALAQDHRNDVFSN+VAVAAAFAAHWHSSLWYL
Sbjct  61   IVLLVAIVVKLLLWYICAKIASHSPSADALAQDHRNDVFSNSVAVAAAFAAHWHSSLWYL  120

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIR+LGDVHHPMMRTDIVRAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRVLGDVHHPMMRTDIVRAYH  180

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVE LDNVERAFVHVDYLERNYDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  240

Query  241  IRRDSP  246
            +RRDSP
Sbjct  241  VRRDSP  246

>PPTG_10185
Length=363

 Score = 440 bits (1131),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 229/246 (93%), Positives = 240/246 (98%), Gaps = 0/246 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEAL+KGF GHQR L+ S+FTM
Sbjct  118  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFKGHQRELDFSSFTM  177

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            +VLLVA+V+KL LW++C KIASHSPSADALAQDHRNDVFSN+VAVAAAFAAHWHS+LWYL
Sbjct  178  IVLLVAIVIKLLLWHICTKIASHSPSADALAQDHRNDVFSNSVAVAAAFAAHWHSNLWYL  237

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DS+GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH
Sbjct  238  DSIGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  297

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVE LDNVERAFVHVDYLERNYDEHKDPT
Sbjct  298  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  357

Query  241  IRRDSP  246
            IRRDSP
Sbjct  358  IRRDSP  363

>PHALS_05194
Length=363

 Score = 416 bits (1070),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 216/245 (88%), Positives = 233/245 (95%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSV+AL+KGFNGH R ++IS+FT+
Sbjct  118  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVKALVKGFNGHLREIDISSFTL  177

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            +VLLVA+VVKL LWY+CAKIASHSPSADALAQDHRNDV+SN VAV+AAF AH H SLW L
Sbjct  178  IVLLVAIVVKLFLWYICAKIASHSPSADALAQDHRNDVYSNLVAVSAAFVAHKHPSLWCL  237

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DS+GAIVISVYIAVSWLATGKEQVERLVGLQA+QEFID IR LGDVHHP+M+TDIVRAYH
Sbjct  238  DSIGAIVISVYIAVSWLATGKEQVERLVGLQAEQEFIDHIRTLGDVHHPLMKTDIVRAYH  297

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVEMEVILPEDMCVK+AHDISLSLQ KVE LDNVERAFVHVDYLERNYDEHKDPT
Sbjct  298  FGNNYLVEMEVILPEDMCVKEAHDISLSLQIKVEGLDNVERAFVHVDYLERNYDEHKDPT  357

Query  241  IRRDS  245
            +RRDS
Sbjct  358  LRRDS  362

>PHYKE_10819
Length=344

 Score = 373 bits (958),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 198/246 (80%), Positives = 209/246 (85%), Gaps = 26/246 (11%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEP+AVIISATLMGMAAIEVIQQ+VE+L+KG NGHQR L+IS FTM
Sbjct  125  MHTPSVKYPAGRRRLEPVAVIISATLMGMAAIEVIQQAVESLVKGLNGHQRQLDISTFTM  184

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VLLVA         +  K+                 V  NTVAV AAFAAHWHS+LWYL
Sbjct  185  AVLLVA---------IVVKL-----------------VLCNTVAVGAAFAAHWHSNLWYL  218

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAIVISVYIAVSWLATGKEQVERLVGLQA QEFID+IRLLGD+HHPMMRTDIVRAYH
Sbjct  219  DSVGAIVISVYIAVSWLATGKEQVERLVGLQASQEFIDEIRLLGDIHHPMMRTDIVRAYH  278

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVE LDNVERAFVHVDYLERNYDEHKDPT
Sbjct  279  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  338

Query  241  IRRDSP  246
            +RRDSP
Sbjct  339  LRRDSP  344

>PYIR_22643
Length=402

 Score = 370 bits (949),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 185/245 (76%), Positives = 215/245 (88%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEV+Q+SVE L+ GF G+   L ++  T+
Sbjct  156  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVMQKSVETLVAGFKGNLPDLNMTLITI  215

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            V+L VA+ VKL LWY+C++IA++SPSADALAQDHRNDVFSN VAV  +  AHW   LWYL
Sbjct  216  VILCVAICVKLVLWYICSRIATNSPSADALAQDHRNDVFSNVVAVVTSALAHWQRDLWYL  275

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DS+G I+IS+YIA+SWLATGKEQVE+LVGLQAD +FI+QI  L D+HHP+M++DIVRAYH
Sbjct  276  DSIGGILISMYIALSWLATGKEQVEKLVGLQADPDFINQIYGLADLHHPLMKSDIVRAYH  335

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVE+EVILPE MCVK+AHDISL+LQDKVE LD VERAFVHVDY  R+YDEHKDPT
Sbjct  336  FGNNYLVELEVILPEQMCVKEAHDISLALQDKVEALDCVERAFVHVDYAPRDYDEHKDPT  395

Query  241  IRRDS  245
            IRRDS
Sbjct  396  IRRDS  400

>PYAP_16572
Length=413

 Score = 367 bits (943),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 178/245 (73%), Positives = 218/245 (89%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTP+V YPAGRRRLEPIA+IISATLMGMAAIEV+Q+S+E L+ GF G    L+++ FT+
Sbjct  167  MHTPNVNYPAGRRRLEPIALIISATLMGMAAIEVVQKSIETLVSGFAGSLPDLDMTPFTV  226

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VLL A+ +K+ LW++CA+I+++S SADALAQDHRNDVFSNTVAV+ +  +HW   LWY+
Sbjct  227  GVLLFAICIKIVLWWICARISTNSSSADALAQDHRNDVFSNTVAVSTSLLSHWKRDLWYV  286

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DS+GAI ISVYIA SWLATGKEQVERL+GL+AD +FI+QIR L D+HHP+M++DI+RAYH
Sbjct  287  DSIGAIAISVYIAFSWLATGKEQVERLIGLRADPDFIEQIRELTDLHHPLMKSDIIRAYH  346

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVE+EVILP DMCV++AHDISL+LQ+KVEELDNVERAFVHVDYL R+YDEHKDPT
Sbjct  347  FGNNYLVELEVILPADMCVREAHDISLALQNKVEELDNVERAFVHVDYLSRDYDEHKDPT  406

Query  241  IRRDS  245
            +RRDS
Sbjct  407  LRRDS  411

>PYIW_17753
Length=398

 Score = 365 bits (938),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 212/245 (87%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEV+Q+S E L+ G NGH   L ++  T+
Sbjct  152  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVMQKSGETLVAGVNGHLPDLNMTTSTI  211

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            VVL VA+ VKL LWY+C++IA +SPSADALAQDHRNDVFSN VAV  +  AHW   LWYL
Sbjct  212  VVLCVAICVKLVLWYICSRIAKNSPSADALAQDHRNDVFSNVVAVVTSVLAHWQRQLWYL  271

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVG IVIS+YIA+SWLATGKEQVE+LVGL+AD +FI QI  L D+HHP+M++DIVRAYH
Sbjct  272  DSVGGIVISLYIALSWLATGKEQVEKLVGLKADPDFIAQIHGLVDLHHPLMKSDIVRAYH  331

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVE+EVILPE MCV++AHDISL+LQDKVE LD VERAFVHVDY  R+YDEHKDPT
Sbjct  332  FGNNYLVELEVILPEQMCVREAHDISLALQDKVEALDCVERAFVHVDYASRDYDEHKDPT  391

Query  241  IRRDS  245
            IRRDS
Sbjct  392  IRRDS  396

>PYU1_G001972
Length=400

 Score = 359 bits (922),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 209/245 (85%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPSV+YPAGRRRLEPIAVIISATLMGMAA+EVIQ+S E LI G  G+   L +S  T+
Sbjct  154  MHTPSVRYPAGRRRLEPIAVIISATLMGMAAVEVIQKSTETLIAGTKGNLPDLNMSALTI  213

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
            ++L VA+ VKL LW++C++IA +SPSADALAQDHRNDVFSN VAV  +  AH+   LWYL
Sbjct  214  LILCVAICVKLVLWFICSRIAKNSPSADALAQDHRNDVFSNAVAVLTSVIAHYQRDLWYL  273

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DS+G I+IS+YIA+SWLATGKEQVE+L GLQAD  FID+I  L DVHHP++R+DIVRAYH
Sbjct  274  DSIGGILISLYIALSWLATGKEQVEKLAGLQADSAFIDEIYELVDVHHPLLRSDIVRAYH  333

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVE+EVILPE MCVKDAHDISL+LQ KVE LD VERAFVHVDY  R+YDEHKDPT
Sbjct  334  FGNNYLVELEVILPETMCVKDAHDISLALQHKVEALDAVERAFVHVDYAPRDYDEHKDPT  393

Query  241  IRRDS  245
            IRRDS
Sbjct  394  IRRDS  398

>PYAR_24297
Length=386

 Score = 353 bits (907),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/245 (71%), Positives = 212/245 (87%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTP+V YPAGRRRLEPIAV+ISATLMGMAAIEV+Q+S+E L+ G+NG    L+++  T+
Sbjct  141  MHTPNVNYPAGRRRLEPIAVVISATLMGMAAIEVVQKSIETLVTGYNGSLPDLDMTPLTI  200

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VL+ A+ +KL LW +CA+IA++S SADALAQDHRNDVFSN+VAV  +  AH+   LWY 
Sbjct  201  GVLVFAIAIKLVLWSICARIAANSSSADALAQDHRNDVFSNSVAVTTSLIAHYRRDLWYT  260

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DS+GAI ISVYI  SWLATGKEQVERL+GL A+ +FI++IR L D+HHP+M++DIVRAYH
Sbjct  261  DSLGAIAISVYIGFSWLATGKEQVERLIGLGAEPDFIERIRALVDLHHPLMQSDIVRAYH  320

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNNYLVE+EVILP  MCV++AHDISL+LQ+KVEELDNVERAFVHVDYL R+YDEHKDPT
Sbjct  321  FGNNYLVELEVILPATMCVREAHDISLALQNKVEELDNVERAFVHVDYLARDYDEHKDPT  380

Query  241  IRRDS  245
            IRRDS
Sbjct  381  IRRDS  385

>PYVX_14608
Length=385

 Score = 343 bits (880),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/261 (70%), Positives = 207/261 (79%), Gaps = 16/261 (6%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGM----------------AAIEVIQQSVEALIK  44
            MHT  VKYPAGRRRLEPIAVIISATLMGM                AAIEVIQ+SVE L+ 
Sbjct  124  MHTRDVKYPAGRRRLEPIAVIISATLMGMTGECVPSLSLLTQWVLAAIEVIQKSVETLVM  183

Query  45   GFNGHQRVLEISNFTmvvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTva  104
            G+ G    + IS  T+ VLL A++ KL LWY+C  I++ SPSADALAQDHRNDV+SN++A
Sbjct  184  GWKGTLPDMNISIITLAVLLAAIITKLVLWYICRLISTQSPSADALAQDHRNDVYSNSIA  243

Query  105  vaaafaaHWHSSLWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLG  164
            + AA  A+WH +LWYLDS GAIVISVYIAVSWL TGKEQVERLVGLQA QEFID+IR L 
Sbjct  244  IIAACLANWHKNLWYLDSAGAIVISVYIAVSWLETGKEQVERLVGLQASQEFIDEIRKLA  303

Query  165  DVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFV  224
            D HH +M+ DIVRAYHFGNNYLVE+EVILPE M V++AHDISLSLQ  VEELD VERAFV
Sbjct  304  DTHHSLMKADIVRAYHFGNNYLVEIEVILPESMRVREAHDISLSLQKAVEELDTVERAFV  363

Query  225  HVDYLERNYDEHKDPTIRRDS  245
            HVDYL R+YDEHKD TIRRDS
Sbjct  364  HVDYLPRDYDEHKDTTIRRDS  384

>H310_07576
Length=351

 Score = 337 bits (863),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 207/244 (85%), Gaps = 0/244 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTP+ KYPAGRRRLEPIAV++SATLMGMA++EV+Q+SV  LI+GF GH   L++S  T+
Sbjct  108  MHTPNEKYPAGRRRLEPIAVVVSATLMGMASLEVVQKSVTTLIEGFGGHLPELDMSILTI  167

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VL VA+ VKL LW++C +IA  SPSA ALAQDHRNDVFSN VAV+ +  AH++S LWY 
Sbjct  168  AVLGVAITVKLMLWFICGQIAYVSPSAAALAQDHRNDVFSNLVAVSTSLMAHYYSGLWYF  227

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            D +GAI IS+YI +SW+ATGKEQVERLVGLQAD++FI+++R + D HHP +++DI+RAYH
Sbjct  228  DPIGAIAISIYITLSWVATGKEQVERLVGLQADEDFIERVRAIADAHHPKLQSDIIRAYH  287

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNN+LVE+EV+LP+DM V+++HDISL+LQ KVE LD VERAFVHVDY  R+YDEHKDPT
Sbjct  288  FGNNFLVELEVVLPKDMSVQESHDISLALQIKVEALDEVERAFVHVDYQSRDYDEHKDPT  347

Query  241  IRRD  244
            +R D
Sbjct  348  VRLD  351

>H257_07371
Length=351

 Score = 335 bits (859),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 205/244 (84%), Gaps = 0/244 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTP+ KYPAGRRRLEPIAV++SATLMGMAA+EV+Q+SV  LI+GF G    L++S  T+
Sbjct  108  MHTPNAKYPAGRRRLEPIAVVVSATLMGMAALEVVQKSVTTLIEGFGGQLPELDMSIPTV  167

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VL +A++VKL LW++C +IA  SPSA ALAQDHRNDVFSN VAV  +  AH++S LWY 
Sbjct  168  AVLGIAIIVKLMLWFLCGQIAYVSPSAAALAQDHRNDVFSNAVAVTTSLVAHYNSELWYF  227

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            D +GAI IS+YI +SW+ATGKEQVERLVGLQADQ+FID++R + D HHP +++DI+RAYH
Sbjct  228  DPIGAIAISIYITLSWVATGKEQVERLVGLQADQDFIDRVRTIADAHHPKLQSDIIRAYH  287

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNN+LVE+EV+LP+DM V+++HDISL+LQ KVE LD VERAFVHVDY  R+YDEHKDPT
Sbjct  288  FGNNFLVELEVVLPKDMSVQESHDISLALQIKVEALDEVERAFVHVDYQSRDYDEHKDPT  347

Query  241  IRRD  244
             R D
Sbjct  348  ARLD  351

>SPRG_12487
Length=346

 Score = 332 bits (851),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 205/245 (84%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPS  YPAGRRRLEPIAV++SATLMGMA++EV+Q+S+  LI+GFNGH   L++S  T+
Sbjct  101  MHTPSPDYPAGRRRLEPIAVVVSATLMGMASLEVVQKSIATLIEGFNGHLPELDMSILTI  160

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VL +A+VVKL LW++CA+IA  SPSA ALAQDHRNDVFSN VAV  +  AH++  +WYL
Sbjct  161  AVLAIAIVVKLILWFLCAQIAHVSPSAAALAQDHRNDVFSNAVAVTTSMIAHYNVEMWYL  220

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            D +GAI IS+YI  SWL TGKEQV+RLVG+QAD++FI +I  + D HHP M++DIVRAYH
Sbjct  221  DPIGAICISIYITWSWLETGKEQVDRLVGIQADEDFIARIDGIADTHHPDMQSDIVRAYH  280

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNN+LVE+EVI+P+ M V DAHDISL+LQ KVEELD VERAFVHVDY  R+YDEHKDPT
Sbjct  281  FGNNFLVELEVIMPKSMTVGDAHDISLALQKKVEELDAVERAFVHVDYESRDYDEHKDPT  340

Query  241  IRRDS  245
            IR+DS
Sbjct  341  IRKDS  345

>CCA18901
Length=373

 Score = 332 bits (850),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 199/245 (81%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPS KYPAGRRRLEPI VIISATLMGMAA+EVIQ++VE LI G+ G    ++++ FT+
Sbjct  126  MHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTI  185

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VLL A+  K  LWY+C +I   SP+A A+AQDHRNDV SN+ AV  +  A  H++LWY+
Sbjct  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FID++R   + HHP M+ DI+RAYH
Sbjct  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+EE DNVERAFVHVDYL R YDEHKDPT
Sbjct  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPT  365

Query  241  IRRDS  245
            +RR +
Sbjct  366  LRRST  370

>SDRG_05001
Length=346

 Score = 330 bits (845),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 204/245 (83%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPS  YPAGRRRLEPIAV++SATLMGMA++EV+Q+S+  LI+GFNGH   L++S  T+
Sbjct  101  MHTPSPDYPAGRRRLEPIAVVVSATLMGMASLEVVQKSIATLIEGFNGHVPELDMSILTI  160

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VL VA+VVKL LW++CA+IA  SPSA ALAQDHRNDVFSN VAV  +  AH++   WYL
Sbjct  161  AVLAVAIVVKLILWFLCAQIAHVSPSAAALAQDHRNDVFSNGVAVTTSMIAHYNIDAWYL  220

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            D +GAI IS+YI  SWL TGKEQV+RLVG+QAD++FI +I  + D HHP M++DIVRAYH
Sbjct  221  DPIGAICISIYITWSWLETGKEQVDRLVGIQADEDFIQRIHAIADSHHPDMQSDIVRAYH  280

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FGNN+LVE+EV++P+ M V DAHDISL+LQ KVEELD VERAFVHVDY  R+YDEHKDPT
Sbjct  281  FGNNFLVELEVVMPKSMTVGDAHDISLALQKKVEELDAVERAFVHVDYESRDYDEHKDPT  340

Query  241  IRRDS  245
            IR+DS
Sbjct  341  IRKDS  345

>CCI45130
Length=248

 Score = 325 bits (834),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE LI G+ G    + ++  T+
Sbjct  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VLL A+  K  LWY+C +I   SP+A ALAQDHRNDV SN  AV  +     H +LWY+
Sbjct  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+EE D+VERAFVHVDYL R YDEHKDPT
Sbjct  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240

Query  241  IRRDS  245
            +RR +
Sbjct  241  LRRST  245

>CCI45129
Length=372

 Score = 325 bits (832),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 0/245 (0%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE LI G+ G    + ++  T+
Sbjct  125  MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  184

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             VLL A+  K  LWY+C +I   SP+A ALAQDHRNDV SN  AV  +     H +LWY+
Sbjct  185  AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  244

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  245  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  304

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+EE D+VERAFVHVDYL R YDEHKDPT
Sbjct  305  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  364

Query  241  IRRDS  245
            +RR +
Sbjct  365  LRRST  369

>HYAP_13828
Length=373

 Score = 322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/254 (70%), Positives = 193/254 (76%), Gaps = 14/254 (6%)

Query  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQ-RVLEISNFT  59
            MHTPSV+YPAGRRRLEPIAVI+SATLMGMA      Q   A  +  + H  R     +  
Sbjct  124  MHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDS--  181

Query  60   mvvllvamvvklalWYVCAKIASHSPSADALAQD--------HRNDVFSNTvavaaafaa  111
                    +V++   Y+       S    ++  D        HRNDVFSNT+A+ AAFA 
Sbjct  182  ---SQARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFAT  238

Query  112  HWHSSLWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMM  171
            H HSS WYLDS+GA+VISVYIAVSWLATGKEQVERLVGLQA QEFIDQIRLLGDVHHPMM
Sbjct  239  HCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMM  298

Query  172  RTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLER  231
            RTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISL+LQ KVEELDNVERAFVHVDYLER
Sbjct  299  RTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLER  358

Query  232  NYDEHKDPTIRRDS  245
            NYDEHKDPTIRRDS
Sbjct  359  NYDEHKDPTIRRDS  372

>CCI45128
Length=1831

 Score = 326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 0/245 (0%)

Query  1     MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTm  60
             MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE LI G+ G    + ++  T+
Sbjct  1584  MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  1643

Query  61    vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
              VLL A+  K  LWY+C +I   SP+A ALAQDHRNDV SN  AV  +     H +LWY+
Sbjct  1644  AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  1703

Query  121   DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
             DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  1704  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  1763

Query  181   FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240
             FG+NYLVE+EVILPE M V++AHDISL LQ K+EE D+VERAFVHVDYL R YDEHKDPT
Sbjct  1764  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  1823

Query  241   IRRDS  245
             +RR +
Sbjct  1824  LRRST  1828

>PYU1_G008336
Length=406

 Score = 202 bits (513),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 158/235 (67%), Gaps = 7/235 (3%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISN----FTmv  61
            KYPAG  R EP+A+I+++++M + ++  IQ+ V  L+ GF +G+    ++S      +  
Sbjct  111  KYPAGTSRFEPVAIIVASSIMVLVSVTFIQEGVTKLVDGFAHGNPESPKLSTIAIVLSST  170

Query  62   vllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLD  121
            ++++ + +    ++   +  ++S +A A+  D+RNDV SN+ A+ A   +     LWY+D
Sbjct  171  IVVIKIGLVAYSYWTIKR--TYSAAAHAIGDDNRNDVVSNSFAICAYIISSSDEDLWYVD  228

Query  122  SVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHF  181
            ++GAIVI + I  +W   GKEQV +LVG+ A +EF+ +++ L   HHP M  DI+RAYHF
Sbjct  229  ALGAIVIFLLIMFAWAKMGKEQVAQLVGVSASEEFMTEVKELCASHHPTMSLDIMRAYHF  288

Query  182  GNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
            G+ YLVE+EV++P DM VK AHDI+L LQ KVE L++VERAFVHVDY  R+YDEH
Sbjct  289  GSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKSRDYDEH  343

>PYVX_16542
Length=388

 Score = 200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 161/233 (69%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISNFTmvvllv  65
            KYPAG  R EP+A+I++A++M +AA+  IQ+SV  +  G  +      ++S   +V++++
Sbjct  83   KYPAGTSRFEPVAIIVAASIMVLAAVYFIQESVTKIFNGLVHDDFEAPDLSVAAIVIVVL  142

Query  66   amvvklalWYVCAKI--ASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A+V K+ L +    I  ++ S + +A+ QD+ ND  SN++A+AA   A    S WY+D  
Sbjct  143  AVVTKIGLVFYSGWILKSTFSAAVEAIHQDNINDTMSNSIAIAAYIVAAVKPSAWYVDPA  202

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GA++I VYI  SW    KEQV++LVG+ AD+EFI +++ L   HHP+M  DIVRAYHFGN
Sbjct  203  GAMLIFVYIMYSWGKMAKEQVQQLVGVSADEEFIQEVKDLCARHHPLMALDIVRAYHFGN  262

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P DM VK AHDI+L LQ KVE LD VERAFVHVDY  R+YDEH
Sbjct  263  KYLVELEVVVPGDMSVKMAHDIALQLQFKVENLDQVERAFVHVDYQSRDYDEH  315

>PHYCA_533347
Length=417

 Score = 200 bits (508),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 159/233 (68%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISNFTmvvllv  65
            KYPAG  R EP+A+I++A++M +A+I  IQ+S   LI GF +G      +S   +V+++ 
Sbjct  112  KYPAGTSRFEPVAIIVAASVMVLASIVFIQESARKLIDGFTSGEPEAPSLSTAAIVIVVT  171

Query  66   amvvklalWYVCAKI--ASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A++VK+ L    A I  ++ S + +A+ QD+ ND  SN+ A+AA   A   S  WY+D  
Sbjct  172  AVIVKIGLMIYSAWILKSTFSAAVEAIHQDNLNDTISNSFAIAAYIVAAVESEAWYVDPA  231

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I +YI VSW     EQV +LVG+ A ++F+ Q++ L   HHP M  DIVRAYHFG+
Sbjct  232  GAILIFIYIMVSWGKMAWEQVTQLVGVCASEDFVLQVKELSRHHHPSMTLDIVRAYHFGS  291

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P +M VKDAHDI+L LQ KVE LD VERAFVHVDY  R+YDEH
Sbjct  292  KYLVELEVVVPAEMSVKDAHDIALQLQFKVENLDEVERAFVHVDYQSRDYDEH  344

>PYU1_G008337
Length=414

 Score = 197 bits (500),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 157/233 (67%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISNFTmvvllv  65
            KYPAG  R EP+A+I++A++M + ++  IQ+ V  L+ GF +G     ++S   +V++ +
Sbjct  127  KYPAGTSRFEPVAIIVAASIMVLVSVVFIQEGVTKLVDGFAHGQPEAPKLSAAAVVIVTL  186

Query  66   amvvklalWYVCAKIA--SHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A++VK+ L +    +   + S S +A+  D+RND  SN  A+ A   +     LWY+D  
Sbjct  187  AVLVKIGLIFYSRWVLKFTFSASVEAIQDDNRNDTISNAFAIIAYIISSVDEGLWYVDPA  246

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I ++I  +W   GKEQV +LVG+ A +EF+ +++ L   HHP M  DI+RAYHFG+
Sbjct  247  GAILIFLFIMFAWGKMGKEQVAQLVGVCASEEFMTEVKELCASHHPSMSLDIMRAYHFGS  306

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P DM VK AHDI+L LQ KVE L++VERAFVHVDY  R+YDEH
Sbjct  307  KYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKSRDYDEH  359

>PHYSO_552775
Length=395

 Score = 193 bits (491),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 155/236 (66%), Gaps = 9/236 (4%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNG------HQRVLEISNFTm  60
            KYPAG  R EP+A+I++A++M +A+I  IQ++V+ L+ GF+       H     I+    
Sbjct  102  KYPAGTSRFEPVAIIVAASVMVLASIVFIQEAVKKLVDGFSSDEPEAPHLSAAAIAIAVT  161

Query  61   vvllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYL  120
             V++   ++  + W + + +   S + +A+ QD+ ND  SN+ AVAA   A      WY+
Sbjct  162  AVVVKIGLMFYSAWILKSTV---SVAVEAIHQDNLNDTLSNSFAVAAYIIAAVEPKAWYV  218

Query  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            D  GAI+I VYI V+W     EQV +LVG+ A +EFI++++ L + HHP M  DIVRAYH
Sbjct  219  DPAGAILIFVYIMVAWGKMAWEQVTQLVGVCASEEFIEEVKDLCNRHHPSMSLDIVRAYH  278

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
            FG+ YLVE+EV++P +M VK AHDI+L +Q KVE L+ VERAFVHVDY  R+YDEH
Sbjct  279  FGSKYLVELEVVVPGEMSVKLAHDIALQMQFKVENLEEVERAFVHVDYQARDYDEH  334

>SDRG_12928
Length=341

 Score = 191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 142/233 (61%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTmvvllva  66
            K+PAG  R EPI V++SAT+M + ++ VI +S   L  GF   +    + + T +V+   
Sbjct  68   KFPAGTSRFEPILVVLSATIMSVISVIVIYESSMRLHDGFASGEPDGAVMSTTAIVICSC  127

Query  67   mvvklalWYVCAKIA---SHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
             V       + A  A   + S S  A+ QD+ ND  SN  A+     A    SLWY+D  
Sbjct  128  AVAIKIGLVIYAGFALRITQSSSVKAIQQDNINDTVSNAFAIIVYAIAASDPSLWYIDPA  187

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I + I V W+ T KEQV +LVG+ A  +FID ++ L D HH     DI+RAYHFGN
Sbjct  188  GAILIFLAILVIWVRTAKEQVLQLVGVSASPDFIDVVKELCDNHHASFALDIIRAYHFGN  247

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV+ P  M VK AHDISL LQ K+E+LD+VERAFVHVDY  R YDEH
Sbjct  248  KYLVELEVVAPATMTVKQAHDISLQLQFKIEQLDDVERAFVHVDYQTRAYDEH  300

>PHYCA_543819
Length=446

 Score = 194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 160/233 (69%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQ-RVLEISNFTmvvllv  65
            KYPAG  R EP+A+I++A++M +A+I  I ++V+ LI GF+  +     +S   + + + 
Sbjct  153  KYPAGTSRFEPVAIIVAASVMVLASIVFIHEAVQKLIDGFSSDEPEAPNLSAAAIAIAVT  212

Query  66   amvvklalWYVCAKI--ASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A+VVK+ L +  A I  ++ S + +A+ QD+ ND+ SN+ AVAA   A      WY+D  
Sbjct  213  AVVVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYVDPA  272

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I VYI VSW     EQV +LVG+ A +EFI +++ L + HHP M+ DIVRAYHFG+
Sbjct  273  GAIIIFVYIMVSWGKMAWEQVTQLVGVCASEEFIGEVKDLCNRHHPSMKLDIVRAYHFGS  332

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P +M VK AHDI+L +Q KVE L+ VERAFVHVDY  R+YDEH
Sbjct  333  KYLVELEVVVPGEMSVKLAHDIALQMQFKVENLEEVERAFVHVDYQSRDYDEH  385

>PYVX_16559
Length=376

 Score = 192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 151/241 (63%), Gaps = 23/241 (10%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTmvvllva  66
            KYPAG  R EP+A+I++A++M + A+  IQ+S      G        E  + +   +++ 
Sbjct  81   KYPAGTSRFEPVAIIVAASIMVLVAVFFIQES------GXXXXXDDFEAPDLSAAAIVIV  134

Query  67   mvvklalWYVCAKI-----------ASHSPSADALAQDHRNDVFSNTvavaaafaaHWHS  115
             +       V +KI           +++S + +A+ QD+ ND  SN++AV A   A    
Sbjct  135  SLA------VVSKIGLIFYSGWILKSTYSAAVEAIHQDNINDTMSNSIAVIAYIIAAVKP  188

Query  116  SLWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDI  175
            S WY+D  GA++I VYI  SW    KEQV++LVG+ AD+EFI +++ L   HHP+M  DI
Sbjct  189  SAWYVDPAGAMLIFVYIMYSWGKMAKEQVQQLVGVSADEEFIQEVKDLCARHHPLMALDI  248

Query  176  VRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDE  235
            VRAYHFGN YLVE+EV++P DM VK AHDI+L LQ KVE L+ VERAFVHVDY  R+YDE
Sbjct  249  VRAYHFGNKYLVELEVVVPGDMSVKMAHDIALQLQFKVENLEPVERAFVHVDYRSRDYDE  308

Query  236  H  236
            H
Sbjct  309  H  309

>PYIR_23853
Length=420

 Score = 191 bits (486),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 157/233 (67%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISNFTmvvllv  65
            KYPAG  R EP+A+I+++++M + ++  IQ+ V  L+ G  +G     ++S   ++++ +
Sbjct  126  KYPAGTSRFEPVAIIVASSIMVLVSVVFIQEGVTKLVDGLAHGQPEAPKLSATAVIIVCL  185

Query  66   amvvklalWYVCAKIAS--HSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A++VK+ L +    + +  +S S +A+  D+RND  SN  A+ A   +     LWY+D  
Sbjct  186  AVLVKIGLIFYSRWVLTFTYSASVEAIQDDNRNDTISNAFAIIAYIISSVDEDLWYVDPA  245

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I ++I  +W   GKEQV +LVG+ A +EF+ +++ L   HHP M  DI+RAYHFG+
Sbjct  246  GAILIFLFIMFAWGKMGKEQVAQLVGVCASKEFMAEVKELCSHHHPSMALDIIRAYHFGS  305

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P DM VK AHDI+L LQ KVE L++VERAFVHVDY  R+YDEH
Sbjct  306  KYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKARDYDEH  358

>PHYRA_83397
Length=384

 Score = 190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 159/233 (68%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQ-RVLEISNFTmvvllv  65
            KYPAG  R EP+A+I++A++M +A+I  I ++V  L  GF+  +     +S   + + + 
Sbjct  91   KYPAGTSRFEPVAIIVAASVMVLASIVFIHEAVVKLADGFSSDEPEAPNLSAAAIAIAVT  150

Query  66   amvvklalWYVCAKIASHSPSA--DALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A+VVK+ L +  A I   + SA  +A+ QD+ ND+ SN+ AVAA   A   S  WY+D  
Sbjct  151  AVVVKIGLMFYSAWILKTTVSAAVEAIHQDNFNDMLSNSFAVAAYIVAAVESEAWYVDPA  210

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I VYI V+W     EQ+ +LVG+ A+++FI++++ L   HHP M  DIVRAYHFG+
Sbjct  211  GAIIIFVYIMVAWGKMAWEQITQLVGVCANEDFIEEVKELCRQHHPSMELDIVRAYHFGS  270

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P +M VK AHDI+L +Q KVE+L+ VERAFVHVDY  R+YDEH
Sbjct  271  KYLVELEVVVPGEMSVKLAHDIALQMQFKVEKLEEVERAFVHVDYQARDYDEH  323

>PPTG_17622
Length=395

 Score = 190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 158/233 (68%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQ-RVLEISNFTmvvllv  65
            KYPAG  R EP+A+I++A++M +A+I  I ++ + L+ GF+  +     +S   + + + 
Sbjct  102  KYPAGTSRFEPVAIIVAASVMVLASIVFIHEAAQKLVDGFSSDEPEAPNLSAAAIAIAVT  161

Query  66   amvvklalWYVCAKI--ASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A+VVK+ L +  A I  ++ S + +A+ QD+ ND+ SN+ AVAA   A      WY+D  
Sbjct  162  AVVVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYVDPA  221

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I VYI V+W     EQ+ +LVG+ A +EFI++++ L   HHP M  DIVRAYHFG+
Sbjct  222  GAIIIFVYIMVAWGKMAWEQITQLVGVCASEEFIEEVKELCSRHHPSMELDIVRAYHFGS  281

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P +M VK AHDI+L +Q KVE L+ VERAFVHVDY  R+YDEH
Sbjct  282  KYLVELEVVVPGEMSVKLAHDIALQVQFKVENLEEVERAFVHVDYQARDYDEH  334

>SPRG_06805
Length=341

 Score = 188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 141/233 (61%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTmvvllva  66
            K+PAG  R EPI V++SAT+M + ++ VI +S   L  GF   +  + + +   + +   
Sbjct  68   KFPAGTSRFEPILVVLSATIMSVISVIVIYESSMRLHDGFASGEPDVAVMSTAAIAICSC  127

Query  67   mvvklalWYVCAKIA---SHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
             +       + A  A   + S S  A+ QD+ ND  SN  A+     A    SLWY+D  
Sbjct  128  AIAIKVGLVIYAGFALRLTQSSSVKAIQQDNINDTVSNAFAIVVYVIAASDPSLWYIDPA  187

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I + I V W+ T KEQV +LVG+ A  +FID ++ L + HH     DI+RAYHFGN
Sbjct  188  GAILIFLAILVIWVRTAKEQVLQLVGVSASPDFIDVVKELCENHHASFALDIIRAYHFGN  247

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV+ P  M VK AHDISL LQ K+E+L++VERAFVHVDY  R YDEH
Sbjct  248  KYLVELEVVAPATMTVKQAHDISLQLQFKIEQLEDVERAFVHVDYQTRAYDEH  300

>PHYRA_96593
Length=613

 Score = 193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 159/233 (68%), Gaps = 3/233 (1%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISNFTmvvllv  65
            KYPAG  R EP+A+I++A++M +A+I  IQ+S   LI GF +G      +S   +V++++
Sbjct  343  KYPAGTSRFEPVAIIVAASVMVLASIVFIQESARKLIDGFTSGEPEAPILSTAAIVIVVM  402

Query  66   amvvklalWYVCAKI--ASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A+VVK+ L    A I  ++ S + +A+ QD+ ND  SN+ AVAA   +   S  WY+D  
Sbjct  403  AVVVKIGLMLYSAWILKSTFSAAVEAIHQDNLNDTISNSFAVAAYIVSAVESEAWYVDPA  462

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I +YI VSW     EQV +LVG+ A ++F+ +++ L   HHP M  DIVRAYHFG+
Sbjct  463  GAILIFLYIMVSWGKMAWEQVTQLVGVCASEDFVQEVKELCSHHHPSMVLDIVRAYHFGS  522

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P +M VK AHDI+L LQ KVE L+ VERAFVHVDY  R+YDEH
Sbjct  523  KYLVELEVVVPAEMSVKAAHDIALQLQFKVENLEEVERAFVHVDYQSRDYDEH  575

>PYIR_21123
Length=388

 Score = 183 bits (465),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 148/218 (68%), Gaps = 7/218 (3%)

Query  24   ATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISN----FTmvvllvamvvklalWYVCA  78
            A +M + AI  IQ+ V  L+ GF +G+    ++S      +  ++++ + +    ++   
Sbjct  110  ANIMVLVAITFIQEGVTKLVDGFAHGNPEAPKLSTAAVVLSSSIVVIKIGLSAYSYWTIK  169

Query  79   KIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSVGAIVISVYIAVSWLA  138
            +  ++S +A A+  D+RNDVFSN+ A+AA   +  +  LWY+D+ GAIV+ ++I V+W  
Sbjct  170  R--TYSAAAHAIGDDNRNDVFSNSFAIAAYIISSANEDLWYVDACGAIVVFLFIMVAWAK  227

Query  139  TGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMC  198
             GK+QV +LVG+ A++EF+ +++ L   HHP M  DI+RAYHFG+ YLVE+EV++P DM 
Sbjct  228  MGKDQVAQLVGVSANEEFMTEVKELCSHHHPSMALDIIRAYHFGSKYLVELEVVVPADMT  287

Query  199  VKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
            VK AHDI+L LQ KVE L++VERAFVHVDY  R+YDEH
Sbjct  288  VKMAHDIALQLQFKVENLEDVERAFVHVDYKARDYDEH  325

>PITG_19056
Length=390

 Score = 177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 149/233 (64%), Gaps = 4/233 (2%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQR---VLEISNFTmvvl  63
            KYPAG    +  A+I++A++M +A+I  IQ++V  L+ GF+  +    VL  +   +   
Sbjct  99   KYPAGTSPCQR-AIIVAASVMVLASIVFIQEAVTKLVDGFSSDEPEAPVLSAAAIAIAAT  157

Query  64   lvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
             V + + L  +      ++ S + +A+ QD+ ND+ SN+ AVAA   A      WY+D  
Sbjct  158  AVIVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYVDPA  217

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN  183
            GAI+I VYI V+W     EQ+ +LVG+ A +EFI +++ L   HHP M  DIVRAYHFG+
Sbjct  218  GAIIIFVYIMVAWGKMAWEQITQLVGVCASEEFIKEVKELCSRHHPSMELDIVRAYHFGS  277

Query  184  NYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
             YLVE+EV++P +M VK AHDI+L +Q KVE L+ VERAFVHVDY  R+YDEH
Sbjct  278  KYLVELEVVVPGEMSVKLAHDIALQVQFKVENLEEVERAFVHVDYQARDYDEH  330

>PYAR_21139
Length=357

 Score = 167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 132/231 (57%), Gaps = 34/231 (15%)

Query  6    VKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTmvvllv  65
            V++PAG  RLEP+AV+++++ M + ++  IQ+  + L  GF                   
Sbjct  104  VRFPAGTSRLEPVAVVVASSTMMVLSVVFIQEGAKKLYDGF-------------------  144

Query  66   amvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSVGA  125
                      V         + +A+ QD        TV      + +   +LWY+D  GA
Sbjct  145  ----------VHGDPVKPHLTVEAIHQD-----LLGTVLPLDPQSPYISRNLWYVDPAGA  189

Query  126  IVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNY  185
            IVI + I V+W   GKEQV +LVG+ A+ EFIDQ++ L   H   +  DI+RAYHFG  Y
Sbjct  190  IVIFLLIMVAWGRMGKEQVMQLVGVAANDEFIDQVKQLCRGHDANLSLDILRAYHFGTKY  249

Query  186  LVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236
            LVE+EVI+P DM V+DAHDI+L LQ KVE+L++VERAFVHVDY  R YDEH
Sbjct  250  LVELEVIVPGDMAVQDAHDIALRLQFKVEKLEDVERAFVHVDYQAREYDEH  300

>PYAR_21138
Length=455

 Score = 161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 106/267 (40%), Positives = 154/267 (58%), Gaps = 37/267 (14%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF---NGHQRVLEISNFTmvvl  63
            K+PAG  R EP+AVI+++++M + +I  IQ+  + L  GF   N  +  L +    +  L
Sbjct  111  KFPAGTSRFEPVAVIVASSVMVVVSIVFIQEGSKKLYDGFAHGNPAKPDLTVEALIISGL  170

Query  64   lvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
             +   + L L+      +  S + +A+  D+RNDV SN+ A+ A   A  +  LWY+D  
Sbjct  171  SITTKIFLMLYSRWVLKSHSSVAVEAIQDDNRNDVLSNSFAIIAYIIASANEKLWYVDPA  230

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIR----------------------  161
            GAI + ++I V+W   GKEQV +LVG+ A  EFID+++                      
Sbjct  231  GAIAVFLFIMVAWARMGKEQVMQLVGVTASAEFIDEVKELCRSHNAKLSLDIEQVMQLVG  290

Query  162  ------LLGDV------HHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSL  209
                   +G+V      H+  +  DIVRAYHFG+ YLVE+EV++P DM V+DAHDI+L L
Sbjct  291  VTASEEFIGEVKQLCNSHNNKLSLDIVRAYHFGSKYLVEVEVVVPGDMTVQDAHDIALQL  350

Query  210  QDKVEELDNVERAFVHVDYLERNYDEH  236
            Q KVE+L++VERAFVHVDY  R YDEH
Sbjct  351  QFKVEQLEDVERAFVHVDYKAREYDEH  377

>PYIW_28078
Length=108

 Score = 109 bits (273),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)

Query  159  QIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDN  218
            +++ L   HHP M  DI RAYHFG+ YLVE+EV++P DM VK AHDI+L LQ KVE LD+
Sbjct  3    EVKELASGHHPSMSLDITRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLDD  62

Query  219  VERAFVHVDYLERNYDEH  236
            VERAFVHVDY  R+YDEH
Sbjct  63   VERAFVHVDYKARDYDEH  80

>PYIW_26705
Length=230

 Score = 99.0 bits (245),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 100/156 (64%), Gaps = 7/156 (4%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISN----FTmv  61
            KYPAG  R EP+A+I+++++M + AI  IQ+ V  L+ GF +G+    ++S      +  
Sbjct  76   KYPAGTSRFEPVAIIVASSVMVLVAITFIQEGVTKLVNGFAHGNPEAPKLSTAAVVLSSS  135

Query  62   vllvamvvklalWYVCAKIASHSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLD  121
            ++++ + +    ++   +  ++S +A A+  D+RNDVFSN+ A+AA   +  +  LWY+D
Sbjct  136  IVVIKIGLSAYSYWTIKR--TYSAAAHAIGDDNRNDVFSNSFAIAAYIISSANEDLWYVD  193

Query  122  SVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFI  157
            + GAI++ ++I  +W   GK+QV +LVG++A +EF+
Sbjct  194  ACGAILVFLFIMFAWAKMGKDQVAQLVGVRASEEFM  229

>PYIW_27182
Length=276

 Score = 89.0 bits (219),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 98/156 (63%), Gaps = 3/156 (2%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEISNFTmvvllv  65
            KYPAG  R EP+A+I++A++M + ++  IQ+ V  L+ G  +G     ++S   +V++++
Sbjct  121  KYPAGTSRFEPVAIIVAASIMVLVSVVFIQEGVTKLVDGLAHGQPEAPKLSAAAVVIVVL  180

Query  66   amvvklalWYVCAKIAS--HSPSADALAQDHRNDVFSNTvavaaafaaHWHSSLWYLDSV  123
            A++VK+ L +    + +  +S S +A+  D+RND  SN  A+ A   +  +  LWY+D  
Sbjct  181  AVLVKIGLIFYARWVLTFTYSASVEAIMDDNRNDTISNAFAIVAYIISSVNEDLWYVDPA  240

Query  124  GAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQ  159
            GAI+I ++I  +W   GKEQV +LVG+ A +EF+ +
Sbjct  241  GAILIFLFIMFAWGKMGKEQVAQLVGVCASEEFMTE  276

>PYAP_18437
Length=451

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 57/99 (58%), Gaps = 3/99 (3%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGF-NGHQRVLEIS-NFTmvvll  64
            K+PAG  R EP+AVI+++++M + ++  IQ+ ++ L+ G  +G     E+S    ++  L
Sbjct  338  KFPAGTSRFEPVAVIVASSIMVLVSVFFIQEGIKKLVDGLVHGEPEKPELSVAAVVITSL  397

Query  65   vamvvklalWYVCAKIASHSPSA-DALAQDHRNDVFSNT  102
                    + Y    + +H+ +A +A+  D+RNDV SN+
Sbjct  398  AISTKVFLMMYASRVLKTHTSAAVEAIQDDNRNDVVSNS  436

 Score = 39.7 bits (91),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 59/101 (58%), Gaps = 7/101 (7%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTmvvllva  66
            K+PAG  R EP+AVI+++++M + ++  IQ+  + L+ GF  H    E  N T+  L++A
Sbjct  112  KFPAGTSRFEPVAVIVASSVMVLVSVVFIQEGAKKLVDGF-AHDNP-EKPNLTIEALVIA  169

Query  67   mvvklalWYVCA----KIASHSPSA-DALAQDHRNDVFSNT  102
             +      ++       + +H+ +A +A+  D+RNDV SN+
Sbjct  170  GMAISTKVFLILYSRWVLKTHTSAAVEAIQDDNRNDVVSNS  210

>PYAR_21141
Length=139

 Score = 40.0 bits (92),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 28/39 (72%), Gaps = 0/39 (0%)

Query  7    KYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKG  45
            K+PAG  R EP+AVI+++++M + ++  IQ+ V  ++ G
Sbjct  75   KFPAGTSRFEPVAVIVASSIMVLVSLFFIQEGVTKIVDG  113

>PYU1_G001828
Length=318

 Score = 34.3 bits (77),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (58%), Gaps = 0/57 (0%)

Query  179  YHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDE  235
            Y  G   +V++ +++  D+ V DAH ++   +  +EE+  +  A +H++ L+ + DE
Sbjct  259  YINGCGTVVDVAIVVHPDLKVGDAHSVAKRARKAIEEISYISEADIHLELLDNDNDE  315

>CCA19358
Length=682

 Score = 33.5 bits (75),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query  131  YIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAY  179
            YIAV  L   K        LQ  QEFI +I+L   +HHP + T I  AY
Sbjct  446  YIAVKRLLQNKTHT-----LQEAQEFIAEIQLTASLHHPNIVTFIGVAY  489

>SDRG_04232
Length=494

 Score = 32.0 bits (71),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 35/68 (51%), Gaps = 2/68 (3%)

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDY--LERNYDEHKD  238
             G    +++ +++  D+ V+D H I+   + ++E +  V  A +H++    E   D+ KD
Sbjct  416  LGYGTFLDVAIVVSPDLSVRDVHKIAARARKEIESITYVVEADIHLELYDAETTIDDGKD  475

Query  239  PTIRRDSP  246
              +  ++P
Sbjct  476  SRLLAEAP  483

>PPTG_01766
Length=699

 Score = 32.0 bits (71),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 21/78 (27%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query  126  IVISVYIAVSWLATGKEQV----ERLV-GLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180
            ++ S  +AV WL   +  V    +RL    +  Q+F+D+I+L+  + HP +   I  A+ 
Sbjct  451  VIGSGSVAVVWLVRYRSSVLLASKRLREDTECTQDFVDEIKLVSKLDHPNIVAFIGTAWT  510

Query  181  FGNNYLVEMEVILPEDMC  198
             G +     E++   D+C
Sbjct  511  TGPDLQALFELVENGDLC  528

>SPRG_07437
Length=494

 Score = 31.6 bits (70),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 35/68 (51%), Gaps = 2/68 (3%)

Query  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDY--LERNYDEHKD  238
             G    +++ +++  D+ V+D H I+   + ++E +  V  A +H++    E   D+ KD
Sbjct  416  LGYGTFLDVAIVVNPDLSVRDVHKIAARARKEIESITYVVEADIHLELYDAETTIDDGKD  475

Query  239  PTIRRDSP  246
              +  ++P
Sbjct  476  SRLLAEAP  483

>PYIR_23329
Length=432

 Score = 31.6 bits (70),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 32/56 (57%), Gaps = 0/56 (0%)

Query  179  YHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYD  234
            Y  G+  +V++ +++  D+ V DAH ++   +  +E +  V  A +H++ L+ + D
Sbjct  372  YINGSGTVVDVAIVVHPDLKVGDAHSVAKRARKAIEAVPYVSEADIHLELLDEDMD  427

>PHYKE_6883
Length=875

 Score = 31.2 bits (69),  Expect = 6.2, Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 46/113 (41%), Gaps = 18/113 (16%)

Query  138  ATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVR-----AYHFGNNYLVEMEVI  192
            A    +VE L G +A  E   +   +GD      R D+       A      Y++EM  I
Sbjct  417  AVDTSEVEELFG-KAVNEVTQKSGGMGDFSALDFRADLEHHKGQLADEMSRRYMIEMRQI  475

Query  193  LPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDS  245
            L E           + L+ K  EL+ +   F   DYL RN    KD  +R++S
Sbjct  476  LNE-----------VDLEVKSMELEKLGDVFTD-DYLHRNQQLEKDAGVRKES  516

>PPTG_07547
Length=108

 Score = 29.3 bits (64),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 1/55 (2%)

Query  154  QEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLS  208
            Q+F + +R L ++      T +     F  N++  M  + PE MCV   H  S++
Sbjct  54   QDFSESLRNLANIFRDA-DTKLTSCITFQTNHMRPMTRLFPEVMCVDATHGTSIN  107

>PYIW_21326
Length=517

 Score = 30.8 bits (68),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 34/60 (57%), Gaps = 4/60 (7%)

Query  179  YHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKD  238
            Y  G+  +V++ +++  D+ V DAH ++   +  +E +  V  A +H++ L    DE+++
Sbjct  458  YLNGSGTVVDVAIVVHPDLKVGDAHSVAKRARKAIEAISYVSEADIHLELL----DEYRE  513

Lambda      K        H        a         alpha
   0.324    0.137    0.414    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13328059152

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40