Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_96081111481561568351e-115
PHYSO_300767111481661075062e-65
PHYSO_300766485331661075062e-65
PHYCA_118037111481651075021e-64
PITG_13740111481661074975e-64
PPTG_09253111481661074967e-64
PHALS_11565111481621074046e-50
PYAR_26061111481141083876e-48
PYIW_14755111481691083701e-44
PYIR_15183111481871103537e-42
PYU1_G005964111481761173501e-41
PYAP_22844111481781083474e-41
SDRG_04481111481861062842e-31
SPRG_13308111481871062746e-30
H257_07013111481661062595e-28
H310_10665111481651062588e-28
PYVX_2085911148225822332e-23
PPTG_224872709348491959e-20
SPRG_11879128323125461566e-13
PHYKE_58401114837491062e-06
CCI40332152161160066721.1
PYAR_2450110578223976674.5
H310_0213412291226450664.8
H257_135891373452366667.1
PYIR_17280721058335658.1
H310_1480113236063836659.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_96081

Length=157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYRA_96081                                                           326     1e-115
PHYSO_300767                                                          199     2e-65 
PHYSO_300766                                                          199     2e-65 
PHYCA_118037                                                          197     1e-64 
PITG_13740                                                            196     5e-64 
PPTG_09253                                                            195     7e-64 
PHALS_11565                                                           160     6e-50 
PYAR_26061                                                            153     6e-48 
PYIW_14755                                                            147     1e-44 
PYIR_15183                                                            140     7e-42 
PYU1_G005964                                                          139     1e-41 
PYAP_22844                                                            138     4e-41 
SDRG_04481                                                            114     2e-31 
SPRG_13308                                                            110     6e-30 
H257_07013                                                            104     5e-28 
H310_10665                                                            103     8e-28 
PYVX_20859                                                            94.4    2e-23 
PPTG_22487                                                            79.7    9e-20 
SPRG_11879                                                            64.7    6e-13 
PHYKE_5840                                                            45.4    2e-06 
CCI40332                                                              32.3    1.1   
PYAR_24501                                                            30.4    4.5   
H310_02134                                                            30.0    4.8   
H257_13589                                                            30.0    7.1   
PYIR_17280                                                            29.6    8.1   
H310_14801                                                            29.6    9.5   

>PHYRA_96081
Length=156

 Score = 326 bits (835),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%), Gaps = 0/156 (0%)

Query  1    MFDQLKHVMSHPMNGKAPAEKHFGGLSPQSKLEKEDPSTAFERSGWVRVFTFPSDPRKQN  60
            MFDQLKHVMSHPMNGKAPAEKHFGGLSPQSKLEKEDPSTAFERSGWVRVFTFPSDPRKQN
Sbjct  1    MFDQLKHVMSHPMNGKAPAEKHFGGLSPQSKLEKEDPSTAFERSGWVRVFTFPSDPRKQN  60

Query  61   SYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVIRRSVMFQEVLALIA  120
            SYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVIRRSVMFQEVLALIA
Sbjct  61   SYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVIRRSVMFQEVLALIA  120

Query  121  ASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAVRR  156
            ASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAVRR
Sbjct  121  ASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAVRR  156

>PHYSO_300767
Length=166

 Score = 199 bits (506),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 98/107 (92%), Gaps = 0/107 (0%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNL DKEVATVTF QLR RIELLQ KDVI
Sbjct  6    VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQTKDVI  65

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIA  153
            RRSVMFQEVLALIA S+NPHGWPPNAMQTY FGH+ DEN+ +P VIA
Sbjct  66   RRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIA  112

>PHYSO_300766
Length=166

 Score = 199 bits (506),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 98/107 (92%), Gaps = 0/107 (0%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNL DKEVATVTF QLR RIELLQ KDVI
Sbjct  6    VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQTKDVI  65

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIA  153
            RRSVMFQEVLALIA S+NPHGWPPNAMQTY FGH+ DEN+ +P VIA
Sbjct  66   RRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIA  112

>PHYCA_118037
Length=165

 Score = 197 bits (502),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 97/107 (91%), Gaps = 0/107 (0%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPSDPRKQNSYVVGT+EGGLLPVVGTLNL +KE  TVTF QLR RIELLQ KDVI
Sbjct  6    VRVFTFPSDPRKQNSYVVGTVEGGLLPVVGTLNLDEKETDTVTFAQLRPRIELLQSKDVI  65

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIA  153
            RRSVMFQEVLALIAAS NPHGWPPNAMQTYWFGH+TDEN+S P VI 
Sbjct  66   RRSVMFQEVLALIAASPNPHGWPPNAMQTYWFGHFTDENESAPHVIT  112

>PITG_13740
Length=166

 Score = 196 bits (497),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNL DKE ATVTF QLR+RIEL+Q  DVI
Sbjct  6    VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQINDVI  65

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIA  153
            RRS+MFQEVLAL+A SSNPH WPPNAMQTYWFGH+ DE++S+P VIA
Sbjct  66   RRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIA  112

>PPTG_09253
Length=166

 Score = 195 bits (496),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 0/107 (0%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFP DPRKQNSYVVGTIEGGLLPVVGTLNL DKEV+TVTF QLR+RIELLQ KDVI
Sbjct  6    VRVFTFPPDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVSTVTFTQLRVRIELLQVKDVI  65

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIA  153
            RRSVMFQEVLALIA S NPH WPPNAMQTYWFGH+ DE+++IP VIA
Sbjct  66   RRSVMFQEVLALIATSPNPHNWPPNAMQTYWFGHFIDESETIPHVIA  112

>PHALS_11565
Length=162

 Score = 160 bits (404),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 83/107 (78%), Gaps = 0/107 (0%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPSDP+KQNSYVVG+IEGG LPVVGT+ + DKE  T+TF QLR RIELLQ KD I
Sbjct  6    VRVFTFPSDPQKQNSYVVGSIEGGHLPVVGTILIDDKEATTITFTQLRQRIELLQVKDEI  65

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIA  153
            RRS MFQEVLA IA S N H WP   MQTYWFG++ DE   +P +I 
Sbjct  66   RRSAMFQEVLAFIATSPNSHSWPQKFMQTYWFGYFADEGACVPHIIT  112

>PYAR_26061
Length=114

 Score = 153 bits (387),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 0/108 (0%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPSDPR QNSYVVGT+EGGLLP VGTL+L D E  TVTF QLR R+EL  D  +I
Sbjct  7    VRVFTFPSDPRLQNSYVVGTMEGGLLPTVGTLSLDDSEKDTVTFAQLRPRLELRDDDGMI  66

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAV  154
            RRS +FQEVLA+ +AS NPHGWP +A+QTYWFG + D ++++P  I V
Sbjct  67   RRSALFQEVLAIASASRNPHGWPVSALQTYWFGFFQDPSETVPHAIPV  114

>PYIW_14755
Length=169

 Score = 147 bits (370),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 82/108 (76%), Gaps = 2/108 (2%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPS PRKQNSYVVGT EGGLLP VGTL L D E  +VTF QLR RIEL  D  +I
Sbjct  6    VRVFTFPSSPRKQNSYVVGTWEGGLLPTVGTLKLDDSE--SVTFAQLRPRIELQNDNFMI  63

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAV  154
            RR++MFQEVLA+IA S NPH WP +A+QTYWFG Y D    +P V+ V
Sbjct  64   RRALMFQEVLAIIATSPNPHRWPHSALQTYWFGFYEDLEQRVPTVLPV  111

>PYIR_15183
Length=187

 Score = 140 bits (353),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 83/110 (75%), Gaps = 3/110 (3%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPS PR+QNSYVVGT EGGLLP VGTL L + E   VTF QLR RIEL  D  +I
Sbjct  9    VRVFTFPSSPREQNSYVVGTWEGGLLPTVGTLKLDNSEC--VTFAQLRPRIELQNDNFMI  66

Query  107  RR-SVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAVR  155
            R+  +MFQEVLA+IA S NPH WP +A+QTYWFG + D   S+P +I+VR
Sbjct  67   RQVPLMFQEVLAIIATSPNPHQWPHSALQTYWFGFFEDLEQSVPTMISVR  116

>PYU1_G005964
Length=176

 Score = 139 bits (350),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 8/117 (7%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            +RVFTFPS+PR+QNSYVVGT EGGLLP VGTL L + E   +TF QLR RIEL  D  +I
Sbjct  6    IRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQNDNFMI  65

Query  107  R--------RSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAVR  155
            R        RS+MFQEVL +I+ S NPH WP +A+QTYWFG++ D    +P ++  R
Sbjct  66   RSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLPAR  122

>PYAP_22844
Length=178

 Score = 138 bits (347),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 5/108 (5%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPS+PR+QNSY+     GGLLP VG L L + E+ ++TF QLR RIEL  D  +I
Sbjct  6    VRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRDDDGMI  60

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAV  154
            RRS MFQEVL++I+AS NPH WP +A+QTYWFG++TD + ++P  I V
Sbjct  61   RRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEV  108

>SDRG_04481
Length=186

 Score = 114 bits (284),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 73/106 (69%), Gaps = 2/106 (2%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVF FP DP  ++SYVVG+  GGL  V+G + + D E   +TF+ +R RIEL QD  V+
Sbjct  7    VRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVVEDDE--DLTFQSVRPRIELQQDGSVL  64

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVI  152
            RR +M+QE L L+ + +NPH WP  A+QTYW G+Y  E+D +P +I
Sbjct  65   RRHIMYQEALFLMTSGANPHQWPVKALQTYWLGYYAHEDDLVPTII  110

>SPRG_13308
Length=187

 Score = 110 bits (274),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 2/106 (2%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVF FP DP  ++SYVVG+  GGL  V+G +     +   +TFE +R RIEL QD  V 
Sbjct  7    VRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVV--MDDDDDLTFESVRPRIELQQDGSVQ  64

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVI  152
            RR +M+QE L L+ +S+NPH WP  A+QTYW G+Y  E+D +P VI
Sbjct  65   RRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVI  110

>H257_07013
Length=166

 Score = 104 bits (259),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 2/106 (2%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTF  DP  ++SY+VG+  GGL   +G + L D E   +TFE +R RIEL ++  +I
Sbjct  7    VRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLEDDE--DLTFESVRPRIELKEENGLI  64

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVI  152
            RR+ MFQE L  +  + NPH WP + +QTYW G+Y  E+D  P +I
Sbjct  65   RRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTII  110

>H310_10665
Length=165

 Score = 103 bits (258),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 70/106 (66%), Gaps = 2/106 (2%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTF  DP  ++SY+VG+  GGL   +G + L D +   +TF  +R RIEL ++  +I
Sbjct  6    VRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLDDDD--DLTFASVRPRIELKEENGLI  63

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVI  152
            RR++MFQE L  +  + NPH WP + +QTYW G+Y +E+D  P +I
Sbjct  64   RRNLMFQEALFQMTEARNPHQWPTHTLQTYWLGYYKNEDDMTPTII  109

>PYVX_20859
Length=225

 Score = 94.4 bits (233),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 2/82 (2%)

Query  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106
            VRVFTFPSDPR+QNSY+VGT EGGLLPVVGTLN+ D E  T++F QLR RIEL  D +++
Sbjct  6    VRVFTFPSDPREQNSYLVGTSEGGLLPVVGTLNVEDAEQDTISFSQLRPRIELKNDNNMV  65

Query  107  R--RSVMFQEVLALIAASSNPH  126
            R  RS      L ++A  + P 
Sbjct  66   RCVRSAALPVSLIMMAILTAPQ  87

>PPTG_22487
Length=48

 Score = 79.7 bits (195),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 1/49 (2%)

Query  1   MFDQLKHVMSHPMNGKAPAEKHFGGLSPQSKLEKEDPSTAFERSGWVRV  49
           M DQLKHVMS P+NG AP EKH G +SPQSKLEK DPSTAFERSGW  +
Sbjct  1   MLDQLKHVMSRPINGNAPTEKHMG-MSPQSKLEKADPSTAFERSGWCYI  48

>SPRG_11879
Length=125

 Score = 64.7 bits (156),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)

Query  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVI  152
            RR +M+QE L L+ +S+NPH WP  A+QTYW G+Y  E+D +P VI
Sbjct  3    RRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVI  48

>PHYKE_5840
Length=37

 Score = 45.4 bits (106),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 12/49 (24%)

Query  1   MFDQLKHVMSHPMNGKAPAEKHFGGLSPQSKLEKEDPSTAFERSGWVRV  49
           MFDQLKHV++ PM+    AEK      P+   +++DPSTAFERSGWV +
Sbjct  1   MFDQLKHVVARPMS----AEKQ-----PK---DQKDPSTAFERSGWVFI  37

>CCI40332
Length=1600

 Score = 32.3 bits (72),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query  16   KAPAEKHFGGLSPQSKLEKEDPSTAFERSGWVRVFTFPSDPRKQNSYVVGTIEGGLLPVV  75
            K+P EK F  L+    L+  + S   ER+G    +  P    ++N Y +G ++GGL P+ 
Sbjct  488  KSPDEKTFQDLAEYFALDAPESSGLHERNGNAPKYRRPG---RRNYYQIG-LKGGLRPLA  543

Query  76   GTLNLH  81
                LH
Sbjct  544  QAFTLH  549

>PYAR_24501
Length=239

 Score = 30.4 bits (67),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 35/76 (46%), Gaps = 11/76 (14%)

Query  79   NLHDKEVATVTFEQLRLRIELLQDK--DVIRRSVMFQEVLALIAASSNPHGWPP----NA  132
             L+D  V  +T  QLR R+ L Q K  DV++R+ + Q V+         H WP       
Sbjct  84   KLNDDLVWDLTITQLRTRLLLAQVKTTDVLQRAQVAQAVILPKLLYIGRHVWPSATRLRT  143

Query  133  MQTY-----WFGHYTD  143
            +Q Y     WFG + +
Sbjct  144  LQRYTHNYVWFGRFEE  159

>H310_02134
Length=264

 Score = 30.0 bits (66),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 0/50 (0%)

Query  46   WVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRL  95
            WV      S PR++  Y VGT  G  +P +    L    + T+TF  L L
Sbjct  140  WVPYSILVSTPRRELRYSVGTYLGRFVPRIFRATLATIPLGTITFPCLYL  189

>H257_13589
Length=523

 Score = 30.0 bits (66),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 32/66 (48%), Gaps = 5/66 (8%)

Query  79   NLHDKEVATVTFEQ--LRLRIELLQDKDVIRRSVMFQEVLALIAASSNPHGWPPNAMQTY  136
            N+  K  A +T E+    L++EL Q +D +R+   +  V+   A     +  PP    TY
Sbjct  152  NVESKPAAPLTLEEENAALKLELEQCRDKMRK---YTTVVRAFAEDKRDYSKPPEDNDTY  208

Query  137  WFGHYT  142
            +F  Y+
Sbjct  209  YFDSYS  214

>PYIR_17280
Length=583

 Score = 29.6 bits (65),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)

Query  80   LHDKEVATVTFEQLRLRIELLQDKDVIRRSVMFQE  114
            LH  +V  V+ E+ +LRIE + ++D++R++ + QE
Sbjct  416  LHRTKVTAVSLEKAKLRIETM-ERDLVRQAKLMQE  449

>H310_14801
Length=638

 Score = 29.6 bits (65),  Expect = 9.5, Method: Composition-based stats.
 Identities = 14/36 (39%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  99   LLQDKDVIRRSVMFQEVLALIAASSNPHGWPPNAMQ  134
            L +  DVIR   +  E+LAL   +++PH  PP+  Q
Sbjct  251  LFRTGDVIRARPLADELLALSQVTTHPHLMPPSWRQ  286

Lambda      K        H        a         alpha
   0.322    0.137    0.423    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5186817045

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40