Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_816741114661659529930.0
PHYSO_3150181114663661924450.0
PHYCA_5353791114662760924230.0
PPTG_092511114664160824030.0
PITG_137381114661060522130.0
PHALS_115631114661361019380.0
PYU1_G0059621114662462215800.0
PYIW_147541114661662215100.0
PYIR_151781114663863215010.0
PYVX_208581114662161714980.0
PYAR_232061114660062913317e-177
HYAP_08501111463523639783e-127
CCA15905111466206399424e-118
PYAP_22843111464725099084e-115
H310_01471111465606018391e-103
SPRG_06313111465155188307e-103
H257_00314111465636098093e-99
SDRG_01805111465195188002e-98
CCI46717111463823994927e-55
PYAP_228451005791351224636e-54
PHYKE_5842111455501094572e-48
H257_08759141943107491279e-08
SDRG_0835412944174481221e-06
SPRG_0198212944175481222e-06
PYU1_G00943412944163461212e-06
H257_0060512944186541212e-06
PHYRA_9341712944332461234e-06
PHALS_0990812944499461255e-06
PPTG_0962912944191541195e-06
SPRG_070021256151701221185e-06
PYIR_1325012944214461196e-06
PYIW_1947412944224461197e-06
SDRG_08762144371109631137e-06
H310_0120512944186481179e-06
H257_06038125748684521221e-05
H257_06804141055933931212e-05
CCA261325881266881163e-05
H310_13091125748662521193e-05
H310_10009141055972621184e-05
H310_06346144371139421095e-05
PYAR_2052014949374611148e-05
H310_05789125615223431109e-05
PYAP_188749935675611021e-04
H257_13532144371136421052e-04
PYU1_G0085142443531651122e-04
PYAR_207062443530751112e-04
PYAR_252123353307611092e-04
PITG_1875114949330741092e-04
PPTG_0954714949391591102e-04
PYIR_1857114949403581093e-04
H310_0028417505994531103e-04
PYU1_G00497614633172561044e-04
PYAR_131768274621661094e-04
SDRG_1151714949356601084e-04
SDRG_005063353738611094e-04
PYU1_G00937995722435601085e-04
PYAP_1775014761343591075e-04
PYIR_141541564617401085e-04
PHYKE_733314949376591076e-04
PYIW_1529682746751121086e-04
PHALS_12995785768421086e-04
SPRG_072003353714611086e-04
PPTG_1665321617851076e-04
H310_08802141715190421036e-04
H257_1239314761208421037e-04
CCI452125881267881057e-04
SPRG_0012214949355541058e-04
PHYSO_28841114949187591028e-04
PYIR_1527614633153501000.001
PYIW_233871564591471060.001
H310_0512714761206421020.001
SDRG_09580125615161511000.001
PITG_038213353830491050.001
SDRG_1038815292629851050.001
PHYCA_10491214949347561040.001
PHYSO_5583918518463441040.001
PYU1_G00173014761358421030.001
PHYKE_69785651610851040.002
PYVX_1732214949385441030.002
PHYRA_806132443488631030.002
PITG_1519512278601591020.003
SDRG_1323612472713557950.003
PYAP_1742614949369561010.003
CCI4512014761270641000.003
PHALS_0899114949400471010.003
PYU1_G00905814949389611010.003
H257_06791175051029641020.003
PYVX_186598518452481010.003
PHYSO_5539321476123342990.003
CCA141803353844611020.003
PYIW_208531494922458990.003
PPTG_005238518466441010.003
PPTG_065363353837611020.003
PITG_1924915292465441010.003
HYAP_09472122786391071010.003
PHYRA_77725785968421020.003
PITG_103218518465441010.003
PYU1_G0071933353831541020.003
HYAP_02462785821421010.003
PYVX_1803057811665611010.003
CCA181702443374801000.004
SPRG_15736152926221081010.004
PHYSO_3223603353811611010.004
PHYCA_5254763353753491010.004
PITG_0002521535851010.004
PYVX_1474233531160531010.004
PHYKE_301512278612471010.004
CCI433853353862611010.004
PITG_02789244331565990.004
CCI43386160562788611010.004
PYIR_1696612278634471000.004
PYIW_1466414761426421000.004
PYAP_132463353832611010.005
H257_0818314171519342960.005
PPTG_171321476128842980.005
SDRG_077321476115942950.005
PHALS_0060633531142491000.006
PHYCA_568641244343465990.006
PHYRA_9412033531227611000.006
H310_06527143321243100970.006
PPTG_05556244348963990.006
PYU1_G0128891227859247990.007
PHYCA_107875851844144980.007
PYAP_13371244348283980.007
PYIW_229991463321950960.007
PYAR_2014010387928443970.007
PYAR_204571463313343920.007
PITG_184621476122042950.007
PPTG_040051001064342980.008
PHALS_130471227859492980.008
PHYSO_5442101227861547980.008
SDRG_069099260240219960.008
PYIR_134461476142442970.008
CCA188951476127484960.009
PHALS_072411476129042960.009
PPTG_2412378599343980.009
H257_1367214440629344960.009
H310_041401494936848970.009
PPTG_067621227859747980.009
PHYCA_5309151476118642940.009
HYAP_071061476129142960.010
PYAR_149061227859047970.010
PYAP_130925881277136960.010
PYVX_191831476118251930.010
PHYKE_78373353144749980.011
PHYRA_793171227859547970.011
PYIW_23779419734656960.011
PHYCA_5042431227859747970.011
CCI4901612278539110970.011
H257_14373335371154970.012
PHYCA_1033721812514344910.012
PYVX_237211227861047960.013
SPRG_12576926024044940.013
HYAP_05107335390661970.014
CCA1402315176239644950.014
SPRG_005271476116442910.014
PYU1_G005703156441239950.015
PHYKE_83961476116059910.015
PHYRA_810911476121242930.015
CCI3999815176239644950.015
PYU1_G010079959999242870.016
PHYCA_1046322156985950.016
HYAP_041431812547044950.017
SPRG_0729612574850552950.017
PYAR_26477107078196122920.018
SPRG_2109913446611975880.019
PYAP_1919015084124850960.019
PYAP_233361227856247950.019
PYAR_21118238441476940.020
SPRG_1189812833814943890.021
H257_079401494936953940.021
PYIW_21541335382154950.022
PYIR_18633335386154950.022
PYAP_207831463319654910.025
PYAR_251059935643748930.026
PHALS_11946244349261940.026
CCA199781227853847930.028
PYVX_21138453342647930.029
PYU1_G007124329746457930.029
H310_11926335371154940.030
SPRG_0538112472713369870.030
PYIW_131281077742544930.031
PPTG_13607329743056930.032
PYIR_19269453346048930.033
CCI42121329758268930.033
PYIW_21519329746754930.033
SPRG_0219917505100753930.034
CCA20583329736571920.035
PITG_06725565176554930.037
PYU1_G0139088242140285920.037
PHYSO_441337244331365910.037
H310_1432814440630344910.039
PYVX_167341463327750910.040
SDRG_1096117505100553930.040
PYIW_196215710116148930.041
H310_00896238440766920.042
PYIR_22040244345753910.045
PHALS_040272159046920.047
PHALS_06891754354658910.052
PYIW_184351289996162920.052
H310_011961227859266910.056
PPTG_185925710109448920.056
SDRG_10501565168533910.059
PYAP_151459841538152900.060
PITG_03761329743156900.061
PYAR_213059841537348900.062
PYIR_25281419735653900.064
PHYRA_759921463315843860.064
PYIR_165178242158385910.064
PYAR_135791476136559900.065
PYIW_16105851839744900.066
PITG_067925710105848910.066
CCI472511077741556900.070
PYU1_G001639754361456900.071
PPTG_11049565167585900.072
PYIR_19863754365256900.073
PHYSO_46998691436152890.073
PHYSO_4769865683036152890.073
PYIR_18310827467853900.077
CCA169061077742356890.078
PYAR_16668851844845890.079
PYIR_231831077743344890.079
H310_019802147942890.079
PYIR_18043851846248890.081
PHYSO_3582152140036846890.082
H310_1257115060478445900.084
SDRG_0425412574850652890.085
H257_0818414171617342860.086
PYAP_15538851844348890.086
SPRG_03958565147233890.086
PHALS_006581812539729890.089
PYU1_G002995851844844890.091
PPTG_11751827483452890.096
PYAP_19146156440742890.096
PYU1_G0034261442349248890.097
H257_1154214332124455870.099
PYAR_231871077741756880.099
CCA26695419729753880.100
CCA2347915583329753880.100
PHYRA_96819848979682890.10
PYU1_G009791576240775880.10
PYIR_15591329744654880.11
SDRG_0407012436918544850.11
PYU1_G0133651077741344880.11
PYAR_179194640810170810.11
PHALS_01600238447089880.13
PHYSO_326395565185954880.13
H257_04593926024786860.13
PYAP_195399616877731880.14
PYU1_G0102495710108048880.14
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81674

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYRA_81674                                                           1157    0.0   
PHYSO_315018                                                          946     0.0   
PHYCA_535379                                                          937     0.0   
PPTG_09251                                                            930     0.0   
PITG_13738                                                            857     0.0   
PHALS_11563                                                           751     0.0   
PYU1_G005962                                                          613     0.0   
PYIW_14754                                                            586     0.0   
PYIR_15178                                                            582     0.0   
PYVX_20858                                                            581     0.0   
PYAR_23206                                                            517     7e-177
HYAP_08501                                                            381     3e-127
CCA15905                                                              367     4e-118
PYAP_22843                                                            354     4e-115
H310_01471                                                            327     1e-103
SPRG_06313                                                            324     7e-103
H257_00314                                                            316     3e-99 
SDRG_01805                                                            312     2e-98 
CCI46717                                                              194     7e-55 
PYAP_22845                                                            182     6e-54 
PHYKE_5842                                                            180     2e-48 
H257_08759                                                            53.5    9e-08 
SDRG_08354                                                            51.6    1e-06 
SPRG_01982                                                            51.6    2e-06 
PYU1_G009434                                                          51.2    2e-06 
H257_00605                                                            51.2    2e-06 
PHYRA_93417                                                           52.0    4e-06 
PHALS_09908                                                           52.8    5e-06 
PPTG_09629                                                            50.4    5e-06 
SPRG_07002                                                            50.1    5e-06 
PYIR_13250                                                            50.4    6e-06 
PYIW_19474                                                            50.4    7e-06 
SDRG_08762                                                            48.1    7e-06 
H310_01205                                                            49.7    9e-06 
H257_06038                                                            51.6    1e-05 
H257_06804                                                            51.2    2e-05 
CCA26132                                                              49.3    3e-05 
H310_13091                                                            50.4    3e-05 
H310_10009                                                            50.1    4e-05 
H310_06346                                                            46.6    5e-05 
PYAR_20520                                                            48.5    8e-05 
H310_05789                                                            47.0    9e-05 
PYAP_18874                                                            43.9    1e-04 
H257_13532                                                            45.1    2e-04 
PYU1_G008514                                                          47.8    2e-04 
PYAR_20706                                                            47.4    2e-04 
PYAR_25212                                                            46.6    2e-04 
PITG_18751                                                            46.6    2e-04 
PPTG_09547                                                            47.0    2e-04 
PYIR_18571                                                            46.6    3e-04 
H310_00284                                                            47.0    3e-04 
PYU1_G004976                                                          44.7    4e-04 
PYAR_13176                                                            46.6    4e-04 
SDRG_11517                                                            46.2    4e-04 
SDRG_00506                                                            46.6    4e-04 
PYU1_G009379                                                          46.2    5e-04 
PYAP_17750                                                            45.8    5e-04 
PYIR_14154                                                            46.2    5e-04 
PHYKE_7333                                                            45.8    6e-04 
PYIW_15296                                                            46.2    6e-04 
PHALS_12995                                                           46.2    6e-04 
SPRG_07200                                                            46.2    6e-04 
PPTG_16653                                                            45.8    6e-04 
H310_08802                                                            44.3    6e-04 
H257_12393                                                            44.3    7e-04 
CCI45212                                                              45.1    7e-04 
SPRG_00122                                                            45.1    8e-04 
PHYSO_288411                                                          43.9    8e-04 
PYIR_15276                                                            43.1    0.001 
PYIW_23387                                                            45.4    0.001 
H310_05127                                                            43.9    0.001 
SDRG_09580                                                            43.1    0.001 
PITG_03821                                                            45.1    0.001 
SDRG_10388                                                            45.1    0.001 
PHYCA_104912                                                          44.7    0.001 
PHYSO_558391                                                          44.7    0.001 
PYU1_G001730                                                          44.3    0.001 
PHYKE_6978                                                            44.7    0.002 
PYVX_17322                                                            44.3    0.002 
PHYRA_80613                                                           44.3    0.002 
PITG_15195                                                            43.9    0.003 
SDRG_13236                                                            41.2    0.003 
PYAP_17426                                                            43.5    0.003 
CCI45120                                                              43.1    0.003 
PHALS_08991                                                           43.5    0.003 
PYU1_G009058                                                          43.5    0.003 
H257_06791                                                            43.9    0.003 
PYVX_18659                                                            43.5    0.003 
PHYSO_553932                                                          42.7    0.003 
CCA14180                                                              43.9    0.003 
PYIW_20853                                                            42.7    0.003 
PPTG_00523                                                            43.5    0.003 
PPTG_06536                                                            43.9    0.003 
PITG_19249                                                            43.5    0.003 
HYAP_09472                                                            43.5    0.003 
PHYRA_77725                                                           43.9    0.003 
PITG_10321                                                            43.5    0.003 
PYU1_G007193                                                          43.9    0.003 
HYAP_02462                                                            43.5    0.003 
PYVX_18030                                                            43.5    0.003 
CCA18170                                                              43.1    0.004 
SPRG_15736                                                            43.5    0.004 
PHYSO_322360                                                          43.5    0.004 
PHYCA_525476                                                          43.5    0.004 
PITG_00025                                                            43.5    0.004 
PYVX_14742                                                            43.5    0.004 
PHYKE_3015                                                            43.5    0.004 
CCI43385                                                              43.5    0.004 
PITG_02789                                                            42.7    0.004 
CCI43386                                                              43.5    0.004 
PYIR_16966                                                            43.1    0.004 
PYIW_14664                                                            43.1    0.004 
PYAP_13246                                                            43.5    0.005 
H257_08183                                                            41.6    0.005 
PPTG_17132                                                            42.4    0.005 
SDRG_07732                                                            41.2    0.005 
PHALS_00606                                                           43.1    0.006 
PHYCA_568641                                                          42.7    0.006 
PHYRA_94120                                                           43.1    0.006 
H310_06527                                                            42.0    0.006 
PPTG_05556                                                            42.7    0.006 
PYU1_G012889                                                          42.7    0.007 
PHYCA_107875                                                          42.4    0.007 
PYAP_13371                                                            42.4    0.007 
PYIW_22999                                                            41.6    0.007 
PYAR_20140                                                            42.0    0.007 
PYAR_20457                                                            40.0    0.007 
PITG_18462                                                            41.2    0.007 
PPTG_04005                                                            42.4    0.008 
PHALS_13047                                                           42.4    0.008 
PHYSO_544210                                                          42.4    0.008 
SDRG_06909                                                            41.6    0.008 
PYIR_13446                                                            42.0    0.008 
CCA18895                                                              41.6    0.009 
PHALS_07241                                                           41.6    0.009 
PPTG_24123                                                            42.4    0.009 
H257_13672                                                            41.6    0.009 
H310_04140                                                            42.0    0.009 
PPTG_06762                                                            42.4    0.009 
PHYCA_530915                                                          40.8    0.009 
HYAP_07106                                                            41.6    0.010 
PYAR_14906                                                            42.0    0.010 
PYAP_13092                                                            41.6    0.010 
PYVX_19183                                                            40.4    0.010 
PHYKE_7837                                                            42.4    0.011 
PHYRA_79317                                                           42.0    0.011 
PYIW_23779                                                            41.6    0.011 
PHYCA_504243                                                          42.0    0.011 
CCI49016                                                              42.0    0.011 
H257_14373                                                            42.0    0.012 
PHYCA_103372                                                          39.7    0.012 
PYVX_23721                                                            41.6    0.013 
SPRG_12576                                                            40.8    0.013 
HYAP_05107                                                            42.0    0.014 
CCA14023                                                              41.2    0.014 
SPRG_00527                                                            39.7    0.014 
PYU1_G005703                                                          41.2    0.015 
PHYKE_8396                                                            39.7    0.015 
PHYRA_81091                                                           40.4    0.015 
CCI39998                                                              41.2    0.015 
PYU1_G010079                                                          38.1    0.016 
PHYCA_104632                                                          41.2    0.016 
HYAP_04143                                                            41.2    0.017 
SPRG_07296                                                            41.2    0.017 
PYAR_26477                                                            40.0    0.018 
SPRG_21099                                                            38.5    0.019 
PYAP_19190                                                            41.6    0.019 
PYAP_23336                                                            41.2    0.019 
PYAR_21118                                                            40.8    0.020 
SPRG_11898                                                            38.9    0.021 
H257_07940                                                            40.8    0.021 
PYIW_21541                                                            41.2    0.022 
PYIR_18633                                                            41.2    0.022 
PYAP_20783                                                            39.7    0.025 
PYAR_25105                                                            40.4    0.026 
PHALS_11946                                                           40.8    0.026 
CCA19978                                                              40.4    0.028 
PYVX_21138                                                            40.4    0.029 
PYU1_G007124                                                          40.4    0.029 
H310_11926                                                            40.8    0.030 
SPRG_05381                                                            38.1    0.030 
PYIW_13128                                                            40.4    0.031 
PPTG_13607                                                            40.4    0.032 
PYIR_19269                                                            40.4    0.033 
CCI42121                                                              40.4    0.033 
PYIW_21519                                                            40.4    0.033 
SPRG_02199                                                            40.4    0.034 
CCA20583                                                              40.0    0.035 
PITG_06725                                                            40.4    0.037 
PYU1_G013908                                                          40.0    0.037 
PHYSO_441337                                                          39.7    0.037 
H310_14328                                                            39.7    0.039 
PYVX_16734                                                            39.7    0.040 
SDRG_10961                                                            40.4    0.040 
PYIW_19621                                                            40.4    0.041 
H310_00896                                                            40.0    0.042 
PYIR_22040                                                            39.7    0.045 
PHALS_04027                                                           40.0    0.047 
PHALS_06891                                                           39.7    0.052 
PYIW_18435                                                            40.0    0.052 
H310_01196                                                            39.7    0.056 
PPTG_18592                                                            40.0    0.056 
SDRG_10501                                                            39.7    0.059 
PYAP_15145                                                            39.3    0.060 
PITG_03761                                                            39.3    0.061 
PYAR_21305                                                            39.3    0.062 
PYIR_25281                                                            39.3    0.064 
PHYRA_75992                                                           37.7    0.064 
PYIR_16517                                                            39.7    0.064 
PYAR_13579                                                            39.3    0.065 
PYIW_16105                                                            39.3    0.066 
PITG_06792                                                            39.7    0.066 
CCI47251                                                              39.3    0.070 
PYU1_G001639                                                          39.3    0.071 
PPTG_11049                                                            39.3    0.072 
PYIR_19863                                                            39.3    0.073 
PHYSO_469986                                                          38.9    0.073 
PHYSO_476986                                                          38.9    0.073 
PYIR_18310                                                            39.3    0.077 
CCA16906                                                              38.9    0.078 
PYAR_16668                                                            38.9    0.079 
PYIR_23183                                                            38.9    0.079 
H310_01980                                                            38.9    0.079 
PYIR_18043                                                            38.9    0.081 
PHYSO_358215                                                          38.9    0.082 
H310_12571                                                            39.3    0.084 
SDRG_04254                                                            38.9    0.085 
H257_08184                                                            37.7    0.086 
PYAP_15538                                                            38.9    0.086 
SPRG_03958                                                            38.9    0.086 
PHALS_00658                                                           38.9    0.089 
PYU1_G002995                                                          38.9    0.091 
PPTG_11751                                                            38.9    0.096 
PYAP_19146                                                            38.9    0.096 
PYU1_G003426                                                          38.9    0.097 
H257_11542                                                            38.1    0.099 
PYAR_23187                                                            38.5    0.099 
CCA26695                                                              38.5    0.100 
CCA23479                                                              38.5    0.100 
PHYRA_96819                                                           38.9    0.10  
PYU1_G009791                                                          38.5    0.10  
PYIR_15591                                                            38.5    0.11  
SDRG_04070                                                            37.4    0.11  
PYU1_G013365                                                          38.5    0.11  
PYAR_17919                                                            35.8    0.11  
PHALS_01600                                                           38.5    0.13  
PHYSO_326395                                                          38.5    0.13  
H257_04593                                                            37.7    0.13  
PYAP_19539                                                            38.5    0.14  
PYU1_G010249                                                          38.5    0.14  
SPRG_01977                                                            38.5    0.14  
H257_16246                                                            38.1    0.15  
PYVX_24209                                                            38.1    0.15  
PYIR_13224                                                            38.5    0.15  
PHALS_11589                                                           37.7    0.16  
HYAP_05167                                                            38.1    0.16  
PYVX_17302                                                            38.1    0.16  
PITG_01038                                                            37.7    0.16  
SDRG_08349                                                            38.1    0.17  
SPRG_15617                                                            35.8    0.17  
PYVX_20261                                                            37.7    0.18  
HYAP_03293                                                            37.7    0.18  
PHYSO_491096                                                          37.7    0.19  
PYU1_G010963                                                          38.1    0.19  
CCA15828                                                              38.1    0.19  
PYAP_18210                                                            37.7    0.19  
H310_06619                                                            37.4    0.19  
PYIR_23754                                                            37.7    0.19  
PYIR_15045                                                            38.1    0.19  
PPTG_16286                                                            38.1    0.20  
PYVX_17168                                                            37.4    0.20  
H310_14008                                                            37.7    0.20  
HYAP_10080                                                            38.1    0.21  
HYAP_09739                                                            36.2    0.21  
HYAP_05343                                                            37.4    0.21  
SPRG_04569                                                            37.7    0.21  
HYAP_10895                                                            37.7    0.23  
PYAR_14624                                                            36.6    0.24  
HYAP_09737                                                            37.7    0.25  
H310_06071                                                            37.4    0.25  
PHYRA_75300                                                           37.4    0.25  
PHYCA_110463                                                          37.4    0.25  
PYVX_13648                                                            37.4    0.26  
PHYCA_529249                                                          37.0    0.26  
CCI50606                                                              37.0    0.27  
PHYRA_95641                                                           37.4    0.28  
SDRG_03814                                                            37.7    0.28  
PYVX_15397                                                            37.4    0.28  
PYVX_18934                                                            37.0    0.30  
PHALS_14198                                                           37.4    0.30  
SDRG_12435                                                            36.6    0.30  
SDRG_12434                                                            36.6    0.30  
PHYSO_516036                                                          35.8    0.30  
H257_06009                                                            37.4    0.30  
H257_03456                                                            37.4    0.32  
SDRG_05421                                                            36.6    0.33  
PHALS_13020                                                           37.0    0.33  
PHYRA_74793                                                           37.4    0.33  
PYVX_20950                                                            37.0    0.35  
PYIR_17889                                                            37.4    0.35  
PPTG_04666                                                            36.6    0.36  
PHYSO_317996                                                          37.4    0.38  
PHYRA_80698                                                           37.0    0.40  
PYU1_G004427                                                          37.0    0.40  
PYAP_13170                                                            37.0    0.41  
PPTG_19285                                                            37.0    0.43  
PHYCA_98865                                                           36.2    0.43  
PYVX_15421                                                            37.0    0.44  
SPRG_20626                                                            35.8    0.44  
PHYCA_539182                                                          37.0    0.45  
H257_00616                                                            36.6    0.45  
PYIW_18956                                                            37.0    0.47  
PHYSO_454028                                                          36.6    0.48  
PYIW_20686                                                            36.6    0.49  
H257_04031                                                            36.6    0.50  
PITG_04571                                                            35.4    0.51  
PHYSO_474309                                                          36.6    0.51  
PYIW_14039                                                            36.6    0.51  
PITG_02723                                                            36.6    0.52  
PYIW_22457                                                            35.8    0.53  
CCI40171                                                              37.0    0.54  
SPRG_10141                                                            36.2    0.55  
PPTG_13247                                                            36.2    0.55  
PYAR_23449                                                            35.8    0.56  
PYAP_13235                                                            36.2    0.56  
PYAR_15260                                                            35.8    0.57  
PHYSO_359495                                                          36.2    0.57  
PYVX_21774                                                            36.2    0.58  
PYIR_15258                                                            36.2    0.59  
SDRG_03834                                                            36.2    0.59  
PHYCA_503511                                                          36.2    0.61  
H310_12511                                                            34.3    0.61  
PHYSO_496249                                                          36.6    0.62  
PHYRA_75528                                                           35.8    0.65  
PYAR_17590                                                            36.2    0.66  
SPRG_20054                                                            35.8    0.66  
PYIW_17946                                                            35.0    0.66  
PYIR_22666                                                            35.0    0.67  
SPRG_16070                                                            36.6    0.68  
PHYCA_577126                                                          36.2    0.68  
PHYSO_302312                                                          36.2    0.70  
PYAP_18927                                                            36.2    0.71  
PITG_22857                                                            36.2    0.73  
PYAR_13415                                                            35.4    0.74  
PYIW_16281                                                            35.4    0.74  
PYAP_24965                                                            36.2    0.74  
PITG_04905                                                            35.8    0.74  
PHYRA_79594                                                           36.2    0.74  
CCI44683                                                              35.8    0.76  
SPRG_02871                                                            35.8    0.76  
SDRG_13137                                                            35.8    0.77  
PYAR_17169                                                            35.8    0.82  
SPRG_17132                                                            35.4    0.82  
PHYCA_575745                                                          35.8    0.83  
SDRG_16098                                                            36.2    0.83  
PPTG_09394                                                            35.4    0.84  
PPTG_20649                                                            35.0    0.85  
PHYRA_77467                                                           35.4    0.85  
PYIW_15735                                                            35.8    0.86  
SDRG_06286                                                            34.7    0.87  
PYAP_17815                                                            35.4    0.87  
PPTG_10322                                                            35.8    0.89  
SDRG_14644                                                            33.9    0.92  
CCA15199                                                              35.8    0.92  
PHYKE_9812                                                            35.4    0.94  
PPTG_00492                                                            35.8    0.95  
PHYSO_485995                                                          35.8    0.97  
PHYRA_77537                                                           35.4    0.98  
PITG_06849                                                            35.4    0.99  
PHYCA_542886                                                          35.0    1.0   
PHYSO_566581                                                          35.4    1.0   
PYU1_G002937                                                          35.4    1.1   
PHYRA_79956                                                           35.0    1.1   
PHYSO_322283                                                          35.4    1.1   
PITG_07745                                                            35.0    1.1   
CCA21163                                                              35.4    1.1   
PHYCA_34102                                                           35.4    1.1   
PYIR_23050                                                            34.7    1.1   
SPRG_05620                                                            35.4    1.1   
PHYKE_6903                                                            35.0    1.2   
PYVX_17349                                                            32.7    1.2   
HYAP_08680                                                            35.4    1.2   
PYU1_G000018                                                          35.4    1.2   
PYU1_G011028                                                          35.0    1.2   
PYVX_21690                                                            35.0    1.2   
PHYSO_348603                                                          35.0    1.2   
PHYSO_348645                                                          34.3    1.2   
PHYCA_510382                                                          35.4    1.2   
HYAP_05437                                                            35.0    1.2   
PHYKE_6696                                                            35.0    1.3   
SPRG_14175                                                            35.0    1.3   
PYIW_15865                                                            35.4    1.3   
PYAP_19047                                                            35.0    1.3   
SPRG_07375                                                            35.4    1.3   
CCA14639                                                              34.7    1.3   
PPTG_00942                                                            35.0    1.4   
PYAP_22590                                                            35.0    1.4   
PYAR_21053                                                            34.3    1.4   
PHALS_08957                                                           35.4    1.4   
CCA14290                                                              34.7    1.4   
H257_03611                                                            35.0    1.5   
PYAP_20567                                                            34.7    1.5   
PHYKE_6166                                                            35.0    1.5   
PITG_02571                                                            34.7    1.5   
CCI40615                                                              34.7    1.6   
PPTG_03353                                                            35.0    1.6   
PITG_18301                                                            33.5    1.6   
H310_13121                                                            35.0    1.6   
PYU1_G007015                                                          34.7    1.6   
PYU1_G013921                                                          34.3    1.6   
PYAP_21108                                                            34.3    1.6   
PYIR_15342                                                            35.0    1.6   
SPRG_05600                                                            35.0    1.7   
PYIW_16406                                                            35.0    1.7   
PPTG_16346                                                            34.7    1.7   
PYVX_17537                                                            35.0    1.7   
SDRG_07947                                                            34.7    1.7   
PHYCA_537577                                                          35.0    1.7   
H310_10136                                                            35.0    1.7   
PYIR_20315                                                            34.7    1.7   
PITG_05331                                                            34.7    1.7   
PHYRA_74439                                                           34.3    1.8   
PYU1_G009074                                                          34.7    1.8   
PYIW_14050                                                            34.3    1.8   
PITG_09090                                                            34.7    1.8   
H257_13622                                                            34.3    1.9   
PPTG_18645                                                            34.7    1.9   
SPRG_09420                                                            34.7    1.9   
SPRG_02923                                                            34.3    2.0   
SPRG_11477                                                            34.3    2.0   
PPTG_05311                                                            34.7    2.0   
PHYSO_472659                                                          34.3    2.0   
CCI42893                                                              34.3    2.0   
PHYSO_311785                                                          33.5    2.0   
PHALS_03635                                                           34.7    2.1   
PYAP_16130                                                            34.7    2.1   
SPRG_16580                                                            33.9    2.1   
PHALS_02128                                                           34.7    2.1   
PHALS_09475                                                           34.7    2.1   
PYIW_13113                                                            34.7    2.1   
PHYKE_134                                                             34.3    2.2   
PYVX_23586                                                            34.3    2.2   
PHYRA_78083                                                           34.7    2.2   
PHYCA_534275                                                          34.3    2.2   
PYAR_26118                                                            33.5    2.3   
PYAR_22168                                                            32.0    2.3   
H310_02575                                                            34.7    2.3   
PYVX_16402                                                            34.7    2.3   
PITG_16469                                                            34.3    2.4   
SDRG_11440                                                            33.9    2.4   
PYIW_17284                                                            34.3    2.4   
PPTG_14797                                                            34.3    2.4   
PITG_18962                                                            34.3    2.4   
SPRG_11405                                                            34.3    2.4   
PHYRA_80786                                                           34.3    2.5   
SDRG_06451                                                            34.7    2.5   
PPTG_06058                                                            34.3    2.5   
PYVX_16915                                                            34.7    2.5   
PHYRA_82951                                                           34.3    2.6   
PYVX_19355                                                            34.3    2.7   
PITG_10285                                                            34.3    2.8   
CCA27133                                                              33.5    2.8   
PYIW_22466                                                            34.3    2.8   
PHYSO_385187                                                          34.3    2.9   
SDRG_00740                                                            33.9    2.9   
SPRG_02648                                                            33.9    2.9   
SDRG_00203                                                            33.9    3.0   
PYVX_14860                                                            33.9    3.1   
PYAP_19165                                                            34.3    3.1   
SPRG_00931                                                            33.9    3.2   
PHYKE_6488                                                            33.5    3.3   
SDRG_01371                                                            33.9    3.3   
PYIW_19306                                                            33.9    3.5   
PYVX_17336                                                            33.9    3.5   
PHYSO_549695                                                          33.9    3.5   
PHYCA_537866                                                          33.1    3.6   
PYIW_20224                                                            33.5    3.6   
H257_04671                                                            33.1    3.6   
PYAR_24751                                                            33.5    3.6   
PYIW_15067                                                            33.9    3.7   
CCI45305                                                              33.9    3.7   
HYAP_01506                                                            32.7    3.8   
PITG_10028                                                            33.9    3.8   
PYVX_21870                                                            33.9    3.8   
PPTG_19688                                                            31.6    3.8   
PYAR_14432                                                            33.9    3.9   
PYVX_14310                                                            33.1    3.9   
PYU1_G003417                                                          33.5    4.0   
PYIR_18625                                                            33.5    4.0   
PHYSO_535714                                                          33.5    4.1   
PHYSO_360629                                                          33.5    4.1   
CCI40722                                                              33.9    4.1   
PYAP_21439                                                            33.5    4.2   
SDRG_10094                                                            33.1    4.2   
PYIW_17180                                                            33.9    4.2   
H257_03610                                                            33.5    4.3   
PYAP_18050                                                            33.5    4.3   
PYIR_13106                                                            33.5    4.4   
SPRG_07448                                                            33.1    4.4   
PHYCA_530572                                                          33.5    4.4   

>PHYRA_81674
Length=616

 Score = 1157 bits (2993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/595 (100%), Positives = 595/595 (100%), Gaps = 0/595 (0%)

Query  22   EQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFV  81
            EQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFV
Sbjct  22   EQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFV  81

Query  82   ISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW  141
            ISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW
Sbjct  82   ISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW  141

Query  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMF  201
            PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMF
Sbjct  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMF  201

Query  202  PQLRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLREL  261
            PQLRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLREL
Sbjct  202  PQLRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLREL  261

Query  262  LYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSN  321
            LYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSN
Sbjct  262  LYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSN  321

Query  322  TPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQ  381
            TPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQ
Sbjct  322  TPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQ  381

Query  382  KEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPR  441
            KEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPR
Sbjct  382  KEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPR  441

Query  442  FCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSNAAAFSL  501
            FCDFYICELDLTSQLSPSTLNLFRNELKKRTKQRKQKQRQQNATTPSSPIFKSNAAAFSL
Sbjct  442  FCDFYICELDLTSQLSPSTLNLFRNELKKRTKQRKQKQRQQNATTPSSPIFKSNAAAFSL  501

Query  502  EQEGMTWPSPYEQAIAESLEEFHLSNSELDSAAVSPDVESSFARVTENSGYFPALGGEPR  561
            EQEGMTWPSPYEQAIAESLEEFHLSNSELDSAAVSPDVESSFARVTENSGYFPALGGEPR
Sbjct  502  EQEGMTWPSPYEQAIAESLEEFHLSNSELDSAAVSPDVESSFARVTENSGYFPALGGEPR  561

Query  562  TPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkkgagkkgVSVFSTTQRRSYR  616
            TPVADPIAFGSPAAWGNASTSPPAAAWGSGKGGKKKGAGKKGVSVFSTTQRRSYR
Sbjct  562  TPVADPIAFGSPAAWGNASTSPPAAAWGSGKGGKKKGAGKKGVSVFSTTQRRSYR  616

>PHYSO_315018
Length=636

 Score = 946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/619 (83%), Positives = 541/619 (87%), Gaps = 28/619 (5%)

Query  22   EQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFV  81
            EQKKNMDYE RVTRNGVSANHLLNF++PERERHV+HHQKKKKSSAPRTQSEYLHANYRFV
Sbjct  22   EQKKNMDYEARVTRNGVSANHLLNFSMPERERHVHHHQKKKKSSAPRTQSEYLHANYRFV  81

Query  82   ISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW  141
            I+PL+PDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW
Sbjct  82   IAPLDPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW  141

Query  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMF  201
            PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL QLQ+PPHV  D  FQFLERPKSSMF
Sbjct  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQVPPHVGDDVAFQFLERPKSSMF  201

Query  202  PQLRALPSAE-------VEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEAT  254
            PQLR LP AE       +EATS SA+P P+A AFA+RKRSRKLP ++DVDATYSRILEAT
Sbjct  202  PQLRVLPPAEAKGDLAGIEATSHSALPSPDAPAFAKRKRSRKLPRVDDVDATYSRILEAT  261

Query  255  PAYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSH  314
            P YLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGS+H
Sbjct  262  PDYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSNH  321

Query  315  TYNM--NSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELE  372
              N   + +    K KPH+N  G+AYSFYQIA+GTYVVLHPLNMKCLL+EYSDEHQHELE
Sbjct  322  ANNAIGSGSATGVKGKPHQNEGGDAYSFYQIANGTYVVLHPLNMKCLLKEYSDEHQHELE  381

Query  373  GRHEEDARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKR  432
            G H +DA QKE+EAAWT     SASSE LP DRYHLLPE+I GRVLDIEHVVMDEE  KR
Sbjct  382  GDHGDDAHQKELEAAWT----PSASSEPLPVDRYHLLPEQIRGRVLDIEHVVMDEEAQKR  437

Query  433  YRFLSHLPRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIF  492
            YRFLSHLPRFCDFYICELDLTSQLSPSTLN FRN+LKKR KQRKQKQRQQNA +PSSPIF
Sbjct  438  YRFLSHLPRFCDFYICELDLTSQLSPSTLNSFRNDLKKRAKQRKQKQRQQNAPSPSSPIF  497

Query  493  KSNAAAFSLEQEGMTWPSPYEQAIAESLEEFHLSNS-------ELDSAAV-----SPDVE  540
            KSNAAAFSLEQEGM WPSPYEQA+AESLEEFHL+N+       E+ +AA      S DV 
Sbjct  498  KSNAAAFSLEQEGMMWPSPYEQALAESLEEFHLTNASSVEFEGEVHAAATPASPYSDDVG  557

Query  541  SSFARVTENSGYFPALGGEP---RTPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkk  597
             SFARVTENSGYFP LGG P   R  V DPIAFGSPAAWGN STSPPA AW SGKGGKKK
Sbjct  558  RSFARVTENSGYFPVLGGGPSETRAHVTDPIAFGSPAAWGNPSTSPPAVAWSSGKGGKKK  617

Query  598  gagkkgVSVFSTTQRRSYR  616
            GAGKKGVSVFSTTQRRSYR
Sbjct  618  GAGKKGVSVFSTTQRRSYR  636

>PHYCA_535379
Length=627

 Score = 937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/609 (79%), Positives = 519/609 (85%), Gaps = 17/609 (3%)

Query  22   EQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFV  81
            EQKK MDYE R TRNGVSANHLLNF++PERE+ VYHHQKKKKSSAPRTQ EYLHANYRFV
Sbjct  22   EQKKTMDYEARATRNGVSANHLLNFSMPEREKTVYHHQKKKKSSAPRTQIEYLHANYRFV  81

Query  82   ISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW  141
            I+PL+PDAVVPTWDLEALTEWSSVEQVLLWYD+ESPQTCPICMDTFRAPKITKCGH+FCW
Sbjct  82   IAPLDPDAVVPTWDLEALTEWSSVEQVLLWYDIESPQTCPICMDTFRAPKITKCGHVFCW  141

Query  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMF  201
            PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHV SD TFQFLERPKSSMF
Sbjct  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVGSDVTFQFLERPKSSMF  201

Query  202  PQLRALPSAEV-------EATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEAT  254
            PQLR LP  ++       EA+S S    PEA AFA RKRSRKLP++ D DATYSRILEAT
Sbjct  202  PQLRVLPPLDIKVERNATEASSNSTQSSPEAIAFAARKRSRKLPNVTDADATYSRILEAT  261

Query  255  PAYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSH  314
            P YLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDF+HGTYG++H
Sbjct  262  PGYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFTHGTYGANH  321

Query  315  TYNMNSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGR  374
            + N+ +N    K KP ++ SG+ YSFYQ+ADGTYVVLHPLNMKCLL+E+SD HQHE E  
Sbjct  322  S-NI-ANVAGKKGKPRDDNSGDLYSFYQLADGTYVVLHPLNMKCLLKEFSDTHQHEQEED  379

Query  375  HEEDARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYR  434
             +E A QKE+EAAWTQE +SSA SE LP DRY LLPE+IHGRVLDIEHVVMDEE  KRYR
Sbjct  380  SQELAHQKELEAAWTQEGSSSAGSEPLPVDRYQLLPEQIHGRVLDIEHVVMDEEAQKRYR  439

Query  435  FLSHLPRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKS  494
            FLSHLPRFCDFY+CELDLTSQLS STLN FRN+LKKRTKQRK K +QQ+  TPSSPIFK 
Sbjct  440  FLSHLPRFCDFYVCELDLTSQLSQSTLNAFRNDLKKRTKQRKLKMKQQSTPTPSSPIFKR  499

Query  495  NAAAFSLEQEGMTWPSPYEQAIAESLEEFHLSNS-------ELDSAAVSPDVESSFARVT  547
            NA AFSLE+EGM WPSPYEQA+AESLEEFHLSNS       EL + + S D E SFARVT
Sbjct  500  NADAFSLEEEGMMWPSPYEQALAESLEEFHLSNSSSLELEAELHAVSSSTDEERSFARVT  559

Query  548  ENSGYFPALGGEPRTPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkkgagkkgVSVF  607
            ENSGYFPALGG   +   DPIAFGSP+AWGN STSPP     +   G KK AGKKGVSVF
Sbjct  560  ENSGYFPALGGVGPSESRDPIAFGSPSAWGNPSTSPP-VTAWNSGKGGKKKAGKKGVSVF  618

Query  608  STTQRRSYR  616
            STTQRRSYR
Sbjct  619  STTQRRSYR  627

>PPTG_09251
Length=641

 Score = 930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/608 (80%), Positives = 525/608 (86%), Gaps = 24/608 (4%)

Query  23   QKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVI  82
            QKK MDYE RVTRNGVSANHLLNF++PERERHVYHHQKKKKSSAPRTQSEYLHANYRFVI
Sbjct  44   QKKTMDYEARVTRNGVSANHLLNFSMPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVI  103

Query  83   SPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWP  142
            +PL+ D +VPTWDLEALTEWSSVEQ+LLWYDVESPQTCPICMDTFRAPKITKCGHIFCWP
Sbjct  104  APLDHDTIVPTWDLEALTEWSSVEQILLWYDVESPQTCPICMDTFRAPKITKCGHIFCWP  163

Query  143  CILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFP  202
            CILRYLSMTDKYWRRCPMCFESVQKGHLR+VQL QLQIPPHV SD TFQFLERPKSSMFP
Sbjct  164  CILRYLSMTDKYWRRCPMCFESVQKGHLRNVQLQQLQIPPHVGSDVTFQFLERPKSSMFP  223

Query  203  QLRALPS-------AEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATP  255
            QLR LP+       AE +A+S S    PEA AFA RKRSRKLP++NDVDA YSRILEATP
Sbjct  224  QLRVLPTAESKGEHAETDASSHSTQSTPEAVAFAARKRSRKLPNVNDVDAIYSRILEATP  283

Query  256  AYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHT  315
             YLRELLYSEMRDLQSMD EFRSSGDVD+LPFVEEAMRNTSGRLAKSDDFSHGTY  +++
Sbjct  284  EYLRELLYSEMRDLQSMDTEFRSSGDVDSLPFVEEAMRNTSGRLAKSDDFSHGTYRQANS  343

Query  316  YNMNSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRH  375
               +++T   K  P EN SG+AYSFYQIADGTYVVLHPLNMKCLL+EYSDEHQHE E  H
Sbjct  344  --ASNSTAGKKSTPKENGSGDAYSFYQIADGTYVVLHPLNMKCLLKEYSDEHQHEQE--H  399

Query  376  EEDARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRF  435
             EDA    +EAAW +  +SSAS+E LP DRYHLLPERIHG+VLDIEHVVMDEE  KRYRF
Sbjct  400  GEDA---HLEAAWIE--SSSASAEPLPVDRYHLLPERIHGKVLDIEHVVMDEEAQKRYRF  454

Query  436  LSHLPRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSN  495
            LSHLPRFCDFYICELDLTSQLS STLN FRN+L K+  ++++ + +QNA  PSSPIFK N
Sbjct  455  LSHLPRFCDFYICELDLTSQLSSSTLNTFRNDL-KKRAKQRKHKHKQNAPIPSSPIFKRN  513

Query  496  AAAFSLEQEGMTWPSPYEQAIAESLEEFHLSNS--ELDSAAVS-PDVESSFARVTENSGY  552
            A AFSL++EGM WPSPYEQA+AESLEEFHLSNS  ELD+   S  D E SFARVTENSGY
Sbjct  514  ADAFSLQEEGMMWPSPYEQALAESLEEFHLSNSSVELDAEHHSAADEERSFARVTENSGY  573

Query  553  FPALGG----EPRTPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkkgagkkgVSVFS  608
            FPALGG    EPR  V DPIAFGSP+AWGNASTSPPA AW SGKGGKKKGAGKKGVSVFS
Sbjct  574  FPALGGAAAREPRPHVTDPIAFGSPSAWGNASTSPPAVAWSSGKGGKKKGAGKKGVSVFS  633

Query  609  TTQRRSYR  616
            TTQRRSYR
Sbjct  634  TTQRRSYR  641

>PITG_13738
Length=610

 Score = 857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/605 (74%), Positives = 499/605 (82%), Gaps = 27/605 (4%)

Query  22   EQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFV  81
            EQKKNMDYE RVTRNGVSANHLLNF++PERER V+HHQKK KSS PRTQSEYLHANYRFV
Sbjct  23   EQKKNMDYEARVTRNGVSANHLLNFSMPERERQVHHHQKKTKSSTPRTQSEYLHANYRFV  82

Query  82   ISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW  141
            I+PL+ D +VPTWDLEALTEWSSVEQVLLWYDV SPQTCPICMDTFRAPKITKCG     
Sbjct  83   IAPLDRDTIVPTWDLEALTEWSSVEQVLLWYDVGSPQTCPICMDTFRAPKITKCGPP--G  140

Query  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMF  201
            PCILRYLSM++KYWRRCPMCFESVQKGHLRSVQL QLQIPPHV SD TFQFLERPKSSMF
Sbjct  141  PCILRYLSMSEKYWRRCPMCFESVQKGHLRSVQLQQLQIPPHVSSDVTFQFLERPKSSMF  200

Query  202  PQLRALPSAEVE----ATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAY  257
            PQLR LP+AE +    A+S +    PEA+AFA RKRSRKLP+++D DA YSRILEAT  Y
Sbjct  201  PQLRVLPTAEDKSEHAASSHATQSSPEAAAFAARKRSRKLPNVDDADAIYSRILEATLEY  260

Query  258  LRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYN  317
            LRELLYSEMRDLQSMD EFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTY  +++  
Sbjct  261  LRELLYSEMRDLQSMDTEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYRQANS--  318

Query  318  MNSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEE  377
             N++T   K  P ++ SG+ YSFYQIADGTYVVLHPLNMKCL++EYSDEHQ      H E
Sbjct  319  TNNSTTGKKNTPKDSDSGDTYSFYQIADGTYVVLHPLNMKCLMKEYSDEHQE-----HGE  373

Query  378  DARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLS  437
            D +      AWT+ +  S SSELLP DRY +LPERIHG++LDIEHVV+DEE  KRYRFLS
Sbjct  374  DTQL----TAWTESS--SVSSELLPVDRYRMLPERIHGKILDIEHVVLDEEAQKRYRFLS  427

Query  438  HLPRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSNAA  497
            HLPRFCDFYICELDLTS LS STLN FRN+L K+  ++++ + +Q+A TP+SPIFK NA 
Sbjct  428  HLPRFCDFYICELDLTSHLSSSTLNAFRNDL-KKRAKQRKHKHKQSAPTPASPIFKRNAD  486

Query  498  AFSLEQEGMTWPSPYEQAIAESLEEFHLSNS--ELDSAAVSPDVESSFARVTENSGYFPA  555
            AFS+EQEGM WPSPYEQA+AESLEEF+LSN+  EL++     D E SFARVTENSGYFPA
Sbjct  487  AFSIEQEGMMWPSPYEQALAESLEEFNLSNTSVELEAEHTEADEEQSFARVTENSGYFPA  546

Query  556  LGG----EPRTPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkkgagkkgVSVFSTTQ  611
            LGG    EPR  V DPIAFGSP+AWGN STSPP A       G KK AGKKGVSVFSTTQ
Sbjct  547  LGGAAPIEPRPHVTDPIAFGSPSAWGNTSTSPP-AVAWGSGKGAKKKAGKKGVSVFSTTQ  605

Query  612  RRSYR  616
            RRSYR
Sbjct  606  RRSYR  610

>PHALS_11563
Length=613

 Score = 751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/610 (66%), Positives = 466/610 (76%), Gaps = 33/610 (5%)

Query  22   EQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFV  81
            EQ KNM++E RVTRNGVSANHLLNF+LPERE    +H KKKKSSAPRTQ EYLHANYRFV
Sbjct  22   EQNKNMNHEARVTRNGVSANHLLNFSLPEREHLAKYHHKKKKSSAPRTQIEYLHANYRFV  81

Query  82   ISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW  141
            I+PL+P+ +VPTWD+E+LTEWS VEQVLLWYD  +PQTCPICMD+FR PKITKCGHIFCW
Sbjct  82   IAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCW  141

Query  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMF  201
            PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL QLQIPP V SD TFQFLERPKS +F
Sbjct  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIF  201

Query  202  PQLRALPSAEV--EATSRSAIP--PPEASAFAERKRSRKLPSINDVDATYSRILEATPAY  257
            PQLR LPS ++  + T  SA      EA+ FA RKR+RKLP++ND DATYSRILEATP Y
Sbjct  202  PQLRVLPSTQLTDDCTESSAFTHSSSEAATFAARKRTRKLPNVNDADATYSRILEATPEY  261

Query  258  LRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYN  317
            LRELL +EMR LQSMDAEF+SSGDVDNLPFV EAMRNTS RL+ SDD S GTYG   T  
Sbjct  262  LRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYGKPVT-T  320

Query  318  MNSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEE  377
              S+  +   KP E+ + + YSFYQIA+GTYV+LHPLNMKCLL+EY+DE +H       E
Sbjct  321  FASDQSI---KPLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEH-------E  370

Query  378  DARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLS  437
            +A + +ME+ WT E  S A+S   PA+RYHL+PE++HGRVLDIEH +MDEE  KR+RFLS
Sbjct  371  NAVEVKMESTWTTET-SCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLS  429

Query  438  HLPRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSNAA  497
            HLPRFCDFYICELDL+SQLS STL+ F+N+LKKR KQR+ K +  N  T SSP++KS   
Sbjct  430  HLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSSPMYKSKVQ  489

Query  498  AFSLEQEGMTWPSPYEQAIAESLEEFHLSNS-------ELDSAAVSPDVESSFARVTENS  550
             FSL+ E   WPSPYEQ +AES+E+FHLS+S       E ++     D E SFAR+TENS
Sbjct  490  TFSLQHENTHWPSPYEQTLAESVEDFHLSSSFASDLLTEDETTTSFEDDERSFARITENS  549

Query  551  GYFPALGGEP----RTPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkkgagkkgVSV  606
            GYFPALG  P    R P  +  A GS   WGN  +S           G KK  GKKG+SV
Sbjct  550  GYFPALGDAPSNESRHPSENSTASGSSHPWGNTISS------NVAGRGSKKKGGKKGISV  603

Query  607  FSTTQRRSYR  616
            FSTTQRRSYR
Sbjct  604  FSTTQRRSYR  613

>PYU1_G005962
Length=624

 Score = 613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/622 (53%), Positives = 432/622 (69%), Gaps = 48/622 (8%)

Query  25   KNMDYEERVT-RNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVIS  83
            + +DYE R   RNGVSANHLLNF+LPERE+ VY   KKKK++  RTQ+EYLHANYRFV++
Sbjct  21   RTLDYEIRTGGRNGVSANHLLNFSLPEREKQVY--VKKKKNAPMRTQNEYLHANYRFVVA  78

Query  84   PLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPC  143
            PL  DA  P WD+EALTEW +VEQVLLWYD  SP +CPIC+D FRAPKITKCGHIFCWPC
Sbjct  79   PLSNDANTPFWDMEALTEWKNVEQVLLWYDEASPASCPICLDDFRAPKITKCGHIFCWPC  138

Query  144  ILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFPQ  203
            ILRYLS++DKYWRRCPMCFESVQKG LRSV+L ++ +PP V+SDATFQFL+R KSS FP 
Sbjct  139  ILRYLSLSDKYWRRCPMCFESVQKGQLRSVRLDKVSLPPRVNSDATFQFLQRSKSSYFPH  198

Query  204  LRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLY  263
            LR+    ++     SA+          +KR+RKLPS+ D  ATYSRILE++  YL +LL 
Sbjct  199  LRSDSKHDLNDLDASAL------GGGNKKRARKLPSVYDPAATYSRILESSQEYLTQLLL  252

Query  264  SEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSNTP  323
             EMRDL+++DAEFRSSGDVD+LPFVEEAMR TSGRLA++D       GS  +  ++S   
Sbjct  253  DEMRDLEALDAEFRSSGDVDSLPFVEEAMRATSGRLAQND-------GSQQS--VSSGYE  303

Query  324  VAKEKPHENASG----EAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDA  379
             A E     +SG      YSFYQ+++G YVVLHPLNMKCL++EY++  + E +  H+   
Sbjct  304  AANEYEAGASSGGEDENVYSFYQLSNGIYVVLHPLNMKCLMKEYAEPKRKERDADHDHKD  363

Query  380  RQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHL  439
                + AAW    + S+SSEL    RY LLP  I GR+LD+EHVVMDEE+ KRYRFLSHL
Sbjct  364  PDDVVSAAWADATSPSSSSELSTGPRYDLLPNTIRGRILDVEHVVMDEEMQKRYRFLSHL  423

Query  440  PRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSNAAAF  499
            PRFCDFY+CELDL+ QLSP TL+ FR E+ K+ +++++++++  A + +SP++K   A F
Sbjct  424  PRFCDFYLCELDLSGQLSPETLDAFRGEI-KKREKQRKQRQRSKARSANSPVYKGALAGF  482

Query  500  SLEQEGMTWPSPYEQAIAESLEEF-----------HLSNSELDSAAVSP--------DVE  540
            S+EQEGM+WP+P E +++++ +E             L+ +++ S + SP        D E
Sbjct  483  SIEQEGMSWPAPAEMSLSDAFQEGVNLNGTYDEGDDLAAAQIASTSTSPPSPYYPAYDAE  542

Query  541  SSFARVTENSGYFPALGGEPRTPVADPIAFGSPAAWGNASTSPP------aaawgsgkgg  594
             SFA +T  SGY+P L     +   +     SP+ WG AS+ PP       +   +   G
Sbjct  543  GSFATITRQSGYYPPLSRVTNSEAGEAAHTQSPSVWGAASSPPPLFDLDLDSLPRTKGKG  602

Query  595  kkkgagkkgVSVFSTTQRRSYR  616
            KK GAGKKGV++FST+Q+RSYR
Sbjct  603  KKGGAGKKGVALFSTSQQRSYR  624

>PYIW_14754
Length=616

 Score = 586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/622 (54%), Positives = 423/622 (68%), Gaps = 56/622 (9%)

Query  25   KNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVISP  84
            + +D+E R TRNGVSANHLLNF+LPERE+      KKKKS   RTQ+E+L AN+RFV++P
Sbjct  21   RALDHEIRSTRNGVSANHLLNFSLPEREKQQVF-AKKKKSGPMRTQNEFLQANFRFVVAP  79

Query  85   LEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCI  144
            LE D   P WD+EALTEW +VEQVLLW+D  SP +CPIC+D FRAPKITKCGHIFCWPCI
Sbjct  80   LEDDVNTPVWDMEALTEWKNVEQVLLWHDEASPMSCPICLDDFRAPKITKCGHIFCWPCI  139

Query  145  LRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFPQL  204
            LRYLS+T+KYWRRCPMCF++VQKG LRSV+L ++ +PP VDSDATFQFL+R KSS FP +
Sbjct  140  LRYLSLTEKYWRRCPMCFDAVQKGQLRSVRLEKVNLPPRVDSDATFQFLQRNKSSFFPHM  199

Query  205  RALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLYS  264
             A   +  E                  KR RKLPS+ D  AT+SRILEAT  YL  +L  
Sbjct  200  PAFAGSSSENM----------------KRVRKLPSVYDPAATFSRILEATQEYLTHILLD  243

Query  265  EMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSNTP-  323
            EMRDLQ++DAEFRSSGDVD+LPFV+EAMR TSGRLA +D       G S   N   +TP 
Sbjct  244  EMRDLQALDAEFRSSGDVDSLPFVDEAMRATSGRLAHNDGGEQ--QGGSPPEN---DTPR  298

Query  324  -VAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQK  382
                +   +++S E YSFYQ A+G YVVLHPLNMKCLL+E+++    ++E     D    
Sbjct  299  RGGGKAATDSSSSEVYSFYQQANGIYVVLHPLNMKCLLKEFAEPKPKDVEELEVRD----  354

Query  383  EMEAAWTQEANSSASSEL---LPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHL  439
            E+ A W + ++ +++S     +   RY LLPERIHGRVL+IEHVVMD+E+ KRYRFLSH+
Sbjct  355  EVSAIWAEASSLASASTSEIPVAGVRYDLLPERIHGRVLEIEHVVMDDEMQKRYRFLSHM  414

Query  440  PRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSNAAAF  499
            PRFCDFY+CELDL+  LSP+T++ FR E+KKR +QRKQKQR ++    SSPI+K   + F
Sbjct  415  PRFCDFYLCELDLSELLSPATVSAFRGEIKKRERQRKQKQRSKDKPVNSSPIYKGALSGF  474

Query  500  SLEQEGMTWPSPYEQAIAESLEE---FHLSNS--ELDSAAV----SPDV-------ESSF  543
            SLEQEGM WP+P E +++++ EE    H + +  E +S AV    SP         E SF
Sbjct  475  SLEQEGMAWPAPAEMSLSDAFEESLSLHENGAAGEANSRAVIESTSPQSPYFGSSDEGSF  534

Query  544  ARVTENSGYFPALGGEPRTPVADPIAFG----SPAAWGNASTSPP-----aaawgsgkgg  594
            A +T  SGY+P L     +      AFG    SP AWG  ++ PP       +      G
Sbjct  535  ATITRQSGYYPPLSRAASSDTNTRPAFGDYAQSPLAWGVTASPPPLFDLDLDSLLRKGKG  594

Query  595  kkkgagkkgVSVFSTTQRRSYR  616
             KKG+GKKGVS+FST+Q+RSYR
Sbjct  595  GKKGSGKKGVSLFSTSQQRSYR  616

>PYIR_15178
Length=638

 Score = 582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/632 (54%), Positives = 426/632 (67%), Gaps = 54/632 (9%)

Query  25   KNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVISP  84
            + +DYE R TRNGVSANHLLNF+LPERE+ V+   KKKK+   RTQ+E+LHAN+RFVI+P
Sbjct  21   RALDYEIRSTRNGVSANHLLNFSLPEREKQVF--TKKKKAGPTRTQNEFLHANFRFVIAP  78

Query  85   LEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIF-----  139
            LE DA  P WD+EALTEW+SVEQVLLWYD  SP +CPIC+D FRAPKITKCGHIF     
Sbjct  79   LEDDASTPFWDMEALTEWTSVEQVLLWYDEASPMSCPICLDDFRAPKITKCGHIFWCERR  138

Query  140  ---CWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERP  196
                WPCILRYLS+T+KYWRRCPMCF+SVQKG LRSV+L ++ +PP VDSDATFQFL+R 
Sbjct  139  SSTLWPCILRYLSLTEKYWRRCPMCFDSVQKGQLRSVRLEKVDLPPRVDSDATFQFLQRS  198

Query  197  KSSMFPQLRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPA  256
            KSS FP L   P A+   +  +      AS    +KR RKLPS+ D  ATYSRILE+   
Sbjct  199  KSSFFPHL---PIAQQHGSPAAGAGNGGAS---NKKRVRKLPSVYDPAATYSRILESNRE  252

Query  257  YLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTY  316
            YL  +L  EMRDL+++DAEF SSGDVD+LPFVEEAMR TSGRLA+     +G+       
Sbjct  253  YLTHILMDEMRDLEALDAEFHSSGDVDSLPFVEEAMRATSGRLAQ-----NGSGKGQGPP  307

Query  317  NMNSNTPVAKEKPHENASG-EAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRH  375
            + ++N   A     +  SG E YSFYQ+A+G YVVLHPLNMKCLL+E+++    E +   
Sbjct  308  DNDTNRSGAMTSGSKADSGSEVYSFYQLANGIYVVLHPLNMKCLLKEFAEPKPKEEDEVQ  367

Query  376  EEDARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRF  435
            E D        A +  + SS+ +  +   RY LLPERIHGRVLD+EHVVMD+E+ KRYRF
Sbjct  368  ERDEVNAAWAEASSLSSASSSDTPAVGV-RYDLLPERIHGRVLDVEHVVMDDEMQKRYRF  426

Query  436  LSHLPRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSN  495
            LSHLP+FCDFY+CELDL+  LSP+TL  FR E+KKR +QRKQKQ+ + + + +SPI+K  
Sbjct  427  LSHLPKFCDFYLCELDLSEFLSPATLGAFRGEIKKRERQRKQKQKSKQSKSANSPIYKGA  486

Query  496  AAAFSLEQEGMTWPSPYEQAIAESLEEF-----HLSNSELDS-----AAVSPDV------  539
             + FSLEQEGM WP+P E +++++ EE      H +  E D       + SP        
Sbjct  487  MSGFSLEQEGMAWPAPAEMSLSDAFEESVSLNDHHNGGEHDHHHANLESTSPQSPYFGSY  546

Query  540  -ESSFARVTENSGYFPAL-------GGEPRTPVA--DPIAFGSPAAWGNASTSPPaaawg  589
             ESSFA +T  SGY+P L        G P +  A     A GSP+AWG  S+ PP     
Sbjct  547  DESSFATITRQSGYYPPLSRAGSSDSGAPTSAAAAFGDYARGSPSAWGVTSSPPPLFDLD  606

Query  590  sgk-----ggkkkgagkkgVSVFSTTQRRSYR  616
                     G KKG+GKKGVS+FST+Q+RSYR
Sbjct  607  LDSLPRKGKGGKKGSGKKGVSLFSTSQQRSYR  638

>PYVX_20858
Length=621

 Score = 581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/617 (54%), Positives = 416/617 (67%), Gaps = 59/617 (10%)

Query  24   KKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVIS  83
            KKN+D++ R +RNGVSANHLLNFTLPERE+  +  +KKK    PRTQSE+LHAN+RFVIS
Sbjct  40   KKNLDFDARSSRNGVSANHLLNFTLPEREKPTFA-RKKKTHVQPRTQSEFLHANFRFVIS  98

Query  84   PLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPC  143
             LE    VP  DLEALTEW+SVEQVLLWYD +SP TCPICMD FRAPKITKCGHIFCWPC
Sbjct  99   QLEDRTAVPLGDLEALTEWTSVEQVLLWYDDDSPMTCPICMDNFRAPKITKCGHIFCWPC  158

Query  144  ILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFPQ  203
            ILRYLS++DKYWRRCPMCFESVQKG LRSV+L ++++PP V S+  FQFL+R K+SMFP 
Sbjct  159  ILRYLSLSDKYWRRCPMCFESVQKGQLRSVRLEKVELPPRVGSEVEFQFLQRSKASMFPT  218

Query  204  LRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLY  263
            L            R +  P  A A +    +  +PSI D  A +SRILE+TP Y+ +L+ 
Sbjct  219  L------------RQSATPALAHAASVTNANDCVPSIYDSAAAFSRILESTPEYVMQLVL  266

Query  264  SEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSNTP  323
            +EMRDL+++DAE RSSG+VD+LPFV EAMR TSGRLA+ +  SHG   S   +       
Sbjct  267  AEMRDLEALDAEHRSSGEVDSLPFVVEAMRATSGRLAQLESSSHGDRDSDDDHV------  320

Query  324  VAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQKE  383
                     A+GE YSFYQIA+G+YV+LHP+NMKCLL+EYS E++ E            +
Sbjct  321  -------RVATGELYSFYQIANGSYVILHPINMKCLLKEYSPENRVE-----AAPPSNDQ  368

Query  384  MEAAWTQEANSSASSE-LLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRF  442
            +  AW+    ++  S  +LP DR+H +P+ + GRVLD+EHVVMD+E  KRYRFLSHLPRF
Sbjct  369  VAEAWSDTGGTAPESHPVLPVDRHHFMPDTVRGRVLDVEHVVMDDESQKRYRFLSHLPRF  428

Query  443  CDFYICELDLTSQLSPSTLNLFRNELkkrtk---qrkqkqrqqNATTPSSPIFKSNAAAF  499
            CD Y+CE+DL++QLS +TL  FR ELKKR K      + +  + A   +SP+F S    F
Sbjct  429  CDLYVCEIDLSAQLSAATLECFRAELKKREKHRRAEAKHRHAEAAARAASPLFASRMDGF  488

Query  500  SLEQEGMTWPSP-------YEQAIAES--LEEFHLSNSELDSAAVSPDVESSFARVTENS  550
            S+EQEGM WP+P       +E ++ ES   +E HLS        ++ D ESSFA +T  S
Sbjct  489  SIEQEGMMWPAPAELSSEMHELSLDESGGSDEAHLSPVSPPLTTLATDDESSFATITRQS  548

Query  551  GYFPALGGEPRTPVADPIAFGSP---------AAWG-NASTSPPaaa-wgsgkggkkkga  599
            GYFP LGG    P     + G+          +AWG + STSPPA     +G+GGKKK  
Sbjct  549  GYFPPLGG----PAHHSPSLGAAPSSGSFGSPSAWGAHPSTSPPALDWDAAGRGGKKKAG  604

Query  600  gkkgVSVFSTTQRRSYR  616
            GKKGV +FSTTQRRSYR
Sbjct  605  GKKGVPLFSTTQRRSYR  621

>PYAR_23206
Length=600

 Score = 517 bits (1331),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 312/629 (50%), Positives = 390/629 (62%), Gaps = 84/629 (13%)

Query  32   RVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVISPLEPDAVV  91
            R+TRNG+SANHLLNFTLPERE++     KKKK+++ RTQ EYLHANYRFVI+PL  D  V
Sbjct  12   RMTRNGLSANHLLNFTLPEREKYA-PQGKKKKAASVRTQMEYLHANYRFVIAPLSNDDAV  70

Query  92   PTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIF-C--WPCILRYL  148
              WD+E LTEW SVEQVLLWYD  SP TCPIC+D+FRAPKIT+CGHIF C  WPCILRYL
Sbjct  71   ACWDIETLTEWKSVEQVLLWYDESSPATCPICLDSFRAPKITRCGHIFWCVFWPCILRYL  130

Query  149  SMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFPQLRALP  208
            SMTDKYWRRCPMCF++VQKG LRSVQL  +Q+PP VD+   FQFL RPK+S+ P +R  P
Sbjct  131  SMTDKYWRRCPMCFDAVQKGQLRSVQLQSVQLPPRVDATTQFQFLRRPKASLSPFVRG-P  189

Query  209  SAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLYSEMRD  268
            S++                  E++  RKLP++ D +A Y+RILE+T  YL  L   EMRD
Sbjct  190  SSK------------------EKRVVRKLPTVYDEEAKYARILESTHEYLLHLAMDEMRD  231

Query  269  LQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSNTPVAKEK  328
            L+ +DAE RSSGD D LPFVEEAM+ TS RLA ++                +N PV  E 
Sbjct  232  LEVLDAECRSSGDADTLPFVEEAMKATSQRLAAAE----------------ANQPVTAES  275

Query  329  PHENAS---------GEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDA  379
               ++           + YSFYQ  +G YVVLHPLNMKCL RE++++ Q   E   E  A
Sbjct  276  ELSSSKFQSLDGLGVSDMYSFYQQQNGCYVVLHPLNMKCLTREFAEKVQPSAEADEETQA  335

Query  380  R-QKEMEAAWTQEANSSASSELLP---ADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRF  435
                 +E AWT  A+   SS   P   +  Y LLP+ I GRVLD+EH+VMD+ V KRYRF
Sbjct  336  SATTTLEDAWTGAASPPLSSRAEPSVHSPHYELLPDTIEGRVLDVEHLVMDDAVQKRYRF  395

Query  436  LSHLPRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSN  495
            L HLP+FCDFY+CELDL+  LS  TL  FR ELKKR KQR+ K      +   +    +N
Sbjct  396  LGHLPKFCDFYVCELDLSPLLSRETLEAFRPELKKREKQRRLKNNADKKSNSGNNSKHAN  455

Query  496  AAA------------------FSLEQEGMTWPSPYEQ-AIAESLE---EFHLSNSELDSA  533
             +A                  FSLE     WP+P E  ++A++ +   +F   ++   + 
Sbjct  456  GSAMSRATLAVHYGDHPTLRGFSLEDGEAHWPAPSEMPSLADAFQDGLQFSSDSASSFTD  515

Query  534  AVSPDVESSFARVTENSGYFPALGGE----PRTPVADPIAFGSPAA--WGNASTSPPaaa  587
             V  D ++SFA +T NSGY+P LGG     PR   + P  +GS      G+ + SPP   
Sbjct  516  QVPADSDASFATITRNSGYYPPLGGSASGAPRDVTSSPSMWGSSTGPLSGSGAASPP---  572

Query  588  wgsgkggkkkgagkkgVSVFSTTQRRSYR  616
              +  GGKKKGA KKG  +FSTTQRRSYR
Sbjct  573  -MAPGGGKKKGAMKKGTPLFSTTQRRSYR  600

>HYAP_08501
Length=352

 Score = 381 bits (978),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 226/363 (62%), Positives = 268/363 (74%), Gaps = 23/363 (6%)

Query  266  MRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSNTPVA  325
            MRDLQSMDAEFRSSGD++NLPFVEEA++ TS RLAKS D        S T       P  
Sbjct  1    MRDLQSMDAEFRSSGDIENLPFVEEALQCTSERLAKSADARKNETHRSIT------IPRV  54

Query  326  KEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQKEME  385
            K +  E  SG+AYSFYQIA+GTYV+LHPLN+KCLL+E+SD+ Q + +G    DA + ++E
Sbjct  55   KGELEEGGSGDAYSFYQIANGTYVILHPLNVKCLLKEFSDQKQPQQQGESINDAHKTDLE  114

Query  386  AAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRFCDF  445
            A W QE    ASSE +  +RYHLLPERI GRVLDIEH+VM++E LKRYRFLSHLPRFCDF
Sbjct  115  AVWIQEV---ASSETIRPNRYHLLPERISGRVLDIEHMVMNDEALKRYRFLSHLPRFCDF  171

Query  446  YICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSNAAAFSLEQEG  505
            YICELDLTSQLSP TLN F+NELKKR+KQRKQK +  +ATTP SPI K +A+AFSLEQEG
Sbjct  172  YICELDLTSQLSPPTLNAFQNELKKRSKQRKQKLKLHSATTPLSPIAKRDASAFSLEQEG  231

Query  506  MTWPSPYEQAIAESLEEFHLSNSELDS--------AAVSPDVESSFARVTENSGYFPALG  557
              WPSPYEQA+ ES+E+  L    LD+        A+V  + + SF RVTENSG FPALG
Sbjct  232  TMWPSPYEQALIESMEDIALDEFSLDTAEQESQSYASVVEEEQQSFERVTENSGLFPALG  291

Query  558  G----EPRTPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkkgagkkgVSVFSTTQRR  613
            G    + R   ++ I FGSP+AWG+AS+SPP  A     G KKKGAGKKGVS+FSTTQRR
Sbjct  292  GASTSDARPFGSNSIVFGSPSAWGSASSSPP--AVAWTPGKKKKGAGKKGVSLFSTTQRR  349

Query  614  SYR  616
            SYR
Sbjct  350  SYR  352

>CCA15905
Length=620

 Score = 367 bits (942),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 241/639 (38%), Positives = 341/639 (53%), Gaps = 105/639 (16%)

Query  32   RVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANY-------------  78
            R TR GV AN+LLNF+LPER+   +  +  KK+   RTQ E+LHA Y             
Sbjct  33   RWTRRGVPANYLLNFSLPERQNSFHAGRYGKKALVTRTQKEFLHAKYTKRTSQHMIVIKF  92

Query  79   ----RFVISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITK  134
                RF+I  L  D       LE L EW +VEQV +W   + P  CPIC+D FR P+ T+
Sbjct  93   LCSFRFIIGALRRDESHRL--LEDLVEWKNVEQVKVWQKAKFPMQCPICLDEFRLPRTTR  150

Query  135  CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLE  194
            CGHIFCW CIL YLS++DKYWRRCPMCFE V+K HLR+V++  +  PP V S A F+FL+
Sbjct  151  CGHIFCWTCILHYLSLSDKYWRRCPMCFECVEKIHLRAVEIESVVSPPVVGSIAKFKFLQ  210

Query  195  RPKSSMFPQLRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEAT  254
            R K  +             ATS   I   +AS   +++    +PS+ D ++ +SR+++AT
Sbjct  211  RSKLDV-------------ATSYQPIDHSKAS---KKRFLPTIPSVYDPNSRFSRVMQAT  254

Query  255  PAYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRL------AKSDDFS--  306
              YL +LL S+++ L+S+    RS G+++ LPF+E A+ +T+ RL         D+ +  
Sbjct  255  NEYLIQLLDSDLQQLRSLADGLRSCGELNELPFIEGAILHTTSRLDSIKIVVDDDELTKM  314

Query  307  -----HGTYGSSHTYNMNSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLR  361
                 +GT G S+++                     YSFYQ+ +GTYV+LHP+NMKCLL+
Sbjct  315  QMEELNGTEGRSNSF---------------------YSFYQLENGTYVILHPVNMKCLLK  353

Query  362  EYSDEHQHELEGRHEEDARQKEM------------EAAWTQEANSSASSELLPADRYHLL  409
            E   +     E R++   R  E+            EAA T  ++ S +S+     ++  L
Sbjct  354  EALLQS----EKRNKTSHRNGEVDDLSDSSVNLPSEAAET--SSMSVTSDGGSCTQHDAL  407

Query  410  PERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRFCDFYICELDLTSQLSPSTLNLFRNELk  469
            P+ + G VL +EH VMD+E  +RYRFLSHLP++CDFY+CELDL+  LS  TL+  + EL+
Sbjct  408  PDYVQGEVLSVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLHSLKKELE  467

Query  470  krtkqrkqkqrqqNATTPSSPIFKSNAAAFSLEQEGMTWPSPYEQA------IAESLEEF  523
             R +QR  KQ+  +     + I  ++    ++  +     SP E        + E   E 
Sbjct  468  SRRRQRAAKQKLLDEQLDDNEIVHASPNCTNISSDATPSISPREGVEPEPSNLVEEFVEL  527

Query  524  HLSNSELDSAAVSPDVESSFARVTENSGYFPALGGEPRTPVADPIAFG---SPAAWGN--  578
            HL NS +D A  S +  SS+A VT NSGYFPAL G     +      G   + A WG   
Sbjct  528  HLQNSRIDQA--SDESSSSYATVTRNSGYFPALEGR----IVQASVSGHEEANAPWGRNR  581

Query  579  -ASTSPPaaawgsgkggkkkgagkkgVSVFSTTQRRSYR  616
              +      A       + KG  K    VFST+QRRSYR
Sbjct  582  EGTNEVFGHAASETGNKRTKGRKKNSKEVFSTSQRRSYR  620

>PYAP_22843
Length=472

 Score = 354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 220/509 (43%), Positives = 292/509 (57%), Gaps = 79/509 (16%)

Query  150  MTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFPQLRALPS  209
            MTDKYWRRCPMCFESVQKG LRSV+L  + +PP +DS ATFQFL+RPK+S+FP +     
Sbjct  1    MTDKYWRRCPMCFESVQKGQLRSVRLESVHLPPQLDSQATFQFLQRPKASLFPHIH----  56

Query  210  AEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLYSEMRDL  269
               ++T             A RKR RKLP++ D +A Y+RILE+T  Y+ +L  SEMRDL
Sbjct  57   ---DST---------GGPMAPRKRVRKLPTVYDEEAKYARILESTKEYVVQLALSEMRDL  104

Query  270  QSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSNTPVAKEKP  329
            +++DAE RSSGD+D LPFVEEAM+ TSGRLA  D  +  T  ++   + +          
Sbjct  105  EALDAECRSSGDIDTLPFVEEAMKATSGRLAGYDAMTDNTQSANGFQSFDG---------  155

Query  330  HENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQKEMEAAWT  389
               A+G+ YSFYQ+ +G YVVLHPLN+KCL +E++++   +     E+     ++ AAW 
Sbjct  156  --LATGDLYSFYQLQNGCYVVLHPLNVKCLTKEFAEKKDRKPSVDSED-----QITAAWA  208

Query  390  QEANSSASSEL----LPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRFCDF  445
              ++   S         A  Y LLP  I GRVLD+EH+VMD++V KRYRFL HLP+FCDF
Sbjct  209  GASSPPVSGRFDRQPPSAVNYELLPNTIQGRVLDVEHLVMDDDVQKRYRFLGHLPKFCDF  268

Query  446  YICELDLTSQLSPSTLNLFRNELk-----------krtkqrkqkqrqqNATTPSSPIFKS  494
            Y+CELDL+  LSP T+  F+ E K              K +K       ATT SSP+F+ 
Sbjct  269  YVCELDLSDILSPETIQAFKGEFKKREKVRRAKREAEKKSKKNGLSGAEATTRSSPVFR-  327

Query  495  NAAAFSLEQEGMTWPSPYEQAIAESLE-EFHLSNSELD----------------------  531
               AFSL++    WP+P E ++ +S +    ++++  D                      
Sbjct  328  QMPAFSLDEGAAHWPAPAELSLNDSFDGAMQVNDTSGDEELAAALAASSMMSPPFGASTS  387

Query  532  SAAVSPDVESSFARVTENSGYFPALGGEPRTPVADPIAFGSPAAWGNASTSPPaaawgs-  590
            + AV   V  SFA +T NSGYFP LGG      + P A  SP  WG  ++SPP       
Sbjct  388  TYAVEDGVYGSFATITRNSGYFPPLGGSTNDTSSAP-ATSSP-MWG--ASSPPLLGARGP  443

Query  591  ---gkggkkkgagkkgVSVFSTTQRRSYR  616
                 G KKKGA KKG  +FST QRRSYR
Sbjct  444  GIVAGGSKKKGAMKKGTQLFSTAQRRSYR  472

>H310_01471
Length=560

 Score = 327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 221/601 (37%), Positives = 313/601 (52%), Gaps = 85/601 (14%)

Query  31   ERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVISPLEPDAV  90
            +R    G  ANHLLNF+LP R        +KKK   PRT+ E+LHANYRFVISPL  +  
Sbjct  30   DRRKSKGSVANHLLNFSLPVRNNDPPSFVRKKKGPPPRTRDEFLHANYRFVISPLSANES  89

Query  91   VPTWDLEALTEWSSVEQVLLWYDVES-PQTCPICMDTFRAPKITKCGHIFCWPCILRYLS  149
               +DL+ALTEW  +EQV++  D  +  Q CPIC+DT RAPKIT+CGH +CW CIL YLS
Sbjct  90   PTLYDLDALTEWDKIEQVIVANDATNIDQRCPICLDTLRAPKITRCGHAYCWHCILTYLS  149

Query  150  MTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFPQL-RALP  208
            MT+ YWRRCPMCF+SV+K  LRSV + + +  P + S ATF  + R +SS FP L  A+ 
Sbjct  150  MTENYWRRCPMCFDSVKKHDLRSVLIDRHRTIPLIGSSATFHLIHRSRSSWFPHLPAAMG  209

Query  209  SAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLYSEMRD  268
            S+ V+                      K+PS++  +A YSRILE+TP+YL+ ++  EM D
Sbjct  210  SSLVKG---------------------KIPSVHCSNAAYSRILESTPSYLQAMIEFEMHD  248

Query  269  LQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAK--SDDFSHGTYGSSHTYNMNSNTPVAK  326
            L ++ AE +SSGD   LP V+EA+     RLAK  +   S G   ++    + S +   K
Sbjct  249  LHTLAAEAQSSGDDHALPVVQEALAYCEKRLAKLFATTSSEGDGVAADASGIVSRSAATK  308

Query  327  EKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQKEMEA  386
                 +     Y+FYQ+ +G   +LHPL M+ L RE+  ++                   
Sbjct  309  AAIDASDDEPPYTFYQLHNGHTAILHPLCMRALTREFGHDNS------------------  350

Query  387  AWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRFCDFY  446
                                   P  I   VL+IEHVVM+++V KR+R+++HLP  CD +
Sbjct  351  ----------------------FPYDITATVLEIEHVVMNDDVRKRFRYMAHLPSHCDLF  388

Query  447  ICELDLTSQLSPSTLNLFRNELkkrtkqrkqkq---rqqNATTPSSPIFKSNAAAFSLEQ  503
            + E+DL   +SP T++ F+ E KKR + R+  +   +     T S     S     +L+ 
Sbjct  389  LVEVDLAGIVSPDTMSHFQTEFKKRARARQLAKRHQKLDKKKTRSDSFEVSLMLQLALDN  448

Query  504  EGMTWPSPYEQAIAE------SLEEFHLSNSELDSAAVSPDVESSFARVTENSGYFPA--  555
            +   +P     A+         LE F   ++  +S   SP   ++FA VT N GY+PA  
Sbjct  449  D-THYPQLQNVAVGAPPDKDGELERF---DTPDESPYNSP--YATFASVTTNQGYYPAFN  502

Query  556  LGGEPRTPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkkgagkkgVSVFSTTQRRSY  615
            +GG   T ++ P   G P      +            G   K A  KGVS+F+T+QRRSY
Sbjct  503  VGGRDGTSMSTP---GWPNVGSAMAVPFNLDELQKELGPNGKKAKGKGVSLFATSQRRSY  559

Query  616  R  616
            R
Sbjct  560  R  560

>SPRG_06313
Length=515

 Score = 324 bits (830),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 202/518 (39%), Positives = 286/518 (55%), Gaps = 92/518 (18%)

Query  30   EERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVISPLEPD-  88
            + R  + GVSANHLLNF+LPERE       +KKK+  PRT+ E+LHANYRFVI+PL  + 
Sbjct  37   DRRKRQGGVSANHLLNFSLPEREEKAVA-MRKKKAPPPRTRDEFLHANYRFVIAPLASEK  95

Query  89   AVVPTWDLEALTEWSSVEQVLLWYD-VESPQTCPICMDTFRAPKITKCGHIFCWPCILRY  147
            A    +D EALT W +VEQV++  +  E+ + CPIC+DT RAPKIT+CGH FCW CIL Y
Sbjct  96   AANVLFDPEALTAWDNVEQVIVTNEQSEADRRCPICLDTLRAPKITRCGHTFCWSCILMY  155

Query  148  LSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFPQLRAL  207
            LS+++ YW RCPMCF+SV+K  LRSV + + +  P V+  ATF  L R K S FP    L
Sbjct  156  LSLSENYWWRCPMCFDSVKKTDLRSVLVDRERSMPSVNRAATFALLHRSKGSWFPH---L  212

Query  208  PSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLYSEMR  267
            P+      SRS +                 PS++  D  +SRILEA+ +YLRE++  E+ 
Sbjct  213  PT----TGSRSGV-----------------PSVHSDDGRFSRILEASASYLREMVEGELL  251

Query  268  DLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSNTPVAKE  327
            DLQ +  E  SSG+ + LP ++E +     +L K         GS+     +++ P+   
Sbjct  252  DLQRLHVEAESSGERNMLPVIQEGITFCEKQLEKQ--------GSA-----SASVPI---  295

Query  328  KPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQKEMEAA  387
            K  ++ + E Y+FYQ+A+G  V LHP+ M+CL +E+ D                      
Sbjct  296  KTSDDDASELYTFYQLANGHTVFLHPITMRCLAKEFGDA---------------------  334

Query  388  WTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRFCDFYI  447
                                 LP  + G+VL++EHVVM+++  KR+RFLSHLP  CDFY+
Sbjct  335  ---------------------LPSSLGGKVLELEHVVMNDDARKRFRFLSHLPGLCDFYL  373

Query  448  CELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrq-qNATTPSSPIFKSNAAAFSLEQEGM  506
             E++L   +SP TL  F+++LKKR + R+ K+R   +          +     +LE E M
Sbjct  374  AEIELKDTVSPETLLHFQSDLKKRARARQAKKRAEVHEERKRLDAVDARLVNLTLENE-M  432

Query  507  TWPSPYEQAIAESLEEFHLSNSELDSA-----AVSPDV  539
             WP+P    +  S   FH S+  LD A      +SPDV
Sbjct  433  LWPAPQPTTLVSSSSSFHASDFALDDADAFPSELSPDV  470

>H257_00314
Length=563

 Score = 316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 212/609 (35%), Positives = 312/609 (51%), Gaps = 83/609 (14%)

Query  23   QKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVI  82
             K+N  ++ R  +  V ANHLLNF+ P R        +KKK   PRT+ E+LHAN+RFVI
Sbjct  23   NKRNGGFDRRKGKGSV-ANHLLNFSRPVRNNDTTSFVRKKKGPPPRTRDEFLHANFRFVI  81

Query  83   SPLEPDAVVPTWDLEALTEWSSVEQVLLWYD--VESPQTCPICMDTFRAPKITKCGHIFC  140
            SPL  +     +D +ALTEW  +EQV++ +D  V++   CPIC+DT RAPKIT+CGH +C
Sbjct  82   SPLAANESRALYDPDALTEWDKIEQVIVAHDATVDADHRCPICLDTLRAPKITRCGHAYC  141

Query  141  WPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSM  200
            W CIL YLS+T+ YWRRCPMCF++V+K  LRSV + + +  P V S ATF+++ R + S 
Sbjct  142  WHCILTYLSLTENYWRRCPMCFDAVKKHDLRSVLIDRHRTIPSVGSSATFRYVHRGRGSW  201

Query  201  FPQLRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRE  260
            FP L A  +A            P ++     ++   +PS++  +A +SRILE+TP+YL  
Sbjct  202  FPHLPAPQAA------------PSSTKNHHPQQKGGIPSVHGANAVFSRILESTPSYLES  249

Query  261  LLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHT-----  315
            ++ SE  DL ++ AE +SSGD   LP ++EA+     RLAK         G S       
Sbjct  250  MIQSETEDLDALAAEAKSSGDDHALPVIQEALAYCEKRLAK-------LRGPSTAPDEPV  302

Query  316  -YNMNSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGR  374
                   T               YSFYQ+ +G   +LHPL ++ L RE+   H       
Sbjct  303  PTTTAKATKKTSSPSEHEEEEAPYSFYQLDNGHAAILHPLCLRALTREFGSTHS------  356

Query  375  HEEDARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYR  434
                                               P  I   VL+IEH+V+ ++V +R+R
Sbjct  357  ----------------------------------FPHTITATVLEIEHMVVTDDVRRRFR  382

Query  435  FLSHLPRFCDFYICELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTP---SSPI  491
            +++HLP  CD ++ E+DL+  +SP+T + F +++KKR + R+ K+   +   P   S   
Sbjct  383  YMAHLPSHCDLFLVEVDLSPVVSPATYSHFYSDIKKRARGRQAKRHPHHDKKPQPRSDSF  442

Query  492  FKSNAAAFSLEQEGMTWPSPYEQAIAESLEEFHLSNSELDSAAVSPDVES---SFARVTE  548
                    +L+ +      P+ Q  A S ++   ++  LD    + D  S   SFA VT 
Sbjct  443  DMCLMLQLALDNDDHY---PHLQDTAASDDK---TSRRLDDEGATGDYSSPYASFANVTT  496

Query  549  NSGYFPALGGE-PRTPVADPIAFGSPAAWGNASTSPPaaawgsgkggkkkgagkkgVSVF  607
            N GY+P+   +      A   A G P    N ST  P       K  ++    KKGVS+F
Sbjct  497  NQGYYPSFNADGDDRRPAAAAAPGWPNV--NGSTDVPFDIDELKKESQQGKKAKKGVSLF  554

Query  608  STTQRRSYR  616
            +T+QRRSYR
Sbjct  555  ATSQRRSYR  563

>SDRG_01805
Length=519

 Score = 312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 280/518 (54%), Gaps = 92/518 (18%)

Query  30   EERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVISPLEPD-  88
            + R  + GVSANHLLNF+LPERE       +KKK+  PRT+ E+LHANYRFV++PL  + 
Sbjct  40   DRRKRQGGVSANHLLNFSLPEREEKAVA-MRKKKAPPPRTRDEFLHANYRFVVAPLASEK  98

Query  89   AVVPTWDLEALTEWSSVEQVLLWYD-VESPQTCPICMDTFRAPKITKCGHIFCWPCILRY  147
            A    +D EAL  W +VEQV++  +  E+ + CPIC+DT RAPKIT+CGH FCW CIL Y
Sbjct  99   AANVLFDPEALAAWDNVEQVIVNNEQAEADRRCPICLDTLRAPKITRCGHTFCWSCILMY  158

Query  148  LSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLERPKSSMFPQLRAL  207
            LS+++ YWRRCPMCF+SV+K  LRSV + + +  P V+  ATF  L R K S FP    L
Sbjct  159  LSLSENYWRRCPMCFDSVKKTDLRSVLVDRERSMPSVNRAATFALLHRSKGSWFPH---L  215

Query  208  PSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLYSEMR  267
            P+      SRS +                 PS++  D  +SRILEA+ +YLRE++  E+ 
Sbjct  216  PT----TASRSGV-----------------PSVHSDDGRFSRILEASASYLREMVEGELL  254

Query  268  DLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYNMNSNTPVAKE  327
            DLQ +  E  SSG+ + LP ++E +     +L K                 +++   A  
Sbjct  255  DLQRLYVEAESSGERNMLPVIQEGITFCEKQLEK---------------QASASIASASI  299

Query  328  KPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHELEGRHEEDARQKEMEAA  387
               ++ + E Y+FYQ+A G  V LHP+ M+CL +E+ D                      
Sbjct  300  TTSDDDASELYTFYQLASGHTVFLHPITMRCLTKEFGDA---------------------  338

Query  388  WTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRFCDFYI  447
                                 LP  + G+VL++EHVVM+++  KR+RFLSHLP   DFY+
Sbjct  339  ---------------------LPSSLSGKVLELEHVVMNDDARKRFRFLSHLPGLGDFYL  377

Query  448  CELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrq-qNATTPSSPIFKSNAAAFSLEQEGM  506
             E++L   +SP TL  F+++LKKR + R+ K+R   +          +     +LE E M
Sbjct  378  AEIELKDTVSPETLLHFQSDLKKRARARQAKKRAEVHEERKRLDAVDARLVNLTLENE-M  436

Query  507  TWPSPYEQAIAESLEEFHLSNSELDSAA-----VSPDV  539
             WP+P    +  S   FH S+  LD A+     +SPDV
Sbjct  437  LWPAPQPTMLLSS-ASFHASDFALDDASAFPSELSPDV  473

>CCI46717
Length=382

 Score = 194 bits (492),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 145/399 (36%), Positives = 216/399 (54%), Gaps = 40/399 (10%)

Query  237  LPSINDVDATYSRILEATPAYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTS  296
            +PS+ D ++ +SR+++A   Y  ++L  +++ L+S+  E RS G+V+ LPF+EEA+  T+
Sbjct  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64

Query  297  GRLAKSDDFSHGTYGSSHTYNMNSNTPVAKEKPHENASGEA---YSFYQIADGTYVVLHP  353
             RL   +    G            N P   E  + NA G+    YS+YQ+ +GTYVVLHP
Sbjct  65   SRLDSVEVIQDG------------NEPTQMEDIN-NAEGKKDVLYSWYQLENGTYVVLHP  111

Query  354  LNMKCLLRE--YSDEHQHELEGRHEE-DARQK-EM-EAAWTQEANSSASSELLPADRYHL  408
            +NMKCLL+E     E ++++  R+ + D +   EM E A T  A+ + SS      ++  
Sbjct  112  VNMKCLLKEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSST-----QHDA  166

Query  409  LPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRFCDFYICELDLTSQLSPSTLNLFRNEL  468
            LP+ + G VL +EH VMD+E  +RYRFLSHLP++CDFY+CELDL+  LS  TL   + EL
Sbjct  167  LPDVVQGEVLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKEL  226

Query  469  kkrtkqrkqkqrqqNATTPSSPIFKSNAAAFSLEQEGMTWPSP------YEQAIAESLEE  522
              R +QR+ K++  +       +  +     +   + +   SP       E  + +  +E
Sbjct  227  ATRRRQREAKKKLLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDE  286

Query  523  FHLSNSELDSAAVSPDVESSFARVTENSGYFPAL-GGEPRTPVADPIAFGSPAA-WG---  577
              L N+ +  A +S D  SS+A +T NSGYFPAL G  P+ P + P AF  P   WG   
Sbjct  287  LRLQNTRI--AQISDDTSSSYATITRNSGYFPALEGSTPQAPASAP-AFEQPIVPWGRNR  343

Query  578  NASTSPPaaawgsgkggkkkgagkkgVSVFSTTQRRSYR  616
             A+              K KG  K    VFST+QRRSYR
Sbjct  344  EATHEVYGHIPSESGHKKMKGKKKNCKEVFSTSQRRSYR  382

>PYAP_22845
Length=135

 Score = 182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 96/122 (79%), Gaps = 5/122 (4%)

Query  24   KKNMDYEE----RVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAP-RTQSEYLHANY  78
            KK  DY E    R+TRNG+SANHLLNF+LPERE+   HH  KKK +AP RTQ EYLHANY
Sbjct  12   KKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAHHHGKKKKNAPTRTQMEYLHANY  71

Query  79   RFVISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHI  138
            RFVI+PL  D  V  WD+E LTEW SVEQVLLWYD  SP TCPIC+D+FRAPKIT+CGHI
Sbjct  72   RFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSFRAPKITRCGHI  131

Query  139  FC  140
            FC
Sbjct  132  FC  133

>PHYKE_5842
Length=550

 Score = 180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 96/109 (88%), Gaps = 1/109 (1%)

Query  223  PEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELLYSEMRDLQSMDAEFRSSGDV  282
            PEA+AFAERKR+RKLPS+ND DATYSRILE+TP YL+ELLYSEMRDLQSMDAEFRSSGDV
Sbjct  67   PEAAAFAERKRTRKLPSVNDADATYSRILESTPEYLKELLYSEMRDLQSMDAEFRSSGDV  126

Query  283  DNLPFVEEAMRNTSGRLAKSDDFSHGTYGSSHTYN-MNSNTPVAKEKPH  330
            DNLPFVEEAMRNTSGRLAKS DF+ GT+G  H  N  NS + V+KEK H
Sbjct  127  DNLPFVEEAMRNTSGRLAKSGDFAQGTHGGHHAANHANSTSGVSKEKTH  175

 Score = 137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 106/149 (71%), Gaps = 14/149 (9%)

Query  449  ELDLTSQLSPSTLNLFRNELkkrtkqrkqkqrqqNATTPSSPIFKSNAAAFSLEQEGMTW  508
            E DLTSQLSPSTLN F NELKKR K RK K + QN   PSSPI+KS+AAAFSLE+EG +W
Sbjct  177  ENDLTSQLSPSTLNCFHNELKKRVKHRKHKLKLQNTAAPSSPIYKSSAAAFSLEEEGASW  236

Query  509  PSPYEQAIAESLEEFHLSNSELDS------AAVSPDVESSFARVTENSGYFPALG---GE  559
            P+  E+A+AESL +F L+ ++LD       +  S D E SFARVTENSGYFPALG   GE
Sbjct  237  PA-LEEALAESLADFTLAGTKLDDERHAAPSLHSTDQEGSFARVTENSGYFPALGSEAGE  295

Query  560  PRT--PVADPIAFGSPAAWGNA--STSPP  584
             R     + P  FGSP+AWG+A  STSPP
Sbjct  296  SRAHGTASGPFGFGSPSAWGSANPSTSPP  324

 Score = 41.2 bits (95),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/20 (85%), Positives = 18/20 (90%), Gaps = 0/20 (0%)

Query  103  SSVEQVLLWYDVESPQTCPI  122
            +SVEQVLLWYD ES QTCPI
Sbjct  25   TSVEQVLLWYDDESQQTCPI  44

>H257_08759
Length=107

 Score = 53.5 bits (127),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 30/49 (61%), Gaps = 0/49 (0%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            TCP+C+D    P  T+CGHIFC  C+ R+ +       RCP+C + +Q+
Sbjct  48   TCPVCLDPILHPIATRCGHIFCRDCLDRWWTEGRMVSTRCPVCNKRLQR  96

>SDRG_08354
Length=174

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 31/48 (65%), Gaps = 4/48 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            C IC+D  + P +T CGH++CWPC+ ++++  ++    CP+C   V K
Sbjct  10   CNICLDRVKEPVVTLCGHLYCWPCLFQWIANHNE----CPVCKAGVTK  53

>SPRG_01982
Length=175

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 31/48 (65%), Gaps = 4/48 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            C IC+D  + P +T CGH++CWPC+ ++++  ++    CP+C   V K
Sbjct  10   CNICLDRVKEPVVTLCGHLYCWPCLFQWIANHNE----CPVCKAGVTK  53

>PYU1_G009434
Length=163

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 29/46 (63%), Gaps = 4/46 (9%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC+DT  +P +T CGH++CWPC+ +++    +    CP+C   +
Sbjct  25   CNICLDTVSSPVVTLCGHLYCWPCLFQWMEARSE----CPVCKAGI  66

>H257_00605
Length=186

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C IC+D  + P +T CGH++CWPC+ R++    +    CP+C   V + ++  V
Sbjct  25   CNICLDHVKEPVVTLCGHLYCWPCLYRWICSNSQ----CPVCKAGVTQDNVIPV  74

>PHYRA_93417
Length=332

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 29/46 (63%), Gaps = 4/46 (9%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C +C+DT  +P +T CGH++CWPC+ +++    +    CP+C   +
Sbjct  25   CNVCLDTVSSPVVTLCGHLYCWPCLYQWMQNHSE----CPVCKAGI  66

>PHALS_09908
Length=499

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 4/46 (9%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC+DT  +P +T CGH++CWPC+ +++    +    CP+C   V
Sbjct  332  CNICLDTVSSPVVTLCGHLYCWPCLYQWM----QSHSECPVCKAGV  373

>PPTG_09629
Length=191

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C IC+DT  +P +T CGH++CWPC+ +++    +    CP+C   V + ++  V
Sbjct  24   CNICLDTVSSPVVTLCGHLYCWPCLYQWMQNHSE----CPVCKAGVSEQNVIPV  73

>SPRG_07002
Length=170

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 50/122 (41%), Gaps = 16/122 (13%)

Query  49   PERERHVYHHQKKKKSSAPRTQSEYLHANYRFVISPLEPDAVVPTWDLEALTEWSSVEQV  108
            P ++R   + +    +SAP T+S+     Y             PT    A      ++  
Sbjct  62   PAKKRKKSNGKAPAATSAPLTRSDGKAVRYD------------PTHMASADCTQVCMDNA  109

Query  109  LLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            +          CPIC+D F     T CGH+FC PCI   +++  K    CP+C  S  + 
Sbjct  110  VAMEQYTKNAFCPICLDEFNELASTSCGHLFCAPCISNAVAVNGK----CPLCQASPVQI  165

Query  169  HL  170
            HL
Sbjct  166  HL  167

>PYIR_13250
Length=214

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 29/46 (63%), Gaps = 4/46 (9%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC+DT  +P +T CGH++CWPC+ +++    +    CP+C   +
Sbjct  50   CNICLDTVSSPVVTLCGHLYCWPCLYQWMESRSE----CPVCKAGI  91

>PYIW_19474
Length=224

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 4/46 (9%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC+DT  +P +T CGH++CWPC+ +++    +    CP+C   V
Sbjct  56   CNICLDTVSSPVVTLCGHLYCWPCLYQWMESRSE----CPVCKAGV  97

>SDRG_08762
Length=109

 Score = 48.1 bits (113),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/63 (35%), Positives = 32/63 (51%), Gaps = 10/63 (16%)

Query  115  ESPQT-------CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            +SPQ        CP+C+D    P  TKCGH+FC  C+++ L        +CP+C   V +
Sbjct  45   DSPQADRRPALECPVCLDAVCKPVATKCGHVFCDECLMQALQRAK---HKCPVCRRRVTR  101

Query  168  GHL  170
              L
Sbjct  102  NQL  104

>H310_01205
Length=186

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 30/48 (63%), Gaps = 4/48 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            C IC+D  + P +T CGH++CW C+ R++S  ++    CP+C   V +
Sbjct  40   CNICLDHVKEPVVTLCGHLYCWSCLYRWISRNNQ----CPVCKAGVTQ  83

>H257_06038
Length=684

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (54%), Gaps = 4/52 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            CPIC+++   P    C H FC PCI     M   Y  +CP+C  S +K HLR
Sbjct  24   CPICLESVTVPYSLPCNHCFCEPCI----GMALTYAPKCPVCKASAKKRHLR  71

>H257_06804
Length=933

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 42/93 (45%), Gaps = 13/93 (14%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQ  174
            ++ + C ICMD  +   IT C H +C PC+L  L         CP+C + VQ  HL    
Sbjct  688  DTGEDCAICMDPLQDAVITMCRHFYCRPCLLCALQAKPT----CPLCRQDVQPAHL----  739

Query  175  LHQLQIPPHVDSDATFQFLERPKSSMFPQLRAL  207
            +  +  PP V+ D        P S M   L+ L
Sbjct  740  VADVAAPPLVEMDQVL-----PSSKMEALLKLL  767

>CCA26132
Length=266

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 43/88 (49%), Gaps = 13/88 (15%)

Query  113  DVESPQTCPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRR-----CPMC---FE  163
            D+   + CPIC+    A  +T+ CGHIFC  CI  ++    K  R+     CPMC   F 
Sbjct  39   DILDNELCPICLQKLDAAVMTQNCGHIFCCDCICLWVDHVTKKSRKRGLPECPMCKREFR  98

Query  164  SVQKGHLRSVQLHQLQIPPHVDSDATFQ  191
            ++       + L +L++    D D TF+
Sbjct  99   TLYANITSDIHLVKLEL----DGDLTFK  122

>H310_13091
Length=662

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (56%), Gaps = 4/52 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            CPIC+++   P    C HIFC PCI   L+    Y  +CP+C    +K HLR
Sbjct  26   CPICLESVTVPYSLPCNHIFCEPCIGVALT----YAPKCPVCKAPAKKRHLR  73

>H310_10009
Length=972

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query  109  LLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            +L   + S + C ICMD  +   IT C H FC PCI   L +       CPMC + VQ  
Sbjct  717  ILQEAINSGEECAICMDPLKDAVITMCRHFFCRPCISCALQVKPS----CPMCRQDVQAS  772

Query  169  HL  170
             L
Sbjct  773  QL  774

>H310_06346
Length=139

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C+D  + P  T CGHI+C  CI+  L +     ++CPMC
Sbjct  87   CAVCLDAVQVPTATTCGHIYCRTCIVESLHVR----KKCPMC  124

>PYAR_20520
Length=374

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
             V  P+ C +C+    +P  T CGH+FCW CI+ +     K    CP+C +      ++ 
Sbjct  313  SVGRPKKCALCLGERTSPATTPCGHVFCWECIVGW---CQKNKPECPICRQEAHPQQIKC  369

Query  173  V  173
            V
Sbjct  370  V  370

>H310_05789
Length=223

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TC IC+DT R    T CGHIFC  CI + +  + K    CPMC
Sbjct  171  TCAICLDTLRDLTSTSCGHIFCRECITQAVFASQK----CPMC  209

>PYAP_18874
Length=75

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 4/61 (7%)

Query  114  VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            V+ PQ C +C +  R     KCGHI C PC   +  M    +  CPMC    Q G+L  +
Sbjct  9    VKDPQ-CFVCYEISRKAYAAKCGHICCLPC---WQKMDKDGFNSCPMCKVPFQLGNLSLI  64

Query  174  Q  174
            +
Sbjct  65   R  65

>H257_13532
Length=136

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D  + P  T CGHI+C  CI+  L +     ++CPMC
Sbjct  84   CAICLDAVQVPTATTCGHIYCRACIVESLHL----RKKCPMC  121

>PYU1_G008514
Length=531

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 0/65 (0%)

Query  97   EALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWR  156
            E + EW          D+E+   C IC D F  P +  C H FC  C+ +YL     +  
Sbjct  13   EDMHEWEWPRHCAELRDIENLLRCQICGDFFHGPVLLPCSHAFCSECVRKYLQTRGAHDG  72

Query  157  RCPMC  161
             CP C
Sbjct  73   CCPEC  77

>PYAR_20706
Length=530

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 33/75 (44%), Gaps = 3/75 (4%)

Query  97   EALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYL-SMTDKYW  155
            EA+ EW           +ES   C IC D F  P +  C H FC  C+ R+L S  +  W
Sbjct  13   EAMDEWLWPAACPELRQMESALRCQICGDFFHGPVLLPCTHTFCSECVRRFLQSRANHGW  72

Query  156  RRCPMCFESVQKGHL  170
              CP C +    G L
Sbjct  73   --CPECKQPCTPGEL  85

>PYAR_25212
Length=307

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D+     C +C D  +   I+KC H+FC  CI   L   +   R+CP C +++ +  ++S
Sbjct  247  DLRKQLKCSVCQDRHKDVIISKCSHLFCKECIDSNLRSRN---RKCPTCKKTLGQDDVKS  303

Query  173  V  173
            V
Sbjct  304  V  304

>PITG_18751
Length=330

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query  100  TEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCP  159
            T +S  E+V      +S + C +C+    +P +T CGH+FCW CI+ +     K    CP
Sbjct  256  TPFSCSERVPTSLSQQSRRKCALCLGERVSPAVTPCGHVFCWECIVGW---CQKNKAECP  312

Query  160  MCFESVQKGHLRSV  173
            +C +      ++ V
Sbjct  313  LCRQEAHPQQIKCV  326

>PPTG_09547
Length=391

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 31/59 (53%), Gaps = 3/59 (5%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            +S + C +C+    +P +T CGH+FCW C++ +     K    CP+C +      ++ V
Sbjct  332  QSRRKCALCLGERVSPAVTPCGHVFCWECVVGW---CQKNKAECPLCRQETHPQQIKCV  387

>PYIR_18571
Length=403

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 3/58 (5%)

Query  116  SPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            S + C +C+    +P  T CGH+FCW CI+ +     K    CP+C + V    ++ +
Sbjct  345  SKRKCALCLGERISPAATPCGHVFCWECIVGW---CQKNKAECPLCRQEVHPQQIKCI  399

>H310_00284
Length=994

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 28/53 (53%), Gaps = 2/53 (4%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q CP+C+D   AP +T CGH+ C  C+L +L+        CP+C   V    L
Sbjct  747  QECPVCLDVPTAPVLTPCGHLMCKECVLGFLNAGATAC--CPVCRADVTPDQL  797

>PYU1_G004976
Length=172

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 29/56 (52%), Gaps = 6/56 (11%)

Query  120  CPICMDTFRAPKI--TKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            CPIC+DT  AP +  T CG  FC  C+   L   D     CPMC E + +G   +V
Sbjct  9    CPICLDTLAAPVVLSTCCGQSFCRVCLDAALVKVDA----CPMCREPLLRGGKHAV  60

>PYAR_13176
Length=621

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 5/66 (8%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR-SV  173
            E+   CPIC+  + AP    C H FC  CI R L +     + CP+C    +K  LR   
Sbjct  49   EAQLQCPICLCAYTAPASLPCNHCFCEECIHRALELK----QVCPICKAPAKKRSLRHDT  104

Query  174  QLHQLQ  179
             + QLQ
Sbjct  105  MIQQLQ  110

>SDRG_11517
Length=356

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (7%)

Query  114  VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            V + + C +C+     P +T CGH+FCW CI+ +     +    CP+C + VQ   ++ +
Sbjct  297  VTAQRKCALCLTERSHPAMTPCGHVFCWECIVGWCQNKPE----CPLCRQLVQPQDVKCI  352

>SDRG_00506
Length=738

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D+     C +C D  +   I+KC H+FC  C+   L   +   R+CP C +   +  L+S
Sbjct  678  DLRKKLKCSVCQDALKDVIISKCSHMFCKDCMDANLKARN---RKCPTCKKMFGQDDLKS  734

Query  173  V  173
            V
Sbjct  735  V  735

>PYU1_G009379
Length=435

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 9/60 (15%)

Query  117  PQTCPICMD--TFRAP-KIT--KCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            P  CP+CM+  T   P +I   KCGH+F   CI R+L       ++CP+C   V+K  LR
Sbjct  244  PTECPVCMEACTLSGPHRIVSLKCGHVFGQKCIERWL----MERKKCPVCNHVVRKTDLR  299

>PYAP_17750
Length=343

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQL  178
            C +C+D       T CGH++C  CI   +  T K    CP+C     + HLR   +H L
Sbjct  292  CSVCLDVIEEMTSTICGHVYCARCIKLAIRATQK----CPLC-----QRHLRPTDIHGL  341

>PYIR_14154
Length=617

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 0/40 (0%)

Query  109  LLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYL  148
            +L      P TCP+C  T   P ++  G++FC+PCI RY+
Sbjct  310  VLTLSTADPSTCPVCRQTRVNPAMSVSGYVFCYPCIYRYV  349

>PHYKE_7333
Length=376

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 30/59 (51%), Gaps = 3/59 (5%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            +S + C +C+    +P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  317  QSRRKCALCLGERVSPAATPCGHVFCWECIVGW---CQKNKAECPLCRQETHPQQIKCV  372

>PYIW_15296
Length=675

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 43/112 (38%), Gaps = 25/112 (22%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQ--  177
            C IC+ T+  P    C H FC  CI R L +  +    CPMC    +K  LR   + Q  
Sbjct  28   CAICLSTYANPASLPCNHCFCEECIHRALELKAE----CPMCKAPAKKRKLRYDSMIQQL  83

Query  178  ------LQIPPHVDSDA------------TFQFLERPKSSMFPQLRALPSAE  211
                  L  P   D+D                  E+PKSS  P +    SAE
Sbjct  84   LRAAEMLNAPAETDADVDDGKQESSTEDDALLLEEKPKSSK-PSMSNGTSAE  134

>PHALS_12995
Length=768

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (55%), Gaps = 3/42 (7%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C + F+ P+   C H FC PCIL++L     +   CP C
Sbjct  21   CTLCNNIFQEPQCLDCKHNFCLPCILQHLKQNKSH---CPTC  59

>SPRG_07200
Length=714

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D+     C +C D  +   I+KC H+FC  C+   L   +   R+CP C +   +  L+S
Sbjct  654  DLRKKLKCSVCQDALKDVIISKCSHMFCKDCMDANLKARN---RKCPTCKKMFGQDDLKS  710

Query  173  V  173
            V
Sbjct  711  V  711

>PPTG_16653
Length=617

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 38/85 (45%), Gaps = 18/85 (21%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQ  179
            C IC +T R P    C H+FC  C+  +      + R CP+C  SV  G           
Sbjct  550  CSICYETMRQPVKLACSHMFCEECVTEWF----DHERSCPLCRASVGSG-----------  594

Query  180  IPPHVDSDATFQFLERPKSSMFPQL  204
              P  + +   QFL+  ++S+ PQL
Sbjct  595  --PSAEENIKPQFLD-GRTSLVPQL  616

>H310_08802
Length=190

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC D    P  T+CGH +C PC++++   T +    CP C
Sbjct  6    CPICYDACYDPVRTRCGHAYCRPCLVQW---TAEGHTSCPTC  44

>H257_12393
Length=208

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 28/42 (67%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+DT  +   T+CGH++C  CI +  ++ D +  RCP+C
Sbjct  157  CPLCLDTMVSITSTRCGHVYCRDCIAQ--AIVDMH--RCPLC  194

>CCI45212
Length=267

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 13/88 (15%)

Query  112  YDVESPQTCPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRR-----CPMC---F  162
            +D    + CPIC+       +T+ CGHIFC  CI  ++    K  ++     CPMC   F
Sbjct  39   HDTLENELCPICLQKVDLAVMTQDCGHIFCCDCICLWVDHVKKKSQKRGLPECPMCKREF  98

Query  163  ESVQKGHLRSVQLHQLQIPPHVDSDATF  190
            +++       + L +L++    D+D TF
Sbjct  99   DTLYANITSDINLVKLEL----DNDLTF  122

>SPRG_00122
Length=355

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P +T CGH+FCW CI+ +     +    CP+C + VQ   ++ +
Sbjct  302  CALCLTERSHPAMTPCGHVFCWECIVGWCQNKPE----CPLCRQLVQPQDVKCI  351

>PHYSO_288411
Length=187

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 30/59 (51%), Gaps = 3/59 (5%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            +S + C +C+    +P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  128  QSRRKCALCLGERVSPAATPCGHVFCWECIVGW---CQKNKAECPLCRQETHPQQIKCV  183

>PYIR_15276
Length=153

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query  120  CPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            CPIC+DT   P +T  CG  FC  C+   L+ TD     CPMC E + KG
Sbjct  32   CPICLDTLERPVLTTCCGQSFCDACLNAALAKTDA----CPMCREPLLKG  77

>PYIW_23387
Length=591

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 0/47 (0%)

Query  110  LWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWR  156
            L      P TCP+C  T   P ++  G++FC+PCI RY+   D   R
Sbjct  302  LMLSTADPSTCPVCRQTRVNPAMSVSGYVFCYPCIYRYVEEHDDMKR  348

>H310_05127
Length=206

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (60%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+DT      TKCGH++C  CI   ++    +  +CP+C
Sbjct  155  CPLCLDTMVTITSTKCGHVYCRSCIAEAIN----HIHKCPLC  192

>SDRG_09580
Length=161

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (55%), Gaps = 4/51 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            C IC+D F     T CGH+FC PC+   +++  K    CP+C  +  + HL
Sbjct  112  CSICLDEFTELASTSCGHLFCAPCVSNAVAVNGK----CPLCQATPVQIHL  158

>PITG_03821
Length=830

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            D++    C +C D  +   I+KC H+FC  CI   L   +   R+CP C
Sbjct  770  DLQKLVNCSVCQDRRKDVLISKCSHMFCKECIENNLKSRN---RKCPTC  815

>SDRG_10388
Length=629

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 37/85 (44%), Gaps = 18/85 (21%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQ  179
            CPIC+  F +P    C H FCW C+ +     + +   CP+C         R VQ     
Sbjct  170  CPICLYHFTSPVTLSCSHTFCWSCLAK---AAEHHIHACPLC---------RQVQ----S  213

Query  180  IPPH-VDSDATFQ-FLERPKSSMFP  202
            I P   + D   Q FL+R  S M P
Sbjct  214  IDPRDYEIDGLLQRFLKRYGSLMTP  238

>PHYCA_104912
Length=347

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            + C +C+    +P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  291  RKCALCLGERVSPAATPCGHVFCWECIVGW---CQKNKTECPLCRQETHPQQIKCV  343

>PHYSO_558391
Length=463

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICM-DTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    +AP    C H FCW C+ R        +R CP+C
Sbjct  202  TCPICLCSEVQAPITLSCAHTFCWSCLSR---AAQHRFRSCPLC  242

>PYU1_G001730
Length=358

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+DT      T CGH++C  CI   + +T K    CP+C
Sbjct  307  CSICLDTIDEMTSTMCGHVYCGKCIRLAIRVTGK----CPLC  344

>PHYKE_6978
Length=610

 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (46%), Gaps = 7/85 (8%)

Query  115  ESPQTCPICMDTFRAP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            ES  TC  C+  F +P  +  CGH +C  C+ +Y S+       C MC  S ++     +
Sbjct  523  ESTFTCLQCIQLFTSPMTLAPCGHTYCAACLAKYGSVDVPSAISCKMCEGSTKQQETECI  582

Query  174  QLHQLQIPPHVDSDATFQFLERPKS  198
                   P H  +D T +F+ R +S
Sbjct  583  ------FPNHALADLTARFVFRQQS  601

>PYVX_17322
Length=385

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (7%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            + C +C+    AP  T CGH+FCW CI+ +          CP+C
Sbjct  329  RKCALCLGERVAPAATPCGHVFCWECIVGWCQKNKA---ECPLC  369

>PHYRA_80613
Length=488

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (43%), Gaps = 1/63 (2%)

Query  99   LTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRC  158
            L EW          D+E+   C IC D F  P +  C H FC  C+ R+L     +   C
Sbjct  8    LDEWEWPADCQAQRDMENHLRCQICGDFFHGPVLLPCSHTFCSTCVRRFLQSKGAHG-CC  66

Query  159  PMC  161
            P C
Sbjct  67   PSC  69

>PITG_15195
Length=601

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 30/59 (51%), Gaps = 5/59 (8%)

Query  120  CPICMDTF-RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQ  177
            C IC + F  A + T CG IFC  CI R++S        CPMC E++    L   +L Q
Sbjct  230  CAICQEVFTNATEATCCGQIFCKDCIERWVSERGS----CPMCREAIGSSLLARSRLAQ  284

>SDRG_13236
Length=135

 Score = 41.2 bits (95),  Expect = 0.003, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 28/57 (49%), Gaps = 2/57 (4%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLH  176
            C IC+D   AP    CGH F   C+ R    T      CP+C   ++  HL+ ++++
Sbjct  13   CAICLDVLTAPTTLACGHSFDLRCVRRLHKATSAL--ACPVCRAPIKPSHLQVLRVN  67

>PYAP_17426
Length=369

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            + C +C+    +P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  313  KKCALCLGERISPATTPCGHVFCWECIVGW---CQKNKPECPICRQEAHPQQIKCV  365

>CCI45120
Length=270

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  98   ALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRR  157
            A +  +S+E   +    ++   C IC+D       T CGH+FC  CI   +  T    ++
Sbjct  197  AASNGASIENAEIIEQFKNSLKCSICLDLIDRMTSTICGHVFCRRCIRSAIQST----KK  252

Query  158  CPMC  161
            CP+C
Sbjct  253  CPLC  256

>PHALS_08991
Length=400

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            E  + C +C+   + P  T CGH+FCW CI+ +     K    CP+C
Sbjct  341  EPLRKCSLCLGERKVPSATPCGHVFCWECIVGW---CQKNKAECPLC  384

>PYU1_G009058
Length=389

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 28/61 (46%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
             V   + C +C+     P  T CGH+FCW CI+ +     K    CP+C +      ++ 
Sbjct  328  GVRRSRKCALCLGDRITPAATPCGHVFCWECIVGW---CQKNKAECPLCRQETHPQQIKC  384

Query  173  V  173
            +
Sbjct  385  I  385

>H257_06791
Length=1029

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 33/64 (52%), Gaps = 9/64 (14%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQ  177
            Q CP+C+D   AP +T C H+ C  C++ +LS        CP+C     + H+   QL +
Sbjct  780  QECPVCLDVPVAPVLTPCAHLMCHACVVAFLSNGGC----CPVC-----RAHISPDQLIR  830

Query  178  LQIP  181
            +  P
Sbjct  831  VDPP  834

>PYVX_18659
Length=452

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query  115  ESPQTCPICMDT-FRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +S   CPIC+    + P    CGH FCW C+ +     +  +  CPMC
Sbjct  182  DSTPICPICLGAQIKLPITLSCGHTFCWSCLSK---AAEHRFHSCPMC  226

>PHYSO_553932
Length=233

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI + +  + K    CP+C
Sbjct  182  CSICLDVIEDITSTTCGHIFCGGCIHQAIRASGK----CPLC  219

>CCA14180
Length=844

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D++    C +C D  ++  I+KC H+FC  CI   L   +   R+CP C +   +  ++S
Sbjct  784  DLQKIVNCSVCQDRRKSVIISKCYHMFCKDCIDSNLKARN---RKCPSCKKMFGQDDVKS  840

Query  173  V  173
            V
Sbjct  841  V  841

>PYIW_20853
Length=224

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query  116  SPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            S + C +C+    +P  T CGH+FCW CI+ +     K    CP+C +      ++ +
Sbjct  166  SRRKCALCLGDRISPAATPCGHVFCWECIVGW---CQKNKAECPLCRQETHPQQIKCI  220

>PPTG_00523
Length=466

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICM-DTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    +AP    C H FCW C+ R        +R CP+C
Sbjct  202  TCPICLCADVQAPITLSCAHTFCWSCLSR---AAQHRFRSCPLC  242

>PPTG_06536
Length=837

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D++    C +C D  +   I+KC H+FC  CI   L   +   R+CP C +      ++S
Sbjct  777  DLQKLVNCSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTCKKMFGHDDVKS  833

Query  173  V  173
            V
Sbjct  834  V  834

>PITG_19249
Length=465

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICM-DTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    +AP    C H FCW C+ R        +R CP+C
Sbjct  205  TCPICLCADVQAPITLSCAHTFCWSCLSR---AAQHRFRSCPLC  245

>HYAP_09472
Length=639

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 48/107 (45%), Gaps = 13/107 (12%)

Query  120  CPICMDTF-RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQL  178
            C IC + F  A + T CG IFC  CI R++S        CPMC E++    L + + H  
Sbjct  265  CAICQEVFTNATEATCCGQIFCKECIERWVSERSS----CPMCREAISFSLLAASR-HAQ  319

Query  179  QIPPHVDSDATFQFLERPKSSMFPQLRALPSAEVEATSRSAIPPPEA  225
            ++   +     +      K+S+   L+A   A VE       PPP A
Sbjct  320  RMANEMTISCGYCSETMKKASLAEHLKACDQAPVE-------PPPPA  359

>PHYRA_77725
Length=968

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C D F+ P+   C H FC PCIL +L        +CP C
Sbjct  211  CTLCGDMFQDPQCLDCKHNFCRPCILLHLKQNHT---QCPSC  249

>PITG_10321
Length=465

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICM-DTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    +AP    C H FCW C+ R        +R CP+C
Sbjct  205  TCPICLCADVQAPITLSCAHTFCWSCLSR---AAQHRFRSCPLC  245

>PYU1_G007193
Length=831

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  ++SV
Sbjct  778  CSVCQDQRKNVLISKCFHMFCKDCIDSNLKSRN---RKCPTCKKMFGQDDVKSV  828

>HYAP_02462
Length=821

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C   F+ P+   C H FC PCIL +L   + Y   CP C
Sbjct  21   CTLCDQMFQDPQCLDCKHNFCRPCILLHLKHNNSY---CPNC  59

>PYVX_18030
Length=665

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 29/61 (48%), Gaps = 5/61 (8%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQ-LHQ  177
            TCPIC+  +  P    C H FC  CI R L +       CP+C    +K  LR  Q L Q
Sbjct  36   TCPICLCAYDNPTSLPCNHCFCEECIHRALEVKPV----CPICKAPAKKRRLRYDQMLRQ  91

Query  178  L  178
            L
Sbjct  92   L  92

>CCA18170
Length=374

 Score = 43.1 bits (100),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (43%), Gaps = 1/80 (1%)

Query  96   LEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYW  155
            +E   EW    ++     +ES   C IC D    P +  C HIFC  C+ RYL +     
Sbjct  1    MEDEGEWQWPHRLRELRAMESTIRCSICGDYLHGPVLLPCSHIFCSECVRRYLQVKGSNG  60

Query  156  RRCPMCFESVQKGHLRSVQL  175
              CP C  S +    R + L
Sbjct  61   -CCPQCKASCEAIDFRPIPL  79

>SPRG_15736
Length=622

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 51/108 (47%), Gaps = 13/108 (12%)

Query  59   QKKKKSSAPRTQSEYLHANYRFVISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESP-  117
            +K  KS A   Q+E L ++   ++ P    + V   DL + T  ++ + +LL    E+P 
Sbjct  109  KKFDKSIAGSMQAEILASD--LLLQPFYAGSYVD--DLYSHTA-ATTDALLLHLLPEAPV  163

Query  118  ----QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
                 +CPIC+    +P    C H FCW C+ +     + +   CP+C
Sbjct  164  AHADASCPICLYHLTSPVTLSCSHSFCWSCLAK---AAEHHIHACPLC  208

>PHYSO_322360
Length=811

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D++    C +C D  +   I+KC H+FC  CI   L   +   R+CP C +      ++S
Sbjct  751  DLQKLVNCSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTCKKMFGHDDVKS  807

Query  173  V  173
            V
Sbjct  808  V  808

>PHYCA_525476
Length=753

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            D++    C +C D  +   I+KC H+FC  CI   L   +   R+CP C
Sbjct  693  DLQKLVNCSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTC  738

>PITG_00025
Length=535

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 18/85 (21%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQ  179
            C IC +T R P    C H+FC  C+  +      + R CP+C  SV  G           
Sbjct  468  CSICYETMRQPVKLACSHMFCEECVTEWF----DHERSCPLCRASVGSG-----------  512

Query  180  IPPHVDSDATFQFLERPKSSMFPQL  204
              P  +      FL+  ++S+ PQL
Sbjct  513  --PSAEESVKPHFLD-GRTSLVPQL  534

>PYVX_14742
Length=1160

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (6%)

Query  109  LLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            L   D++    C +C D  +   I+KC H+FC  C+   L   +   R+CP C
Sbjct  767  LELQDLQKAVKCSVCQDRQKTVIISKCFHMFCKECVDNNLKSRN---RKCPTC  816

>PHYKE_3015
Length=612

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTF-RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC ES+
Sbjct  242  CAICQEVFTNATEATCCGQIFCKECIERWVSERGS----CPMCRESI  284

>CCI43385
Length=862

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D++    C +C D  ++  I+KC H+FC  CI   L   +   R+CP C +   +  ++S
Sbjct  802  DLQKIVNCSVCQDRQKSVIISKCYHMFCKECIDSNLKARN---RKCPSCKKMFGQDDVKS  858

Query  173  V  173
            V
Sbjct  859  V  859

>PITG_02789
Length=315

 Score = 42.7 bits (99),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 1/65 (2%)

Query  97   EALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWR  156
            + L EW          ++ES   C IC D F  P +  C H FC  C+ R+L     +  
Sbjct  8    DVLDEWEWPADCEAQREMESHLRCQICGDFFHGPVLLPCSHTFCSACVRRFLQSKGAHG-  66

Query  157  RCPMC  161
             CP C
Sbjct  67   CCPSC  71

>CCI43386
Length=788

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D++    C +C D  ++  I+KC H+FC  CI   L   +   R+CP C +   +  ++S
Sbjct  728  DLQKIVNCSVCQDRQKSVIISKCYHMFCKECIDSNLKARN---RKCPSCKKMFGQDDVKS  784

Query  173  V  173
            V
Sbjct  785  V  785

>PYIR_16966
Length=634

 Score = 43.1 bits (100),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTFR-APKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC ES+
Sbjct  267  CAICQEVFTGATEATCCGQIFCKDCIERWVSERGS----CPMCRESI  309

>PYIW_14664
Length=426

 Score = 43.1 bits (100),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHI+C  CI   + +T K    CP+C
Sbjct  375  CSICLDVIEEMTSTICGHIYCGKCIRLAIRVTAK----CPLC  412

>PYAP_13246
Length=832

 Score = 43.5 bits (101),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 31/61 (51%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D++    C +C D  +   I+KC H+FC  C+   L   +   R+CP C +   +  +++
Sbjct  772  DLQKQLKCSVCQDRHKNVIISKCFHMFCKECVDSNLKSRN---RKCPTCKKMFGQDDVKN  828

Query  173  V  173
            V
Sbjct  829  V  829

>H257_08183
Length=193

 Score = 41.6 bits (96),  Expect = 0.005, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 3/42 (7%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC D    P  T+CGH +C PC+ ++   T +    CP C
Sbjct  6    CPICYDPCYDPVQTRCGHKYCRPCLSQW---TAEGHTSCPTC  44

>PPTG_17132
Length=288

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI + +  + K    CP+C
Sbjct  237  CSICLDVLEDMTSTLCGHIFCAGCIHQAIRASGK----CPLC  274

>SDRG_07732
Length=159

 Score = 41.2 bits (95),  Expect = 0.005, Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+D ++    T CGH+FC  CI   ++   K    CP+C
Sbjct  108  CPLCLDPYQEMASTTCGHVFCKECITLVVAKIHK----CPLC  145

>PHALS_00606
Length=1142

 Score = 43.1 bits (100),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            D++    C +C D  +   I+KC H+FC  CI   L   +   R+CP C
Sbjct  773  DLQKVVNCSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTC  818

>PHYCA_568641
Length=434

 Score = 42.7 bits (99),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 1/65 (2%)

Query  97   EALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWR  156
            E   EW   E      ++E+   C IC D F  P +  C H FC  C+ R+L     +  
Sbjct  10   EMQDEWEWPEDCKPQREMENHLRCQICGDFFHGPVLLPCSHTFCSTCVRRFLQSKGAHG-  68

Query  157  RCPMC  161
             CP C
Sbjct  69   CCPSC  73

>PHYRA_94120
Length=1227

 Score = 43.1 bits (100),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D++    C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  +++
Sbjct  702  DLQKLVNCSVCQDRRKDVLISKCFHMFCKECIENNLKSRN---RKCPTCKKMFGQDDVKT  758

Query  173  V  173
            V
Sbjct  759  V  759

>H310_06527
Length=243

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 42/100 (42%), Gaps = 17/100 (17%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQL  178
            TCPIC+   R    T CGH FC PC+  Y + + +    CP C + +   HL    +H  
Sbjct  59   TCPICLTDVRLACETNCGHGFCTPCLTSYFA-SRRLDYPCPYCRQYI---HL----VHTF  110

Query  179  QIPPHVDSDA---------TFQFLERPKSSMFPQLRALPS  209
              P  + S           TF      K S+  QL  LP+
Sbjct  111  YSPVEISSQEGLSALRKLDTFNVRAGQKISLLQQLTDLPT  150

>PPTG_05556
Length=489

 Score = 42.7 bits (99),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (43%), Gaps = 1/63 (2%)

Query  99   LTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRC  158
            L EW          ++ES   C IC D F  P +  C H FC  C+ R+L     +   C
Sbjct  12   LDEWEWPVDCKAQREMESHLRCQICGDFFHGPVLLPCSHTFCSACVRRFLQSKGAHG-CC  70

Query  159  PMC  161
            P C
Sbjct  71   PSC  73

>PYU1_G012889
Length=592

 Score = 42.7 bits (99),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTFR-APKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC ES+
Sbjct  226  CAICQEVFTGATEATCCGQIFCKNCIERWVSERGS----CPMCRESI  268

>PHYCA_107875
Length=441

 Score = 42.4 bits (98),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICM-DTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    +AP    C H FCW C+ R        +R CP+C
Sbjct  195  TCPICLCADVQAPITLSCTHTFCWSCLSR---AAQHRFRSCPLC  235

>PYAP_13371
Length=482

 Score = 42.4 bits (98),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 33/83 (40%), Gaps = 15/83 (18%)

Query  95   DLEALTEWSSVEQVLLWYD-------VESPQTCPICMDTFRAPKITKCGHIFCWPCILRY  147
            D + + EW       LW D       +ES   C IC D F  P +  C H FC  C+ R+
Sbjct  2    DADDMDEW-------LWPDACPELRQMESTLRCLICGDFFHGPVLLPCTHTFCSECVRRF  54

Query  148  LSMTDKYWRRCPMCFESVQKGHL  170
            L         CP C +    G L
Sbjct  55   LQSRGASG-CCPECKQPCAPGDL  76

>PYIW_22999
Length=219

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query  120  CPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            CPIC+DT   P +T  CG  FC  C+   L+ T+     CPMC E +  G
Sbjct  27   CPICLDTLERPVLTTCCGQSFCDACLNAALAKTNA----CPMCREPLLSG  72

>PYAR_20140
Length=284

 Score = 42.0 bits (97),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 23/43 (53%), Gaps = 5/43 (12%)

Query  120  CPICMDTFRAPKI-TKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+DT   P + T CG  FC  C+   L+  D     CP+C
Sbjct  13   CPICLDTMETPMLATCCGRSFCRACLYAALAAVDA----CPLC  51

>PYAR_20457
Length=133

 Score = 40.0 bits (92),  Expect = 0.007, Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 5/43 (12%)

Query  120  CPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+DT   P +T  CG  FC  C+   L   D     CPMC
Sbjct  28   CPICLDTMSEPMLTTCCGQSFCRVCLDAALQRVDA----CPMC  66

>PITG_18462
Length=220

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI + +  + K    CP+C
Sbjct  169  CSICLDVLEDMTSTLCGHIFCACCIHQAIRASGK----CPLC  206

>PPTG_04005
Length=643

 Score = 42.4 bits (98),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+   + P    CGH+ CW C+ + LS     +  CP+C
Sbjct  92   CPICLRATQFPVRQDCGHVLCWSCMQQSLSS----FGVCPLC  129

>PHALS_13047
Length=594

 Score = 42.4 bits (98),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query  75   HANYRFVISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTF-RAPKIT  133
            H   R   S L    +V T     L      EQ+    +      C IC + F  A + T
Sbjct  179  HLGQRTAASALAVSNLVSTLAYPTLEPIPRDEQLEALENTRKMLECAICQEVFTNATEAT  238

Query  134  KCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
             CG IFC  CI R++S        CPMC E++
Sbjct  239  CCGQIFCKDCIERWVSERGS----CPMCREAI  266

>PHYSO_544210
Length=615

 Score = 42.4 bits (98),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTF-RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  245  CAICQEVFTNATEATCCGQIFCKECIERWVSERGS----CPMCREAI  287

>SDRG_06909
Length=240

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 52/219 (24%), Positives = 84/219 (38%), Gaps = 49/219 (22%)

Query  119  TCPICMDTFRAP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMC----------------  161
            TC +C   FR P  + +C H FC  CI +++   DK  R CP+C                
Sbjct  17   TCTLCNGYFRQPYTVRECIHTFCKSCIFKHIVTQDK--RACPVCEGPFGTYPLSGTKRKP  74

Query  162  --------FESVQKGHLRSVQLHQLQIP---------PHVDSDATF--QFLERPKSSMFP  202
                     E + K  L  + +   Q           PH  + AT   Q   + K     
Sbjct  75   PEIVQDHAMEGLVKKLLAKLDVQDAQDEVAFYAKHDIPHKSNTATGSSQAEVKFKKLKGK  134

Query  203  QLRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSINDVDATYSRILEATPAYLRELL  262
            QLR +   E++     ++ PP+ S  +   R +    +  +   Y RI +     LR++L
Sbjct  135  QLRVVLRPELK-----SLGPPDGSDESAPLRRKHFTYLWQLTERY-RIFDVK-ILLRKML  187

Query  263  YSEMRDLQSMDAEFRSSGDV----DNLPFVEEAMRNTSG  297
                R ++  D E R +G +      L F+++AM    G
Sbjct  188  RLRGRLVEPQDLEVRCAGQLLGKEHTLIFIQKAMWKKDG  226

>PYIR_13446
Length=424

 Score = 42.0 bits (97),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGH++C  CI   + +T K    CP+C
Sbjct  373  CSICLDVIEEMTSTTCGHVYCGKCIRLAIRVTAK----CPLC  410

>CCA18895
Length=274

 Score = 41.6 bits (96),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 36/84 (43%), Gaps = 9/84 (11%)

Query  95   DLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKY  154
            D  A +   S+E   +    ++   C IC+D       T CGH+FC  CI   +  T K 
Sbjct  198  DRCAASNGVSIENAEIIEQFKNSLKCSICLDLIDRMTSTICGHVFCRHCIRSAIRSTSK-  256

Query  155  WRRCPMCFESVQKGHLRSVQLHQL  178
               CP+C     +  LR   +H L
Sbjct  257  ---CPLC-----QRKLRIRDIHGL  272

>PHALS_07241
Length=290

 Score = 41.6 bits (96),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (48%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI   +    K    CP+C
Sbjct  239  CSICLDVLEDMTSTLCGHIFCAGCIHEAIRANGK----CPLC  276

>PPTG_24123
Length=993

 Score = 42.4 bits (98),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +C +C   F+ P+   C H FC  CIL +L   + +   CP+C
Sbjct  216  SCTLCGKIFQDPQCLDCKHNFCLQCILLHLKQNNSH---CPIC  255

>H257_13672
Length=293

 Score = 41.6 bits (96),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (57%), Gaps = 6/44 (14%)

Query  120  CPICMDTFR--APKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+DTF     +  +C H+FC PC+   L   DK    CP+C
Sbjct  79   CPICLDTFGELVVECAECAHVFCDPCMRESLKRKDK----CPLC  118

>H310_04140
Length=368

 Score = 42.0 bits (97),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            + C +C+     P +T CGH+FCW CI+ +     +    CP+C + V
Sbjct  313  KKCVLCLAERTHPSVTPCGHLFCWECIVGWCQNKPE----CPLCRQLV  356

>PPTG_06762
Length=597

 Score = 42.4 bits (98),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTF-RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  227  CAICQEVFSNATEATCCGQIFCKDCIERWVSERGS----CPMCREAI  269

>PHYCA_530915
Length=186

 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGH+FC  CI + +    K    CP+C
Sbjct  135  CSICLDVLENMTSTICGHVFCAVCIRQAIRANGK----CPLC  172

>HYAP_07106
Length=291

 Score = 41.6 bits (96),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI + +  + K    CP+C
Sbjct  240  CAICLDVLEDITSTVCGHIFCAGCICQAIRASGK----CPLC  277

>PYAR_14906
Length=590

 Score = 42.0 bits (97),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTFR-APKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  232  CAICQEVFTGATEATCCGQIFCKDCIERWVSERGS----CPMCRENI  274

>PYAP_13092
Length=277

 Score = 41.6 bits (96),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 59/136 (43%), Gaps = 18/136 (13%)

Query  86   EPDAV---VPTWDLEALTEWSSVEQVLL-WYDVESPQT------CPICMDTFRAPKITK-  134
            EPD V   VP  D+ AL      E         +SP++      CPIC+     P + K 
Sbjct  14   EPDVVSTTVPAIDVGALGSEEEGEHATTSCGGFDSPESALLGDQCPICLHDLDDPVMLKG  73

Query  135  CGHIFCWPCI---LRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQ  191
            C H++C+ C+   +R LS+       CP+C  +   G+   V   +  I   V  D T Q
Sbjct  74   CHHVYCYACVASWVRNLSLHGARTPTCPLCKRAFTAGYTDVVSETEYSI---VRFDGTLQ  130

Query  192  FLERPKSSMFPQLRAL  207
              +  ++  F Q RA+
Sbjct  131  RAQVSQAEGF-QRRAM  145

>PYVX_19183
Length=182

 Score = 40.4 bits (93),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 4/51 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            C IC+D       T CGH++C  CI   + +  K    CP+C   ++ G +
Sbjct  131  CTICLDVLNQMTSTICGHVYCARCIKAQIQINGK----CPLCQRRLKLGDI  177

>PHYKE_7837
Length=1447

 Score = 42.4 bits (98),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query  113   DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             D++    C +C D  +   I+KC H+FC  CI   L   +   R+CP C
Sbjct  1134  DLQKLVNCSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTC  1179

>PHYRA_79317
Length=595

 Score = 42.0 bits (97),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTF-RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  224  CAICQEVFTNATEATCCGQIFCKECIERWVSERGS----CPMCREAI  266

>PYIW_23779
Length=346

 Score = 41.6 bits (96),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 25/56 (45%), Gaps = 4/56 (7%)

Query  106  EQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +Q ++  D E    C IC   FR    T CGH FC  C L++   T     RC  C
Sbjct  231  DQYVIKSDDEEQFACTICRGPFRNAIETICGHFFCEACALKHFKKT----SRCFNC  282

>PHYCA_504243
Length=597

 Score = 42.0 bits (97),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTF-RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  226  CAICQEVFTNATEATCCGQIFCKECIERWVSERGS----CPMCREAI  268

>CCI49016
Length=539

 Score = 42.0 bits (97),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (44%), Gaps = 17/110 (15%)

Query  57   HHQKKKKSSAPRTQSEYLHANYRFVISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVES  116
            H   K ++   RT +  L A    V  PL P+  +P  +     +  S+E      +   
Sbjct  127  HSALKLRNRRQRTAASALAAT-NMVSMPLLPEEAIPRDE-----QMESIENTRKMLE---  177

Query  117  PQTCPICMDTFR-APKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
               C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  178  ---CAICQEVFTGATEATCCGQIFCKECIERWVSERGS----CPMCRENI  220

>H257_14373
Length=711

 Score = 42.0 bits (97),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  C+   L   +   R+CP C +   +  ++ V
Sbjct  658  CSVCQDAPKEVMISKCSHMFCKECMESNLKARN---RKCPTCKKMFGQDDVKGV  708

>PHYCA_103372
Length=143

 Score = 39.7 bits (91),  Expect = 0.012, Method: Composition-based stats.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  117  PQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            P  CP+C      P +   G++FC+PCI R++      +  CP+
Sbjct  84   PALCPLCKKQRANPAMAPSGYVFCYPCIYRHVEQ----YGECPI  123

>PYVX_23721
Length=610

 Score = 41.6 bits (96),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTFR-APKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  238  CAICQEVFTGATEATCCGQIFCKDCIERWVSERGS----CPMCRENI  280

>SPRG_12576
Length=240

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 3/44 (7%)

Query  119  TCPICMDTFRAP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TC +C   FR P  + +C H FC  CI +++   DK  R CP+C
Sbjct  17   TCTLCNGYFRQPYTVRECIHTFCKSCIFKHIVTQDK--RACPVC  58

>HYAP_05107
Length=906

 Score = 42.0 bits (97),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 3/61 (5%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D++    C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  +++
Sbjct  846  DLQKLVNCSVCQDRRKDVIISKCFHMFCKDCIETNLKARN---RKCPTCKKMFGQDDVKT  902

Query  173  V  173
            V
Sbjct  903  V  903

>CCA14023
Length=396

 Score = 41.2 bits (95),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  117  PQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            P +C +C+ T   P     GH+FC+PCI  Y+    K    CP+
Sbjct  334  PSSCSLCLKTRTNPAAASSGHVFCYPCIYEYVKRHHK----CPL  373

>SPRG_00527
Length=164

 Score = 39.7 bits (91),  Expect = 0.014, Method: Composition-based stats.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+D +     T CGH++C  CI   ++   K    CP+C
Sbjct  113  CPLCLDPYEEMASTTCGHVYCKECITLVVAKIHK----CPLC  150

>PYU1_G005703
Length=412

 Score = 41.2 bits (95),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 21/39 (54%), Gaps = 0/39 (0%)

Query  110  LWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYL  148
            L      P TCP+C      P ++  G++FC+PCI  Y+
Sbjct  346  LMLSTADPSTCPVCRQIRVNPAMSVSGYVFCYPCIYHYV  384

>PHYKE_8396
Length=160

 Score = 39.7 bits (91),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 27/59 (46%), Gaps = 9/59 (15%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQL  178
            C +C+D       T CGHIFC  CI + +    K    CP+C     + HL     H+L
Sbjct  109  CSVCLDVLENMTSTLCGHIFCAGCIHQAIRANGK----CPLC-----QRHLHPKDTHRL  158

>PHYRA_81091
Length=212

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  C+ + +    K    CP+C
Sbjct  161  CSICLDVLEDMTSTLCGHIFCAQCVHQAIRANGK----CPLC  198

>CCI39998
Length=396

 Score = 41.2 bits (95),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 4/44 (9%)

Query  117  PQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            P  C +C+ T   P  +  GH+FC+PCI  Y+    K  ++CP+
Sbjct  334  PSLCSLCLKTRTNPAASSSGHVFCYPCIYEYV----KRHQKCPL  373

>PYU1_G010079
Length=92

 Score = 38.1 bits (87),  Expect = 0.016, Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+ +  AP    CGH+ C  C  + +SM       CP+C
Sbjct  24   CPICLRSELAPIRQDCGHVLCLQCTHQAISMIGS----CPLC  61

>PHYCA_104632
Length=569

 Score = 41.2 bits (95),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (44%), Gaps = 19/85 (22%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQ  179
            C IC +T R P    C H+FC  C+  +      + R CP+C  SV              
Sbjct  503  CSICYETMRQPVKLVCSHMFCEECVTEWFD----HERSCPLCRASVGG------------  546

Query  180  IPPHVDSDATFQFLERPKSSMFPQL  204
              P  + +   QFL+  ++S+ PQL
Sbjct  547  --PTEEENVKPQFLD-GRTSLVPQL  568

>HYAP_04143
Length=470

 Score = 41.2 bits (95),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 24/44 (55%), Gaps = 4/44 (9%)

Query  117  PQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            P  CP+C      P +T  G++FC+PCI RY+    K    CP+
Sbjct  312  PAFCPLCKQKRVNPAMTDSGYVFCYPCIYRYVERHGK----CPI  351

>SPRG_07296
Length=505

 Score = 41.2 bits (95),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 4/52 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            CPIC++    P    C H FC  CI   LS    +   CP+C  +V+K  LR
Sbjct  20   CPICLEALERPFSLPCNHCFCEACINTALS----FATTCPVCKAAVRKRTLR  67

>PYAR_26477
Length=196

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 16/122 (13%)

Query  47   TLPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVISPLEPDAVVPTWDLEALTEWSSVE  106
            T P+  +H       + ++AP  +S+ + A  R     L P               S ++
Sbjct  3    TPPKASQHAQRDSNVRSTTAPEVESDRVLAADRHAPLLLPPPVA-----------SSVIQ  51

Query  107  QVLLWYDVESPQT--CPICMDTFRAPK---ITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             +  ++ V   ++  C +C+++   P+   +T CGH +C PC+  YL++  +     P C
Sbjct  52   TIASFFGVSGSKSLRCLVCLESVPEPQCVALTACGHKYCKPCLTMYLTVNIREGLVYPKC  111

Query  162  FE  163
            F+
Sbjct  112  FQ  113

>SPRG_21099
Length=119

 Score = 38.5 bits (88),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 35/75 (47%), Gaps = 7/75 (9%)

Query  91   VPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPK----ITKCGHIFCWPCILR  146
            V T    A T   +  +V L  D E    CPIC+D F +        +CGH F + C+L 
Sbjct  24   VATEAKAAATPQETTHKVTLLMDQEE---CPICLDEFESLGQSIFTGECGHKFHFTCLLE  80

Query  147  YLSMTDKYWRRCPMC  161
             ++  +    +CP+C
Sbjct  81   NVNHDEANATKCPIC  95

>PYAP_19190
Length=1248

 Score = 41.6 bits (96),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  113   DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYL-SMTDKYWRRCPMC  161
             +V S Q+C IC +    P    CGH+FC  C+  ++ S+ D     CP C
Sbjct  971   NVLSDQSCVICHEDVEDPVEATCGHVFCRECVKEFVESLPDGAAATCPDC  1020

>PYAP_23336
Length=562

 Score = 41.2 bits (95),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTFR-APKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  198  CAICQEVFTGATEATCCGQIFCKDCIERWVSERGS----CPMCRENI  240

>PYAR_21118
Length=414

 Score = 40.8 bits (94),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 31/76 (41%), Gaps = 2/76 (3%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D E    CP+C+D F       C H FC  CI  +   +      CP C   V+   +R+
Sbjct  231  DKERLMLCPVCLDYFSNSATLACSHTFCGHCISHWFRASSAL--SCPECRTGVRHMPVRN  288

Query  173  VQLHQLQIPPHVDSDA  188
              L  L      D+DA
Sbjct  289  RALDDLVHSLVGDTDA  304

>SPRG_11898
Length=149

 Score = 38.9 bits (89),  Expect = 0.021, Method: Composition-based stats.
 Identities = 14/43 (33%), Positives = 24/43 (56%), Gaps = 3/43 (7%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +CPIC++   A   + CGH +C+ CI  ++    +    CP+C
Sbjct  3    SCPICLEPATAAWTSPCGHAYCYACIAEWVR---RRQHTCPIC  42

>H257_07940
Length=369

 Score = 40.8 bits (94),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 27/53 (51%), Gaps = 7/53 (13%)

Query  116  SPQ---TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            SPQ    C +C+     P  T CGH+FCW CI+ +     +    CP+C + V
Sbjct  309  SPQRIKKCALCLAERSHPSATPCGHLFCWDCIVGWCQSKPE----CPLCRQLV  357

>PYIW_21541
Length=821

 Score = 41.2 bits (95),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I KC H+FC  C+   L   +   R+CP C +   +  +++V
Sbjct  768  CSVCQDQRKNVLIGKCFHMFCRDCVDSNLKSRN---RKCPTCKKMFGQDDVKAV  818

>PYIR_18633
Length=861

 Score = 41.2 bits (95),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I KC H+FC  C+   L   +   R+CP C +   +  +++V
Sbjct  808  CSVCQDQRKNVLIGKCFHMFCRDCVDNNLKSRN---RKCPTCKKMFGQDDVKAV  858

>PYAP_20783
Length=196

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 26/54 (48%), Gaps = 12/54 (22%)

Query  109  LLWYDVESPQTCPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMC  161
            LLW        CPIC+DT   P +T  CG  FC  C+   L+  D     CPMC
Sbjct  21   LLW-------KCPICLDTLHEPMLTTCCGQSFCRECLDAALAKADS----CPMC  63

>PYAR_25105
Length=437

 Score = 40.4 bits (93),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  114  VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            V+ PQ C +C +  R     KCGHI C PC   +  M +  +  CP+C
Sbjct  370  VKDPQ-CFVCYEITRKAYAAKCGHICCMPC---WQKMENDGFSSCPVC  413

>PHALS_11946
Length=492

 Score = 40.8 bits (94),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 26/61 (43%), Gaps = 1/61 (2%)

Query  101  EWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            EW          ++ES   C IC D F  P +  C H FC  C+ R+L     +   CP 
Sbjct  12   EWEWPADCKAQREMESHLRCQICGDYFHGPVLLPCSHTFCSACVRRFLQSKGAHG-CCPS  70

Query  161  C  161
            C
Sbjct  71   C  71

>CCA19978
Length=538

 Score = 40.4 bits (93),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  120  CPICMDTFR-APKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F  A + T CG IFC  CI R++S        CPMC E++
Sbjct  177  CAICQEVFTSATEATCCGQIFCKECIERWVSERGS----CPMCRENI  219

>PYVX_21138
Length=426

 Score = 40.4 bits (93),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (9%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            TCP+C+      +++ CGH+    CI R+L+ +     RCP+C E V
Sbjct  140  TCPVCLMDDVDTQLSACGHLLHAKCIKRWLAKS----ARCPVCREEV  182

>PYU1_G007124
Length=464

 Score = 40.4 bits (93),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (51%), Gaps = 5/57 (9%)

Query  118  QTCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            Q C IC++  R   +   CGH+F   CIL+ L +  +    CP+C     + HL S+
Sbjct  10   QECHICLEELRQDLVACPCGHVFHHACILQALQVNTQ----CPICRRYAAESHLISL  62

>H310_11926
Length=711

 Score = 40.8 bits (94),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  C+   L   +   R+CP C +   +  ++ V
Sbjct  658  CSVCQDAPKEVMISKCCHMFCKECMESNLKARN---RKCPTCKKMFGQDDVKGV  708

>SPRG_05381
Length=133

 Score = 38.1 bits (87),  Expect = 0.030, Method: Composition-based stats.
 Identities = 20/69 (29%), Positives = 35/69 (51%), Gaps = 3/69 (4%)

Query  108  VLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            VL+  DV+  + C IC+D    P    CGH F   C+ R  +        CP+C   ++ 
Sbjct  2    VLVEVDVDDIR-CAICLDVLTTPATLACGHSFDLRCVRRLRASPCAI--ACPVCRAPMKA  58

Query  168  GHLRSVQLH  176
             HL++++++
Sbjct  59   SHLQALRVN  67

>PYIW_13128
Length=425

 Score = 40.4 bits (93),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 24/44 (55%), Gaps = 4/44 (9%)

Query  119  TCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+   R+  +  +C H FC  CI + L + +   R CP C
Sbjct  81   TCPICLGVIRSTMVVMECLHRFCGECIQKSLRLGN---RECPSC  121

>PPTG_13607
Length=430

 Score = 40.4 bits (93),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (52%), Gaps = 5/56 (9%)

Query  116  SPQTCPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            S Q C IC++  R+  +   CGH+F   CI++ L +     ++CP+C  S     L
Sbjct  5    SNQECHICLEELRSDLVAAPCGHVFHHACIIQALQVN----KQCPICRRSTYDADL  56

>PYIR_19269
Length=460

 Score = 40.4 bits (93),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +TCP+C+      ++T+CGH     CI R++    +   RCP+C E V
Sbjct  230  ETCPVCLADDVDTQLTQCGHRIHAKCIKRWI----QSGTRCPVCREQV  273

>CCI42121
Length=582

 Score = 40.4 bits (93),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (49%), Gaps = 5/68 (7%)

Query  118  QTCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLH  176
            Q C IC++  +    T +CGH+F   CI   L    KY  +CP+C +S  +  +  +  +
Sbjct  230  QECLICLNELQTNLATIQCGHVFHLICIKEAL----KYKEQCPICRKSASRSFITPLYFN  285

Query  177  QLQIPPHV  184
              +   HV
Sbjct  286  LFEASAHV  293

>PYIW_21519
Length=467

 Score = 40.4 bits (93),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 5/54 (9%)

Query  118  QTCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q C IC++  R   +   CGH+F   CIL+ L + ++    CP+C     + HL
Sbjct  10   QECHICLEELRQDLVACPCGHVFHHACILQALQVNNQ----CPICRRFAAESHL  59

>SPRG_02199
Length=1007

 Score = 40.4 bits (93),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 4/53 (8%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q CP+C+D  ++P +T C H+ C  C+   L         CP+C   V    L
Sbjct  765  QECPVCLDVPQSPVLTPCAHLLCHECVRAALDTAPV----CPVCRADVGLDQL  813

>CCA20583
Length=365

 Score = 40.0 bits (92),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query  118  QTCPICMDTFRAP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLH  176
            Q C IC++  +      +CGH+F   CI        +Y ++CP+C +S  +  +  + L+
Sbjct  105  QECLICLNELQTNLAAVQCGHVFHLICIKEAF----EYKKQCPVCRKSASRSFITPLFLN  160

Query  177  QLQIPPHVDSD  187
              ++P H++ +
Sbjct  161  LNEVPAHIEEE  171

>PITG_06725
Length=765

 Score = 40.4 bits (93),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (2%)

Query  115  ESPQTCPICMDTFRAP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            ES  TC  CM  F  P  +  CGH +C  C+ +  S+       C MC  SV+K
Sbjct  656  ESTFTCLQCMQLFTEPMTLAPCGHTYCAACLAKCGSLEAPSSIACNMCEPSVKK  709

>PYU1_G013908
Length=402

 Score = 40.0 bits (92),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 39/85 (46%), Gaps = 18/85 (21%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQ  179
            C IC ++   P    C H+FC  C++ +        R CP+C  SV    LR     Q +
Sbjct  335  CSICYESMHLPVKLSCSHMFCEECVMEWFDRE----RSCPLCRASVATS-LR----EQDE  385

Query  180  IPPHVDSDATFQFLERPKSSMFPQL  204
            + P        QFL+   +S+FPQL
Sbjct  386  VKP--------QFLD-GSTSLFPQL  401

>PHYSO_441337
Length=313

 Score = 39.7 bits (91),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 18/65 (28%), Positives = 28/65 (43%), Gaps = 1/65 (2%)

Query  97   EALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWR  156
            + + EW          ++E+   C IC D F  P +  C H FC  C+ R++  +     
Sbjct  8    DMMDEWEWPANCKAQREMENHLRCQICGDFFHGPVLLPCSHTFCSACVRRFM-QSKGTNA  66

Query  157  RCPMC  161
             CP C
Sbjct  67   CCPQC  71

>H310_14328
Length=303

 Score = 39.7 bits (91),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 6/44 (14%)

Query  120  CPICMDTF--RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+DT+     +  +C H+FC PC+   L   DK    CP+C
Sbjct  84   CPICLDTYGDMVVECAECAHVFCDPCMRESLKRKDK----CPLC  123

>PYVX_16734
Length=277

 Score = 39.7 bits (91),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query  120  CPICMDTFRAPKI-TKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            CPIC++TFR P + T CG  FC  C+   L   D     CP+C   +  G
Sbjct  12   CPICLETFREPMLATCCGQSFCRSCLDAALRRCDA----CPVCRAPLLAG  57

>SDRG_10961
Length=1005

 Score = 40.4 bits (93),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 4/53 (8%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q CP+C+D  ++P +T C H+ C  C+   L         CP+C   V    L
Sbjct  763  QECPVCLDVPQSPVLTPCAHLLCHECVRAALETAPV----CPVCRADVGLDQL  811

>PYIW_19621
Length=1161

 Score = 40.4 bits (93),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 23/48 (48%), Gaps = 4/48 (8%)

Query  114   VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             VE PQ C +C D  R     +CGHI C  C   +  M    +  CP+C
Sbjct  1096  VEDPQ-CVVCYDITRKAYAAQCGHICCMGC---WKKMEKDGFTSCPLC  1139

>H310_00896
Length=407

 Score = 40.0 bits (92),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQ  174
            ESP  CP+C + F       C H FC  C+  +L ++      CP C  +V    +R+  
Sbjct  218  ESPLKCPVCFEYFVDSLTLTCSHTFCGNCLRSWLQLS----LTCPTCRVAVTDFPVRTRA  273

Query  175  LHQLQI  180
            L  L +
Sbjct  274  LDNLCV  279

>PYIR_22040
Length=457

 Score = 39.7 bits (91),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (2%)

Query  113  DVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            ++E+   C IC D F  P +  C H FC  C+ +YL     +   CP C ++ 
Sbjct  15   EMENLLRCQICGDFFHGPVLLPCSHAFCSECVRKYLQTKGAHG-CCPECKQAC  66

>PHALS_04027
Length=590

 Score = 40.0 bits (92),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 22/46 (48%), Gaps = 4/46 (9%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC +  R P    C HIFC  C+  +      + R CP+C  +V
Sbjct  524  CSICYERMRQPVKLACSHIFCEECVTEWF----DHERSCPLCRATV  565

>PHALS_06891
Length=546

 Score = 39.7 bits (91),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (52%), Gaps = 9/58 (16%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQ  177
            C +C+ T    +I+ CGHIF   C LR+  +     R CP+C     +G +  VQL Q
Sbjct  115  CSVCLSTNAYAQISSCGHIFHPNCFLRWFRLN----RSCPLC-----RGAVDKVQLAQ  163

>PYIW_18435
Length=961

 Score = 40.0 bits (92),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (55%), Gaps = 9/62 (15%)

Query  117  PQTCPICMD--TFRAPK---ITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            P  C IC+D  T   P      KCGH+F   CI R++ +T K    CP+C  +V+K  +R
Sbjct  178  PTECTICIDACTLAGPHRLVALKCGHLFGKLCIERWV-LTKKT---CPICNAAVRKPDIR  233

Query  172  SV  173
            ++
Sbjct  234  AL  235

 Score = 33.1 bits (74),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 26/60 (43%), Gaps = 9/60 (15%)

Query  117  PQTCPICMDTFRAPK-----ITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            P  C IC D             KCGH+F   CI R++       + CP C  +V+K  +R
Sbjct  399  PTECTICYDPCMISGRHRLAALKCGHLFGKKCIERWV----LERKSCPNCNVAVKKADIR  454

>H310_01196
Length=592

 Score = 39.7 bits (91),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (47%), Gaps = 5/66 (8%)

Query  106  EQVLLWYDVESPQTCPICMDTFR-APKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFES  164
            EQ+ +  +      C IC + F  A + T CG IFC  CI R++S        CPMC + 
Sbjct  225  EQLEVLENTRKMLECAICQEIFTGATEATCCGQIFCKLCIERWVSERSS----CPMCRDE  280

Query  165  VQKGHL  170
            +    L
Sbjct  281  LNFAQL  286

>PPTG_18592
Length=1094

 Score = 40.0 bits (92),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  114   VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             V+ PQ C +C D  R    ++CGHI C PC   +  M    +  CP+C
Sbjct  1026  VKDPQ-CFVCYDITRKAYASQCGHICCHPC---WKKMEKDGFTSCPVC  1069

>SDRG_10501
Length=685

 Score = 39.7 bits (91),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (55%), Gaps = 1/33 (3%)

Query  115  ESPQTCPICMDTFRAP-KITKCGHIFCWPCILR  146
            ES  TC +CM     P  +  CGH FC  C++R
Sbjct  591  ESTFTCLLCMQVLEQPMTLVGCGHTFCRRCVVR  623

>PYAP_15145
Length=381

 Score = 39.3 bits (90),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 4/52 (8%)

Query  114  VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            V+  +TCP+C+      +++ CGH     CI R++    K    CP+C E V
Sbjct  112  VQVGETCPVCLTDDVDTQLSNCGHRVHAKCIKRWIQSGSK----CPVCREPV  159

>PITG_03761
Length=431

 Score = 39.3 bits (90),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (54%), Gaps = 5/56 (9%)

Query  116  SPQTCPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            S Q C IC++  R+  +   CGH+F   C+++ L    ++ ++CP+C  S     L
Sbjct  5    SNQECHICLEDLRSNLVAAPCGHVFHHACVIQAL----QFNKQCPICRRSTYDADL  56

>PYAR_21305
Length=373

 Score = 39.3 bits (90),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  118  QTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +TCP+C+      +++ CGH     CI R++    K    CP+C E V
Sbjct  127  ETCPVCLADDVDTQLSNCGHRVHAKCIKRWIQSGSK----CPVCREVV  170

>PYIR_25281
Length=356

 Score = 39.3 bits (90),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 23/53 (43%), Gaps = 4/53 (8%)

Query  109  LLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            ++  D E    C IC   FR    T CGH FC  C L++   T     RC  C
Sbjct  241  VIKSDDEEQFACTICRGPFRNAIETICGHFFCEACALKHFKKTS----RCFNC  289

>PHYRA_75992
Length=158

 Score = 37.7 bits (86),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 21/43 (49%), Gaps = 5/43 (12%)

Query  120  CPICMDTFRAPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+  F  P +   CG  FC PC+   L   D     CPMC
Sbjct  9    CPICLGGFERPVLASCCGQSFCRPCLDAALRQVDA----CPMC  47

>PYIR_16517
Length=583

 Score = 39.7 bits (91),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (45%), Gaps = 15/85 (18%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQ  179
            C IC +    P    C H+FC  C++ +        R CP+C  ++     R  +  Q +
Sbjct  513  CSICYEEMHQPVKLSCSHMFCEECVMEWFDRE----RSCPLCRANMAATSDRGGE--QDE  566

Query  180  IPPHVDSDATFQFLERPKSSMFPQL  204
            + P        QFL+   +S+FPQL
Sbjct  567  VKP--------QFLD-GSTSLFPQL  582

>PYAR_13579
Length=365

 Score = 39.3 bits (90),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 27/59 (46%), Gaps = 9/59 (15%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQL  178
            C +C++       T CGH++C  CI   + +T K    CP+C        LR   +H L
Sbjct  314  CSVCLEVIEDMTSTICGHVYCAKCIRLAIRVTHK----CPLCQRP-----LRPTDIHGL  363

>PYIW_16105
Length=397

 Score = 39.3 bits (90),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 4/44 (9%)

Query  119  TCPICMDT-FRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +CPIC+ T  ++P    C H FCW C+ +     +  +  CP+C
Sbjct  196  SCPICLSTEVKSPITLACAHTFCWSCLSK---AAEHRFNSCPLC  236

>PITG_06792
Length=1058

 Score = 39.7 bits (91),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  114   VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             V+ PQ C +C D  R    ++CGHI C PC   +  M    +  CP+C
Sbjct  997   VKDPQ-CFVCYDITRKAYASQCGHICCHPC---WKKMEKDGFTSCPVC  1040

>CCI47251
Length=415

 Score = 39.3 bits (90),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query  107  QVLLWYDVESPQTCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +VL   D+ S  TCPIC+       +  +C H FC  CI + L +  K    CP C
Sbjct  62   KVLHVRDLNSNLTCPICLGLINQTMVVMECLHRFCGDCIQKCLRLAIK---ECPSC  114

>PYU1_G001639
Length=614

 Score = 39.3 bits (90),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 27/56 (48%), Gaps = 9/56 (16%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL  175
            C +C+      +I  CGH F   C LR+  M     R CP+C     +GH+  +QL
Sbjct  152  CSVCLSANAYAQIASCGHTFHSKCFLRWFRMN----RSCPLC-----RGHVDKIQL  198

>PPTG_11049
Length=675

 Score = 39.3 bits (90),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 38/85 (45%), Gaps = 8/85 (9%)

Query  115  ESPQTCPICMDTFRAP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            ES  TC  CM  F  P  +  CGH +C  C+ +  S+       C MC ES  K  +  +
Sbjct  566  ESTFTCLQCMQLFTQPMTLAPCGHTYCAACLTKCGSIDVPSSIVCKMC-ESGIKKEMECI  624

Query  174  QLHQLQIPPHVDSDATFQFLERPKS  198
                   P +  +D T +F+ R +S
Sbjct  625  ------FPNYALADLTARFIFRQQS  643

>PYIR_19863
Length=652

 Score = 39.3 bits (90),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 27/56 (48%), Gaps = 9/56 (16%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL  175
            C +C+      +I  CGH F   C LR+  M     R CP+C     +GH+  VQL
Sbjct  170  CSVCLSANAYAQIALCGHTFHSKCFLRWFRMN----RSCPLC-----RGHVDKVQL  216

>PHYSO_469986
Length=361

 Score = 38.9 bits (89),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 24/52 (46%), Gaps = 3/52 (6%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQ  166
            +  Q C IC      P  T C H FC  C+ ++ S   +    CPMC  S++
Sbjct  313  KKTQPCTICFGNIDHPITTSCSHTFCAGCLAKWRSGGHEL---CPMCRSSLK  361

>PHYSO_476986
Length=361

 Score = 38.9 bits (89),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 24/52 (46%), Gaps = 3/52 (6%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQ  166
            +  Q C IC      P  T C H FC  C+ ++ S   +    CPMC  S++
Sbjct  313  KKTQPCTICFGNIDHPITTSCSHTFCAGCLAKWRSGGHEL---CPMCRSSLK  361

>PYIR_18310
Length=678

 Score = 39.3 bits (90),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 24/53 (45%), Gaps = 4/53 (8%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            +C IC+  +  P    C H FC  CI R L +       CP+C    +K  LR
Sbjct  2    SCAICLCAYANPSSLPCNHCFCEECIHRALELKPV----CPICKAPAKKRKLR  50

>CCA16906
Length=423

 Score = 38.9 bits (89),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query  107  QVLLWYDVESPQTCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +VL   D+ S  TCPIC+       +  +C H FC  CI + L +  K    CP C
Sbjct  70   KVLHVRDLNSNLTCPICLGLINQTMVVMECLHRFCGECIQKCLRLAIK---ECPSC  122

>PYAR_16668
Length=448

 Score = 38.9 bits (89),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query  119  TCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKY-WRRCPMC  161
            +CPIC+       IT  C H FCW C    LSM  ++ +  CPMC
Sbjct  200  SCPICLQNEVKSAITLSCKHTFCWSC----LSMAAEHRFHSCPMC  240

>PYIR_23183
Length=433

 Score = 38.9 bits (89),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+   R   +  +C H FC  CI + L + +K    CP C
Sbjct  85   TCPICLGVIRNTMVVMECLHRFCGECIQKCLRLGNK---ECPSC  125

>H310_01980
Length=479

 Score = 38.9 bits (89),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC DT + P   +C H+FC  CI  +        R CP+C
Sbjct  412  CSICYDTMQTPVQLQCAHLFCEECIAEWFDRE----RSCPLC  449

>PYIR_18043
Length=462

 Score = 38.9 bits (89),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query  115  ESPQTCPICMDT-FRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            E   +CPIC+    ++P    C H FCW C+ +     +  +  CP+C
Sbjct  188  ECAASCPICLSAEVKSPITLSCAHTFCWSCLSK---AAEHRFNSCPLC  232

>PHYSO_358215
Length=368

 Score = 38.9 bits (89),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 21/46 (46%), Gaps = 4/46 (9%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            CPIC +    P  T C H FC  C+ R+L         CP C + +
Sbjct  168  CPICCEDLTDPFTTACRHTFCTVCLFRWLETKST----CPACRQPI  209

>H310_12571
Length=784

 Score = 39.3 bits (90),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (49%), Gaps = 3/45 (7%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFE  163
            +CPIC+    +P    C H FCW C+ +  +        CP+C E
Sbjct  193  SCPICLYPHTSPVTLGCHHTFCWSCLAKAAAHHIH---ACPLCRE  234

>SDRG_04254
Length=506

 Score = 38.9 bits (89),  Expect = 0.085, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 24/52 (46%), Gaps = 4/52 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            CPIC++    P    C H FC  CI   L     +   CP+C   V+K  LR
Sbjct  20   CPICLEALSRPFSLPCNHFFCEACIHTALG----FATTCPVCKAMVRKRTLR  67

>H257_08184
Length=173

 Score = 37.7 bits (86),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 23/42 (55%), Gaps = 1/42 (2%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC DTF  P +T CGH FC  C+  + S   +    CP+C
Sbjct  11   CAICYDTFYFPFVTSCGHAFCHQCLTDWTS-GHRQSTSCPLC  51

>PYAP_15538
Length=443

 Score = 38.9 bits (89),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  115  ESPQTCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            E   +CPIC+ +     IT  C H FCW C+ + +   +  +  CPMC
Sbjct  180  EHKVSCPICLQSEVKSAITLSCKHTFCWSCLSKAV---EHRFHSCPMC  224

>SPRG_03958
Length=472

 Score = 38.9 bits (89),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (55%), Gaps = 1/33 (3%)

Query  115  ESPQTCPICMDTFRAP-KITKCGHIFCWPCILR  146
            ES  TC +CM     P  +  CGH FC  C++R
Sbjct  378  ESTFTCLLCMQVLAQPMTLVGCGHTFCRRCVVR  410

>PHALS_00658
Length=397

 Score = 38.9 bits (89),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYL  148
            CP+C      P +T  G +FC+PCI RY+
Sbjct  329  CPLCKKKRVNPAMTSSGFVFCYPCIYRYV  357

>PYU1_G002995
Length=448

 Score = 38.9 bits (89),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +CPIC+ T     IT  C H FCW C+ +     +  +  CP+C
Sbjct  192  SCPICLSTEVKTSITLACAHTFCWSCLSK---AAEHRFNSCPLC  232

>PPTG_11751
Length=834

 Score = 38.9 bits (89),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 24/52 (46%), Gaps = 4/52 (8%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            C IC+  +  P    C H FC  CI R L +  +    CP+C    +K  LR
Sbjct  48   CAICLCAYDNPVSLPCNHCFCEECIHRALELKAQ----CPICKTPAKKRRLR  95

>PYAP_19146
Length=407

 Score = 38.9 bits (89),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 4/42 (10%)

Query  119  TCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            TCPIC      P  +  G++FC+PCI R++    +  R CP+
Sbjct  351  TCPICQKRRVNPAASVSGYVFCYPCIYRHV----EEHRACPV  388

>PYU1_G003426
Length=492

 Score = 38.9 bits (89),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (46%), Gaps = 0/48 (0%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            C +CMD  R      CGHI      L  +   D Y   CP+C  ++Q+
Sbjct  438  CVVCMDAERDAICVPCGHIAGCHTCLSAIKQQDPYRASCPICRTTIQR  485

>H257_11542
Length=244

 Score = 38.1 bits (87),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 27/55 (49%), Gaps = 1/55 (2%)

Query  115  ESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGH  169
            E+  TCPIC+   +    T CGH FC  C+  Y + + +    CP C + +   H
Sbjct  55   ETQPTCPICLSDVQLACETNCGHSFCTSCLTSYFA-SRRVAYPCPCCRQHIHLVH  108

>PYAR_23187
Length=417

 Score = 38.5 bits (88),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query  107  QVLLWYDVESPQTCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            + LL   + +  TCPIC+   R  ++  +C H FC  CI R L +       CP C
Sbjct  61   RTLLVRVLNAELTCPICLGIIRQTEVVMECLHRFCGDCIQRSLRVGKN---ECPSC  113

>CCA26695
Length=297

 Score = 38.5 bits (88),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 24/53 (45%), Gaps = 4/53 (8%)

Query  109  LLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            L+  D +    C IC   F+    T CGHIFC  C L++   T     RC  C
Sbjct  220  LVSDDADEQFACTICRQPFQDAVKTICGHIFCEKCALKHFRKTS----RCFNC  268

>CCA23479
Length=297

 Score = 38.5 bits (88),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 24/53 (45%), Gaps = 4/53 (8%)

Query  109  LLWYDVESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            L+  D +    C IC   F+    T CGHIFC  C L++   T     RC  C
Sbjct  220  LVSDDADEQFACTICRQPFQDAVKTICGHIFCEKCALKHFRKTS----RCFNC  268

>PHYRA_96819
Length=796

 Score = 38.9 bits (89),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 34/82 (41%), Gaps = 13/82 (16%)

Query  114  VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC-FESVQ----KG  168
            +E+   C IC  T   P    CGH FC  C++           +CP+C  E +Q    K 
Sbjct  117  LEAELQCIICQYTMFKPVSVICGHSFCRVCLMDSFLTRSIEEAQCPICRVEILQPFSAKS  176

Query  169  HLRSV--------QLHQLQIPP  182
             L S+         L QL IPP
Sbjct  177  SLSSIFSINVTLWNLVQLLIPP  198

>PYU1_G009791
Length=407

 Score = 38.5 bits (88),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 13/75 (17%)

Query  114  VESPQTCPICMDTF---RAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            V+  + C IC+DT     A   T CGH F W C+    S     + +CP C         
Sbjct  214  VQEAEECAICLDTMDVGHAIYTTACGHSFHWSCLKEIQSSDSSNYDKCPSC---------  264

Query  171  RSVQLHQLQIPPHVD  185
            R++ + ++Q+  H D
Sbjct  265  RAI-MTEMQVKKHCD  278

>PYIR_15591
Length=446

 Score = 38.5 bits (88),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query  118  QTCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q C IC++  R   +   CGH+F   CIL+ L +  +    CP+C     + HL
Sbjct  10   QECHICLEELRQDLVACPCGHVFHHACILQALQVNTQ----CPICRRFAAESHL  59

>SDRG_04070
Length=185

 Score = 37.4 bits (85),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 5/44 (11%)

Query  120  CPICMDTFRAPKI--TKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+DTF    +    C  +FC  C+   L+   +  RRCP+C
Sbjct  56   CPVCLDTFAGAVVECNACAQVFCESCLQACLT---RQSRRCPLC  96

>PYU1_G013365
Length=413

 Score = 38.5 bits (88),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICMDTFRAPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+   R   +  +C H FC  CI + L + +K    CP C
Sbjct  80   TCPICLGIIRNTMVVMECLHRFCGECIQKCLRLGNK---ECPSC  120

>PYAR_17919
Length=101

 Score = 35.8 bits (81),  Expect = 0.11, Method: Composition-based stats.
 Identities = 23/70 (33%), Positives = 32/70 (46%), Gaps = 15/70 (21%)

Query  120  CPIC---MDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLH  176
            C +C   + T R   +T C H FC  CI R L+    +   CP+C   V+        +H
Sbjct  3    CALCDAPLSTTRDRGLTDCAHEFCLACICRQLT---DFRNLCPVCGRKVK-------TVH  52

Query  177  QLQIPPHVDS  186
            QLQ  P  D+
Sbjct  53   QLQ--PESDT  60

>PHALS_01600
Length=470

 Score = 38.5 bits (88),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (44%), Gaps = 13/89 (15%)

Query  120  CPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRR----CPMCFESVQKGHLRSVQL  175
            CP+C+D F +     C H FC  CI          W R    CP C + V+   +R+  L
Sbjct  270  CPVCLDYFNSSATLPCSHTFCGLCI--------SSWFRNSLSCPECRDIVKTLPIRNRAL  321

Query  176  HQLQIPPHVDSDATFQFLERPKSSMFPQL  204
             +L +   V     ++ L R ++ M  +L
Sbjct  322  DEL-VEGLVGQKEAYKSLIRRRALMQRRL  349

>PHYSO_326395
Length=859

 Score = 38.5 bits (88),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 1/54 (2%)

Query  115  ESPQTCPICMDTFRAP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            ES  TC  CM  F  P  +  CGH +C  C+ +  ++       C MC   V+K
Sbjct  751  ESTFTCLQCMQLFTQPMTLAPCGHTYCAACLAKCGNVDIPSSITCKMCESGVKK  804

>H257_04593
Length=247

 Score = 37.7 bits (86),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (42%), Gaps = 10/86 (12%)

Query  120  CPICMDTFRAP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQL  178
            C +C   FR P  I +C H FC  CI +Y+        +CP+C        L   +    
Sbjct  17   CTLCHGYFRQPYTIRECIHTFCKSCIFKYI--VSGVGNQCPICQLEFGTYPLSGTKTK--  72

Query  179  QIPPHVDSDATFQFLERPKSSMFPQL  204
              PP +  D   + L +    +FPQL
Sbjct  73   --PPQIVQDHVMEGLVK---KLFPQL  93

>PYAP_19539
Length=777

 Score = 38.5 bits (88),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query  115  ESPQTCPICMDTFRAP-KITKCGHIFCWPCI  144
            ES  TC  CM  F +P  +T CGH FC  C+
Sbjct  679  ESTFTCMQCMQLFVSPLTLTPCGHTFCTSCV  709

>PYU1_G010249
Length=1080

 Score = 38.5 bits (88),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (48%), Gaps = 4/48 (8%)

Query  114   VESPQTCPICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             V+ PQ C +C D  R     +CGHI C  C   +  M    +  CP+C
Sbjct  1017  VKDPQ-CVVCYDITRKAYAAQCGHICCMGC---WKKMEKDGFTSCPLC  1060

Lambda      K        H        a         alpha
   0.317    0.130    0.393    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 47809178505

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40