Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_300767111481661668864e-123
PHYSO_300766485331661668864e-123
PPTG_09253111481661667859e-108
PITG_13740111481661667841e-107
PHYCA_118037111481651647754e-106
PHALS_11565111481621576096e-81
PYIW_14755111481691606098e-81
PYU1_G005964111481761755785e-76
PYIR_15183111481871845501e-71
PYAP_22844111481781795371e-69
PHYRA_96081111481561075062e-65
SDRG_04481111481861624599e-58
SPRG_13308111481871604441e-55
H310_10665111481651614248e-53
PYAR_26061111481141114208e-53
H257_07013111481661623856e-47
SPRG_11879128323125953029e-35
PYVX_2085911148225892655e-28
H310_0994612444379173740.70
CCI39712159758199117701.6
PYAR_2450110578223977674.5
PYIW_19423795350384675.3
H310_1480113236063843668.8
PYAR_2161310441363665659.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_300767

Length=167
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYSO_300767                                                          345     4e-123
PHYSO_300766                                                          345     4e-123
PPTG_09253                                                            306     9e-108
PITG_13740                                                            306     1e-107
PHYCA_118037                                                          303     4e-106
PHALS_11565                                                           239     6e-81 
PYIW_14755                                                            239     8e-81 
PYU1_G005964                                                          227     5e-76 
PYIR_15183                                                            216     1e-71 
PYAP_22844                                                            211     1e-69 
PHYRA_96081                                                           199     2e-65 
SDRG_04481                                                            181     9e-58 
SPRG_13308                                                            175     1e-55 
H310_10665                                                            167     8e-53 
PYAR_26061                                                            166     8e-53 
H257_07013                                                            152     6e-47 
SPRG_11879                                                            120     9e-35 
PYVX_20859                                                            106     5e-28 
H310_09946                                                            33.1    0.70  
CCI39712                                                              31.6    1.6   
PYAR_24501                                                            30.4    4.5   
PYIW_19423                                                            30.4    5.3   
H310_14801                                                            30.0    8.8   
PYAR_21613                                                            29.6    9.6   

>PHYSO_300767
Length=166

 Score = 345 bits (886),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
            TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI
Sbjct  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ  166
            SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ
Sbjct  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ  166

>PHYSO_300766
Length=166

 Score = 345 bits (886),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
            TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI
Sbjct  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ  166
            SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ
Sbjct  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ  166

>PPTG_09253
Length=166

 Score = 306 bits (785),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MVRVKVRVFTFP DPRKQNSYVVGTIEGGLLPVVGTLNLDDKEV+TVTF QLR RIELLQ
Sbjct  1    MVRVKVRVFTFPPDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVSTVTFTQLRVRIELLQ  60

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
             KDVIRRSVMFQEVLALIATS NPH WPPNAMQTY FGHF DE+E +PHVIAA+DEDCPI
Sbjct  61   VKDVIRRSVMFQEVLALIATSPNPHNWPPNAMQTYWFGHFIDESETIPHVIAASDEDCPI  120

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ  166
            +QFLNM TSKQTGDL+L+PQTQLGPVCE+CCEGC LCPPI+SS+NQ
Sbjct  121  NQFLNMITSKQTGDLILVPQTQLGPVCEQCCEGCTLCPPIQSSNNQ  166

>PITG_13740
Length=166

 Score = 306 bits (784),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKE ATVTF QLR RIEL+Q
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
              DVIRRS+MFQEVLAL+ATS+NPH WPPNAMQTY FGHF DE+E VPHVIAAADEDCPI
Sbjct  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCPI  120

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ  166
            SQ+LNMTTSK  GDL+LIPQTQLGPVCE+CCEGC LCPPI+SSS Q
Sbjct  121  SQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQSSSKQ  166

>PHYCA_118037
Length=165

 Score = 303 bits (775),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MVRVKVRVFTFPSDPRKQNSYVVGT+EGGLLPVVGTLNLD+KE  TVTFAQLRPRIELLQ
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTVEGGLLPVVGTLNLDEKETDTVTFAQLRPRIELLQ  60

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
            +KDVIRRSVMFQEVLALIA S NPHGWPPNAMQTY FGHF DENE  PHVI AADE+ PI
Sbjct  61   SKDVIRRSVMFQEVLALIAASPNPHGWPPNAMQTYWFGHFTDENESAPHVITAADENTPI  120

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSS  164
            SQFLNMTTSKQTGDL+L+PQTQLGPVCE+CCEGC LCP I S++
Sbjct  121  SQFLNMTTSKQTGDLILVPQTQLGPVCEQCCEGCSLCPSINSNN  164

>PHALS_11565
Length=162

 Score = 239 bits (609),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 127/157 (81%), Gaps = 0/157 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            M+ VKVRVFTFPSDP+KQNSYVVG+IEGG LPVVGT+ +DDKE  T+TF QLR RIELLQ
Sbjct  1    MIHVKVRVFTFPSDPQKQNSYVVGSIEGGHLPVVGTILIDDKEATTITFTQLRQRIELLQ  60

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
             KD IRRS MFQEVLA IATS N H WP   MQTY FG+FADE   VPH+I AADE  P+
Sbjct  61   VKDEIRRSAMFQEVLAFIATSPNSHSWPQKFMQTYWFGYFADEGACVPHIITAADEIRPV  120

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELC  157
            SQF NM TSKQ  DL+L+PQTQ+GPVC +CC+ C++C
Sbjct  121  SQFTNMATSKQICDLILVPQTQIGPVCHQCCQSCKVC  157

>PYIW_14755
Length=169

 Score = 239 bits (609),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 130/160 (81%), Gaps = 2/160 (1%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MV VKVRVFTFPS PRKQNSYVVGT EGGLLP VGTL LDD E  +VTFAQLRPRIEL  
Sbjct  1    MVHVKVRVFTFPSSPRKQNSYVVGTWEGGLLPTVGTLKLDDSE--SVTFAQLRPRIELQN  58

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
               +IRR++MFQEVLA+IATS NPH WP +A+QTY FG + D  + VP V+  A ED P+
Sbjct  59   DNFMIRRALMFQEVLAIIATSPNPHRWPHSALQTYWFGFYEDLEQRVPTVLPVAVEDSPV  118

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPI  160
            S FLNM TSKQTGDL+LIPQTQ+GPVCE+CCEGC LCPPI
Sbjct  119  SAFLNMMTSKQTGDLILIPQTQVGPVCEKCCEGCALCPPI  158

>PYU1_G005964
Length=176

 Score = 227 bits (578),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 132/175 (75%), Gaps = 13/175 (7%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MV VK+RVFTFPS+PR+QNSYVVGT EGGLLP VGTL L++ E   +TFAQLRPRIEL  
Sbjct  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60

Query  61   TKDVIR--------RSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIA  112
               +IR        RS+MFQEVL +I+TS NPH WP +A+QTY FG+F D  + VP ++ 
Sbjct  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120

Query  113  A-----ADEDCPISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIES  162
            A     ADED PIS FLNMTTSKQTGDL+LIPQTQ+GP+CE+CC+GC  CPP+  
Sbjct  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRK  175

>PYIR_15183
Length=187

 Score = 216 bits (550),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 130/184 (71%), Gaps = 25/184 (14%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            M  +KVRVFTFPS PR+QNSYVVGT EGGLLP VGTL LD+ E   VTFAQLRPRIEL  
Sbjct  4    MAYLKVRVFTFPSSPREQNSYVVGTWEGGLLPTVGTLKLDNSEC--VTFAQLRPRIELQN  61

Query  61   TKDVIRR-SVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAA------  113
               +IR+  +MFQEVLA+IATS NPH WP +A+QTY FG F D  + VP +I+       
Sbjct  62   DNFMIRQVPLMFQEVLAIIATSPNPHQWPHSALQTYWFGFFEDLEQSVPTMISVRPSCGC  121

Query  114  ----------------ADEDCPISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELC  157
                            +DED P+S FLNMTTSKQTGDL+LIPQTQ+GPVCE+CC+GC LC
Sbjct  122  DCTNPSTIDIAQWLQVSDEDSPVSTFLNMTTSKQTGDLILIPQTQVGPVCEKCCKGCALC  181

Query  158  PPIE  161
            PPI 
Sbjct  182  PPIR  185

>PYAP_22844
Length=178

 Score = 211 bits (537),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 127/179 (71%), Gaps = 24/179 (13%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MVRVKVRVFTFPS+PR+QNSY+     GGLLP VG L L++ E+ ++TF+QLRPRIEL  
Sbjct  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAA------  114
               +IRRS MFQEVL++I+ S NPH WP +A+QTY FG+F D ++ VPH I         
Sbjct  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115

Query  115  -------------DEDCPISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPI  160
                         +ED PIS++L+MTTSK TGDL+LIPQTQ GPVCE CC+GCE CPP+
Sbjct  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174

>PHYRA_96081
Length=156

 Score = 199 bits (506),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 98/107 (92%), Gaps = 0/107 (0%)

Query  6    VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQTKDVI  65
            VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNL DKEVATVTF QLR RIELLQ KDVI
Sbjct  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106

Query  66   RRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIA  112
            RRSVMFQEVLALIA S+NPHGWPPNAMQTY FGH+ DEN+ +P VIA
Sbjct  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIA  153

>SDRG_04481
Length=186

 Score = 181 bits (459),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 114/162 (70%), Gaps = 2/162 (1%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            +VR+KVRVF FP DP  ++SYVVG+  GGL  V+G + ++D E   +TF  +RPRIEL Q
Sbjct  2    VVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVVEDDE--DLTFQSVRPRIELQQ  59

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
               V+RR +M+QE L L+ + ANPH WP  A+QTY  G++A E++ VP +I  ADE    
Sbjct  60   DGSVLRRHIMYQEALFLMTSGANPHQWPVKALQTYWLGYYAHEDDLVPTIIPTADEHQSF  119

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIES  162
             +FL+M T+K T DL+LIPQ+Q+GPVC  CC+GC  CPPI +
Sbjct  120  REFLDMKTTKLTADLILIPQSQIGPVCNACCQGCAACPPIAA  161

>SPRG_13308
Length=187

 Score = 175 bits (444),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 112/160 (70%), Gaps = 2/160 (1%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            +VR+KVRVF FP DP  ++SYVVG+  GGL  V+G + +   +   +TF  +RPRIEL Q
Sbjct  2    VVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVM--DDDDDLTFESVRPRIELQQ  59

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
               V RR +M+QE L L+ +SANPH WP  A+QTY  G++A E++ VP VI  ADE  P+
Sbjct  60   DGSVQRRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIPTADEQKPL  119

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPI  160
               L+M T+K T DL+LIPQ+Q+GPVC  CC+GC +CPPI
Sbjct  120  RAVLDMKTTKLTADLILIPQSQIGPVCTACCQGCAVCPPI  159

>H310_10665
Length=165

 Score = 167 bits (424),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 110/161 (68%), Gaps = 2/161 (1%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            MVR+KVRVFTF  DP  ++SY+VG+  GGL   +G + LDD +   +TFA +RPRIEL +
Sbjct  1    MVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLDDDD--DLTFASVRPRIELKE  58

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI  120
               +IRR++MFQE L  +  + NPH WP + +QTY  G++ +E++  P +I   DE   +
Sbjct  59   ENGLIRRNLMFQEALFQMTEARNPHQWPTHTLQTYWLGYYKNEDDMTPTIIPTEDEARSL  118

Query  121  SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIE  161
               L+M ++K T DL+++PQ+Q+GPVC  CC+GC LCP I+
Sbjct  119  RDVLDMKSTKVTADLIIVPQSQIGPVCAMCCQGCALCPAIQ  159

>PYAR_26061
Length=114

 Score = 166 bits (420),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 90/111 (81%), Gaps = 0/111 (0%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            ++RVKVRVFTFPSDPR QNSYVVGT+EGGLLP VGTL+LDD E  TVTFAQLRPR+EL  
Sbjct  2    VLRVKVRVFTFPSDPRLQNSYVVGTMEGGLLPTVGTLSLDDSEKDTVTFAQLRPRLELRD  61

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVI  111
               +IRRS +FQEVLA+ + S NPHGWP +A+QTY FG F D +E VPH I
Sbjct  62   DDGMIRRSALFQEVLAIASASRNPHGWPVSALQTYWFGFFQDPSETVPHAI  112

>H257_07013
Length=166

 Score = 152 bits (385),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 3/162 (2%)

Query  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
            +VR+KVRVFTF  DP  ++SY+VG+  GGL   +G + L+D E   +TF  +RPRIEL +
Sbjct  2    VVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLEDDE--DLTFESVRPRIELKE  59

Query  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCP-  119
               +IRR+ MFQE L  +  + NPH WP + +QTY  G++  E++  P +I   D     
Sbjct  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKC  119

Query  120  ISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIE  161
            +   L+M ++K T DL++IPQ+Q+GPVC +CC+ C LCP I+
Sbjct  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161

>SPRG_11879
Length=125

 Score = 120 bits (302),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 69/95 (73%), Gaps = 0/95 (0%)

Query  66   RRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPISQFLN  125
            RR +M+QE L L+ +SANPH WP  A+QTY  G++A E++ VP VI  ADE  P+   L+
Sbjct  3    RRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIPTADEQKPLRAVLD  62

Query  126  MTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPI  160
            M ++K T DL+LIPQ+Q+GPVC  CC+GC  CPPI
Sbjct  63   MKSTKLTADLILIPQSQIGPVCNACCQGCAECPPI  97

>PYVX_20859
Length=225

 Score = 106 bits (265),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 4/89 (4%)

Query  1   MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60
           MVRVKVRVFTFPSDPR+QNSY+VGT EGGLLPVVGTLN++D E  T++F+QLRPRIEL  
Sbjct  1   MVRVKVRVFTFPSDPREQNSYLVGTSEGGLLPVVGTLNVEDAEQDTISFSQLRPRIELKN  60

Query  61  TKDVIR--RSVMFQEVLALIA--TSANPH  85
             +++R  RS      L ++A  T+  PH
Sbjct  61  DNNMVRCVRSAALPVSLIMMAILTAPQPH  89

>H310_09946
Length=791

 Score = 33.1 bits (74),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 37/73 (51%), Gaps = 11/73 (15%)

Query  85   HGWPPNAM-----QTYCFGHFADENEDVPHVIAA-----ADEDCPISQFLNMTTSKQTG-  133
            H   P+A+     +TYC+  FA  +      ++A      D+ CP++  LN++T   T  
Sbjct  364  HAKAPDAVAQVVNKTYCWKVFAPASARNVSTLSALGGYSVDDSCPMALKLNLSTQTTTNT  423

Query  134  DLVLIPQTQLGPV  146
             LV++PQ  L PV
Sbjct  424  SLVVLPQVTLSPV  436

>CCI39712
Length=199

 Score = 31.6 bits (70),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 28/117 (24%), Positives = 52/117 (44%), Gaps = 21/117 (18%)

Query  35   GTLNLDDKEVATVTFAQLRPRIELLQTKDVIRRSVMFQEVLALIATSANPHG-WPPNAMQ  93
            G +  +DK ++   FA L+P + L Q   +    V++ + +A++  ++   G +P +A+Q
Sbjct  26   GKVPFEDKRISKEEFAALKPTLPLGQVPVLKVDGVIYSQTMAMVRYASILSGIYPTDALQ  85

Query  94   TY-------CFGHFADENEDVPHVI------AAADED-----CP--ISQFLNMTTSK  130
                     C+   A    ++ H+I      AA  +D     CP  I    NM + K
Sbjct  86   VLKAESVIGCYDELAGPIVEIMHLIKDEGIKAAKTKDLVEKQCPKIIGYIQNMVSGK  142

>PYAR_24501
Length=239

 Score = 30.4 bits (67),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 11/77 (14%)

Query  38   NLDDKEVATVTFAQLRPRIELLQTK--DVIRRSVMFQEVLALIATSANPHGWPP----NA  91
             L+D  V  +T  QLR R+ L Q K  DV++R+ + Q V+         H WP       
Sbjct  84   KLNDDLVWDLTITQLRTRLLLAQVKTTDVLQRAQVAQAVILPKLLYIGRHVWPSATRLRT  143

Query  92   MQTY-----CFGHFADE  103
            +Q Y      FG F + 
Sbjct  144  LQRYTHNYVWFGRFEER  160

>PYIW_19423
Length=503

 Score = 30.4 bits (67),  Expect = 5.3, Method: Composition-based stats.
 Identities = 26/84 (31%), Positives = 38/84 (45%), Gaps = 9/84 (11%)

Query  41   DKEVATVTFAQLRPRIELLQTKDVIRRSVMFQEV-----LALIATSANPHGWPPNAMQTY  95
            DK+  + + A L    E L  K  + R V F  V      +++A+S     + P  M  Y
Sbjct  179  DKDTLSSSAAGLS---EKLTFKSRMGRLVYFHAVQSSTVASMLASSRASEHFLPGRMY-Y  234

Query  96   CFGHFADENEDVPHVIAAADEDCP  119
             F   A E E VP ++  + EDCP
Sbjct  235  TFSLNAKEIESVPVIVQRSKEDCP  258

>H310_14801
Length=638

 Score = 30.0 bits (66),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 0/43 (0%)

Query  58   LLQTKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHF  100
            L +T DVIR   +  E+LAL   + +PH  PP+  Q     H 
Sbjct  251  LFRTGDVIRARPLADELLALSQVTTHPHLMPPSWRQLPALLHL  293

>PYAR_21613
Length=636

 Score = 29.6 bits (65),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 27/65 (42%), Gaps = 10/65 (15%)

Query  98   GHFADENEDVPHVIAAADEDC----PISQFLNMTTSKQTGDLVLI------PQTQLGPVC  147
            G   D  E  P  +A+ D  C     +S  L+ T +  TGD V +        T    VC
Sbjct  351  GFVTDFFESSPRPLASLDTKCFPGTYLSDLLSNTKTTTTGDPVWVSSLDSDASTTSALVC  410

Query  148  ERCCE  152
            ERCC 
Sbjct  411  ERCCS  415

Lambda      K        H        a         alpha
   0.324    0.138    0.428    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6082944840

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40