Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_81677111491731736116e-81
PHYSO_315015111492061674653e-58
PHYCA_60964111491771634362e-54
PITG_13744111491781654242e-52
PYAP_24882111491791203425e-40
PPTG_0925411149307963402e-38
PYIR_15197111492841143262e-36
PYIW_14749111493141243133e-34
PYAR_2268911149304892783e-29
SDRG_1409311149287982573e-26
H310_1172811149291942522e-25
CCA17990111492831162424e-24
H257_1278611149278942416e-24
SPRG_03281111491531042136e-21
PYU1_G00596511149117481322e-09
PHYKE_64081114991721093e-06
PHYCA_50576712836460103750.55
PHYSO_24961812836485103693.2
PPTG_1271712836496103693.8
H310_1447612836490100684.2
PHALS_0984612836481106668.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81677

Length=174
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYRA_81677                                                           239     6e-81
PHYSO_315015                                                          183     3e-58
PHYCA_60964                                                           172     2e-54
PITG_13744                                                            167     2e-52
PYAP_24882                                                            136     5e-40
PPTG_09254                                                            135     2e-38
PYIR_15197                                                            130     2e-36
PYIW_14749                                                            125     3e-34
PYAR_22689                                                            111     3e-29
SDRG_14093                                                            103     3e-26
H310_11728                                                            101     2e-25
CCA17990                                                              97.8    4e-24
H257_12786                                                            97.4    6e-24
SPRG_03281                                                            86.7    6e-21
PYU1_G005965                                                          55.5    2e-09
PHYKE_6408                                                            46.6    3e-06
PHYCA_505767                                                          33.5    0.55 
PHYSO_249618                                                          31.2    3.2  
PPTG_12717                                                            31.2    3.8  
H310_14476                                                            30.8    4.2  
PHALS_09846                                                           30.0    8.2  

>PHYRA_81677
Length=173

 Score = 239 bits (611),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 173/173 (100%), Positives = 173/173 (100%), Gaps = 0/173 (0%)

Query  1    MATSFAFAEVKalvlrrqreqaqqllerlaaavlPIltrrrfrvrrlleffPTDGALLGM  60
            MATSFAFAEVKALVLRRQREQAQQLLERLAAAVLPILTRRRFRVRRLLEFFPTDGALLGM
Sbjct  1    MATSFAFAEVKALVLRRQREQAQQLLERLAAAVLPILTRRRFRVRRLLEFFPTDGALLGM  60

Query  61   NVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQEMES  120
            NVNRGAKIYVRLRPKRTPESFYPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMES
Sbjct  61   NVNRGAKIYVRLRPKRTPESFYPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMES  120

Query  121  LMVRGLEGQEAVKFADAGAGQRLGGDSARVPICVAAVLAAKRREQVSRGSCLE  173
            LMVRGLEGQEAVKFADAGAGQRLGGDSARVPICVAAVLAAKRREQVSRGSCLE
Sbjct  121  LMVRGLEGQEAVKFADAGAGQRLGGDSARVPICVAAVLAAKRREQVSRGSCLE  173

>PHYSO_315015
Length=206

 Score = 183 bits (465),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 151/167 (90%), Gaps = 2/167 (1%)

Query  1    MATSFAFAEVKalvlrrq--reqaqqllerlaaavlPIltrrrfrvrrlleffPTDGALL  58
            M+TSFA  EVKALV + Q  R +AQQLLERLAAAVLPILT+RRFRVR LLEFFP DG LL
Sbjct  1    MSTSFAIPEVKALVRQPQPQRARAQQLLERLAAAVLPILTKRRFRVRWLLEFFPKDGCLL  60

Query  59   GMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQEM  118
            GMNVNRGAKIYVRLRP+R+P+SF PYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEM
Sbjct  61   GMNVNRGAKIYVRLRPQRSPQSFLPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEM  120

Query  119  ESLMVRGLEGQEAVKFADAGAGQRLGGDSARVPICVAAVLAAKRREQ  165
            ESLMVRGL G+E  KFADAGAGQRLGG+SA VPI VAAVLAAKRREQ
Sbjct  121  ESLMVRGLVGEEGAKFADAGAGQRLGGNSAGVPIRVAAVLAAKRREQ  167

>PHYCA_60964
Length=177

 Score = 172 bits (436),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 143/163 (88%), Gaps = 0/163 (0%)

Query  3    TSFAFAEVKalvlrrqreqaqqllerlaaavlPIltrrrfrvrrlleffPTDGALLGMNV  62
            TS+A  E+KALV + QRE AQ+LLERLAAAVLPI+TRRRFRVRRLLEFFP DGALLGMNV
Sbjct  1    TSYAITEIKALVRQPQREDAQRLLERLAAAVLPIMTRRRFRVRRLLEFFPKDGALLGMNV  60

Query  63   NRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQEMESLM  122
            NRGAKIYVRLRP+R PESFY YE LL TLLHELTHMVHGPHNQAFY+YLDELK +MESLM
Sbjct  61   NRGAKIYVRLRPQRNPESFYSYEELLGTLLHELTHMVHGPHNQAFYKYLDELKHDMESLM  120

Query  123  VRGLEGQEAVKFADAGAGQRLGGDSARVPICVAAVLAAKRREQ  165
            VRGL G+E  KF++AG G RLGG S  VPI VAAVLAAKRREQ
Sbjct  121  VRGLVGEEGAKFSEAGEGHRLGGSSVGVPIRVAAVLAAKRREQ  163

>PITG_13744
Length=178

 Score = 167 bits (424),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 141/165 (85%), Gaps = 0/165 (0%)

Query  3    TSFAFAEVKalvlrrqreqaqqllerlaaavlPIltrrrfrvrrlleffPTDGALLGMNV  62
            T+FA AE+KALV + QR QAQQLLERLAAAVLPILTRRRF VRRL EFFP DGALLGMNV
Sbjct  2    TAFAIAEIKALVRQPQRVQAQQLLERLAAAVLPILTRRRFHVRRLHEFFPKDGALLGMNV  61

Query  63   NRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQEMESLM  122
            NRGAKIYVRLR K  P++FYPYEALLETLLHELTHMVHGPHN+AFY YL+ELK EMESLM
Sbjct  62   NRGAKIYVRLRLKHAPDTFYPYEALLETLLHELTHMVHGPHNEAFYTYLEELKAEMESLM  121

Query  123  VRGLEGQEAVKFADAGAGQRLGGDSARVPICVAAVLAAKRREQVS  167
            VRGL G+E  KFADAG GQRLGG     P  VAAVLAAKRREQ +
Sbjct  122  VRGLVGEEGAKFADAGTGQRLGGSRVSAPARVAAVLAAKRREQYT  166

>PYAP_24882
Length=179

 Score = 136 bits (342),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 91/120 (76%), Gaps = 5/120 (4%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            P DG LLGMNVNRGA IY+RLRP   P SF+PYEALLET+LHELTHMVHGPHNQAFY+YL
Sbjct  56   PKDGQLLGMNVNRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYL  115

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAGQRLGGDSARVPI-----CVAAVLAAKRREQV  166
            DELK+EMESLM RGL G E  +F DAG    +  +S  + +       AAVLAA+RRE++
Sbjct  116  DELKEEMESLMTRGLVGHEGARFQDAGQAYSIQTESRVIAVRRENDNRAAVLAAQRREKM  175

>PPTG_09254
Length=307

 Score = 135 bits (340),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 85/96 (89%), Gaps = 0/96 (0%)

Query  70   VRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQEMESLMVRGLEGQ  129
            +R  PKRTP+SFYPYEALLETLLHELTHMVHGPHN+AFY+YLDELK EME LMVRGL G+
Sbjct  70   LRPLPKRTPKSFYPYEALLETLLHELTHMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129

Query  130  EAVKFADAGAGQRLGGDSARVPICVAAVLAAKRREQ  165
            E V+FA AG GQRLGGD+  VPI VAAVLAAKRREQ
Sbjct  130  EGVRFAAAGTGQRLGGDNISVPIRVAAVLAAKRREQ  165

>PYIR_15197
Length=284

 Score = 130 bits (326),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 86/114 (75%), Gaps = 9/114 (8%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            PT+  LLGMNVNRG KIY+RLRP   PESF P+EALLET+LHELTHMVHGPHNQAFY YL
Sbjct  50   PTNAHLLGMNVNRGIKIYLRLRPAARPESFLPFEALLETMLHELTHMVHGPHNQAFYNYL  109

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAGQRLGGDSARVPICVAAVLAAKRREQ  165
            DELK EME+LM+R L G E  KF  AG G+    D+A      AAVLAAK REQ
Sbjct  110  DELKMEMEALMIRDLLGTEGAKFHSAGEGR---NDNA------AAVLAAKHREQ  154

>PYIW_14749
Length=314

 Score = 125 bits (313),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 87/124 (70%), Gaps = 16/124 (13%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            PT   LLGMNVNRG KIY+RLRP   P +FYP+EALLET+LHELTHMVHGPHNQAFY+YL
Sbjct  50   PTSAHLLGMNVNRGYKIYLRLRPAAQPAAFYPFEALLETMLHELTHMVHGPHNQAFYKYL  109

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAGQ----------RLGGDSARVPICVAAVLAAK  161
            DELK EME+LM++GL G E  KF  AG G+          R   D+A      AAVL AK
Sbjct  110  DELKTEMEALMIQGLIGAEGAKFHSAGEGRVIKASRSISVRFQNDNA------AAVLVAK  163

Query  162  RREQ  165
            RR Q
Sbjct  164  RRAQ  167

>PYAR_22689
Length=304

 Score = 111 bits (278),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 70/89 (79%), Gaps = 6/89 (7%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            P+D  LLGMNVNRGA IY+RLRP+  PESF PYEALLET+LHELTHMVHGPHNQAFY   
Sbjct  50   PSDANLLGMNVNRGATIYIRLRPQHRPESFLPYEALLETMLHELTHMVHGPHNQAFY---  106

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAG  140
               K E+ESLM+RGL G E  +F DAG G
Sbjct  107  ---KDEVESLMLRGLTGHEGARFQDAGDG  132

>SDRG_14093
Length=287

 Score = 103 bits (257),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 68/98 (69%), Gaps = 0/98 (0%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            P +  LLGMNVN G KIYVRLRP   P SF P+E LL T+LHEL HM  GPHN AFY+ L
Sbjct  50   PKNANLLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLL  109

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAGQRLGGDSAR  149
            DEL  EMESLM +GL G    +F +AG G  LGG +AR
Sbjct  110  DELTSEMESLMAQGLIGITGAQFQNAGQGHALGGANAR  147

>H310_11728
Length=291

 Score = 101 bits (252),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 0/94 (0%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            P +G LLGMNVN+G KI++RLRP   P +F P+E +L T+LHEL HM  GPHN +FY+ L
Sbjct  54   PKNGNLLGMNVNQGWKIFLRLRPASQPTTFLPFEDILGTMLHELVHMKIGPHNASFYKML  113

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAGQRLGG  145
            DEL +EME+L+ RGL G     F DAG GQ LGG
Sbjct  114  DELTREMENLLERGLLGAAGAAFQDAGNGQSLGG  147

>CCA17990
Length=283

 Score = 97.8 bits (242),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 5/116 (4%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            P D  LLGMN+NRG K+++RLRP R P++FYPYEALLETLLHELTH V+G H++AFY++ 
Sbjct  51   PKDARLLGMNLNRGWKVFIRLRPSRKPDTFYPYEALLETLLHELTHNVYGQHDEAFYKFF  110

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAGQRLGGDSA-----RVPICVAAVLAAKR  162
             +LK+E E LM+ GL G+    F  +G G  L  +S      R    +AA + AKR
Sbjct  111  AQLKKEAEDLMMNGLSGRSGALFMGSGRGHVLQPNSTSAGDYRHKAALAADIRAKR  166

>H257_12786
Length=278

 Score = 97.4 bits (241),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 0/94 (0%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            P +  LLGMNVN G KI++RLRP   P +F P+E +L T+LHEL HM  GPH+ +FY+ L
Sbjct  50   PKNANLLGMNVNEGWKIFLRLRPASHPTTFLPFEEILGTMLHELVHMKIGPHDASFYKML  109

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAGQRLGG  145
            DEL ++ME+LM RGL G     F D G GQ LGG
Sbjct  110  DELTEDMENLMARGLLGATGAAFQDTGDGQSLGG  143

>SPRG_03281
Length=153

 Score = 86.7 bits (213),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 67/104 (64%), Gaps = 8/104 (8%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYL  111
            P +  LLGMNVN G KIYVRLRP   P SF P+E LL T+LHEL HM  GPHN AFY+ L
Sbjct  50   PKNANLLGMNVNHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLL  109

Query  112  DELKQEMESLMVRGLEGQEAVKFADAGAGQRLGGDSARVPICVA  155
            DEL  EME+LM +GL G  A   + A + + L  D     +CVA
Sbjct  110  DELTSEMETLMAQGLIGGLA---SLARSSKTLAKD-----MCVA  145

>PYU1_G005965
Length=117

 Score = 55.5 bits (132),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)

Query  52   PTDGALLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMV  99
            PT+  LLGMNVN+G KIY+RLRP   P +F+P+EALLET+LHELTHMV
Sbjct  59   PTNPHLLGMNVNKGVKIYIRLRPANAPGTFFPFEALLETMLHELTHMV  106

>PHYKE_6408
Length=91

 Score = 46.6 bits (109),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)

Query  1   MATSFAFAEVKalvlrrqreqaqqllerlaaavlPIltrrrfrvrrlleffPTDGALLGM  60
           MA+SFA  EVKALV + +R+ AQQLLERLA AVLPI+T+RRFRV RL+EFFP DG+LLGM
Sbjct  1   MASSFAIPEVKALVRQPRRDHAQQLLERLATAVLPIMTQRRFRVHRLIEFFPKDGSLLGM  60

Query  61  NVNRGAKIYVRL  72
           NVN GAKIY+RL
Sbjct  61  NVNHGAKIYIRL  72

>PHYCA_505767
Length=460

 Score = 33.5 bits (75),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 12/103 (12%)

Query  57   LLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQ  116
            +LG+N N+G KI +RLR       F  + ++ + L HEL+H VH  H+  FYQ + ++++
Sbjct  160  VLGLNQNKGQKILLRLR-TDDLLGFRKFLSIKKVLFHELSHNVHSEHDNKFYQLMRQVEK  218

Query  117  EMESLMVRG-----LEGQEAVKFAD------AGAGQRLGGDSA  148
            E   L         + G  A+   D      A +GQRLGG SA
Sbjct  219  ECNELDWTNSSGAAIGGSGAILRDDGDFGTSASSGQRLGGGSA  261

>PHYSO_249618
Length=485

 Score = 31.2 bits (69),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 12/103 (12%)

Query  57   LLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQ  116
            +LG+N N+G KI +RLR       F  + ++ + L HEL+H VH  H+  FYQ + +++ 
Sbjct  186  VLGLNQNKGQKILLRLR-TDDLLGFRKFLSIKKVLFHELSHNVHSEHDSKFYQLMRQIEN  244

Query  117  EMESLMVR-----GLEGQEAVKF----ADAG--AGQRLGGDSA  148
            E   L         + G +A+      +D+G  +G RLGG SA
Sbjct  245  ECNELDWTSSGGAAVGGSQAMPHNESNSDSGSTSGHRLGGGSA  287

>PPTG_12717
Length=496

 Score = 31.2 bits (69),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 12/103 (12%)

Query  57   LLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQ  116
            +LG+N N+G KI +RLR       F  + ++ + L HEL+H VH  H+  FYQ + ++++
Sbjct  206  VLGLNQNKGQKILLRLR-TDDLLGFRKFLSIKKVLFHELSHNVHSEHDNKFYQLMRQVEK  264

Query  117  EMESLMVRGLEG-----------QEAVKFADAGAGQRLGGDSA  148
            E   L      G            +    ++  +G RLGG SA
Sbjct  265  ECNELDWTNSGGAAVGGSPAALHDDDSTSSNVSSGHRLGGGSA  307

>H310_14476
Length=490

 Score = 30.8 bits (68),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query  57   LLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHG---PHNQAFYQYLDE  113
            +LG+N N+G +I +RLR     +    +   L         + H     HN  FYQ + +
Sbjct  182  VLGLNENKGQRIRLRLR----TDDLLGFRKFLTIKQVLFHELSHNDVSDHNPEFYQLMRQ  237

Query  114  LKQEMESL-MVRGLEGQEAVKFADAGAGQRLG-GDSARVP  151
            ++ E  ++ M R      +V    +  G RLG G S  +P
Sbjct  238  VEAECNAIPMTRTTPLVRSVVQQQSSVGHRLGLGPSPPLP  277

>PHALS_09846
Length=481

 Score = 30.0 bits (66),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 15/106 (14%)

Query  57   LLGMNVNRGAKIYVRLRPKRTPESFYPYEAlletllhelthMVHGPHNQAFYQYLDELKQ  116
            +LG+N N+G KI +R         F  Y ++ + L HEL+H VH  H+  FYQ + ++++
Sbjct  184  ILGLNQNKGQKILLR-LRTDDLLGFRKYLSIKKVLFHELSHNVHSEHDNKFYQLMRQVER  242

Query  117  EMESL-------MVRGLEGQEAVKFADA-----GAGQRLGGDSARV  150
            E   L        V G  G  A+   D        G RLGG SA+ 
Sbjct  243  ECSELDWTQSGGSVVG--GSPAIVEDDGTTLKNSTGYRLGGGSAQT  286

Lambda      K        H        a         alpha
   0.324    0.138    0.406    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6670127178

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40