Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_81095541181381387103e-97
PYAR_264491070602111362721e-29
PHYCA_131788433712161372702e-29
PHYCA_123502426032901042603e-27
PHYSO_3795485411864632132e-22
PHYCA_12765467012581392262e-22
PPTG_070286701195782197e-22
PHYRA_807747119410721392211e-20
PHYRA_783504055811901392192e-20
PHYRA_870417341610581382182e-20
PHYSO_333190516106191402069e-19
PHYSO_415226550973101332021e-18
PHYCA_101315404651601361942e-18
PHYCA_106763410971251251893e-18
PYAR_22624104850102981865e-18
PHYCA_106692410833301381979e-18
PHYCA_118513422021601361881e-17
PHYCA_105797409791601361881e-17
PHYCA_126068428291551331862e-17
CCA222621403088451441911e-16
PPTG_20423253071891391831e-16
PYAR_261301068183111341871e-16
PPTG_24067285096371501883e-16
PHYRA_756027012613191201874e-16
PHYRA_86868733089161361874e-16
PHYRA_8442299448941361864e-16
PYAR_235781052944071181831e-15
PHYSO_519621594911321131712e-15
PHYRA_836921143326131361813e-15
PHYRA_85571724983811061777e-15
PHYCA_124508426765071361779e-15
PHYRA_74652548326361361761e-14
PHYRA_777644658117281381751e-14
PHYRA_87090734577911401742e-14
PHYCA_108911412822741361712e-14
PHYCA_104401130503141361697e-14
PYAR_223141047174681041707e-14
PYAR_26570516102011041647e-14
PHYSO_530693602483321041671e-13
H257_0696212697113571491662e-13
PHYCA_518853867987631542e-13
PHYRA_854297240714851361629e-13
PHYSO_34210699445681411611e-12
PYAR_230501050422651141553e-12
CCA2570899449041191574e-12
PYIW_176141658664641511556e-12
PYVX_23916602484111331548e-12
PPTG_23088276249771351531e-11
PHYRA_85914726935711371503e-11
PHYCA_132571435472941141485e-11
PHYCA_624423904792551386e-11
PITG_0803467012681221451e-10
PHYCA_12203342495451571442e-10
PHYCA_13370943829220551412e-10
PPTG_21423261211351251373e-10
PHYRA_85792726185431361433e-10
PHYCA_97306401213871391414e-10
PHYSO_482594571261441401364e-10
H310_114001415225351321408e-10
PHYSO_388784543712641141371e-09
PYIW_274611668131581401322e-09
PHYSO_3096206701323861353e-09
PHYCA_114143418581021031264e-09
PYAR_2670794383172521304e-09
PHYSO_261195177974811141344e-09
PPTG_00243178852321331316e-09
PHYSO_374083539021021141257e-09
PHYCA_9875940254197981307e-09
PHYSO_4161571243698981231e-08
PHYSO_40376654636184561272e-08
H257_132071441775171491302e-08
PHYCA_10240440598122531232e-08
PHYCA_123491426022911441282e-08
H310_039081441772421501272e-08
PHYRA_78352706493701421292e-08
H257_1470514491912301351292e-08
PHYSO_412316126971188561262e-08
PHYCA_68972391792321151273e-08
PYIW_163401645252071331253e-08
H310_133541391595071521274e-08
PHYCA_6575073416453661274e-08
SDRG_173721278966951721274e-08
SDRG_173671384336741721274e-08
PHYRA_8550772450686651265e-08
PHYCA_119571422901571101226e-08
PHYSO_408655548301541081201e-07
PHYCA_12758442961124521181e-07
PHYSO_41362155026120551181e-07
PHYCA_96803400642921171221e-07
PHYCA_103492407442101031202e-07
PYIW_170691653652521151212e-07
H310_108911501826481541222e-07
PHYRA_77067704001021971212e-07
H257_18441123826261471204e-07
PHYCA_625433906499971134e-07
PHYSO_53267335741851081174e-07
PHALS_04869316291291341145e-07
PHYSO_299586484422671771185e-07
PHYCA_13135743336270761185e-07
PHYCA_723503937593971116e-07
PHYRA_81909714248401601186e-07
PHYCA_424343822893971109e-07
PITG_1901215117111631119e-07
PHYCA_13303243672110511119e-07
PHYRA_78074357410981201161e-06
PHALS_1186634668117571101e-06
PHYCA_111030415201191091101e-06
PHYRA_85982727285521361142e-06
PHALS_047106701140571093e-06
PPTG_23990128455571591133e-06
PHYSO_35471853545125551083e-06
PHYRA_8682773281813651133e-06
PHYCA_10731141136186341095e-06
H310_125221505892251631089e-06
H310_046141487822311491089e-06
H257_189541474076571521081e-05
H257_1380814445912391251081e-05
PPTG_16122234693701731072e-05
H257_1337714428610791571072e-05
PHYCA_12812143009109931012e-05
PPTG_22307757910441761072e-05
H310_025661483354531471062e-05
PYVX_23592727282901161053e-05
PHYSO_403711546342291361043e-05
PYAR_15076102422475811053e-05
PHYCA_100340178852291381044e-05
PHYSO_4340015557210940994e-05
PHYCA_11932442260461571045e-05
PYAP_2302494383252441026e-05
PHYRA_86147546349561791037e-05
PHYRA_859341514614021641037e-05
PHYCA_78763395372721221028e-05
H257_099101425428561621021e-04
H257_0776214152212521561021e-04
PHYSO_457550560355745931e-04
PHYRA_8367040711908481011e-04
H257_020961391593301591001e-04
PHYCA_1066524107215656981e-04
H310_01656148167263155992e-04
PHYCA_103334407194938922e-04
H310_01813143700824971002e-04
H257_01623138974137053992e-04
PYAR_2519510166842545992e-04
PHYRA_8567548442720173992e-04
PHYSO_419503724077850932e-04
PITG_040733574178104973e-04
H257_04448140128363100983e-04
H310_0116014810017754963e-04
PHYCA_1220304249430847983e-04
H310_15218142886706140983e-04
H257_1233014370073571983e-04
H257_14645670175353983e-04
PHYCA_12528842744147138953e-04
PHYCA_123947426399650924e-04
H310_14304146931238142964e-04
PHYRA_8558872509167788965e-04
H257_0488914030289071966e-04
H257_1879014726934179966e-04
H310_105951501059940916e-04
H310_13336145027615166957e-04
H257_0947314232785471957e-04
SPRG_08815126561290133948e-04
PHYCA_174667240738550949e-04
PHYCA_51481386425147860.001
H257_0905312656160653930.001
PYAP_2533210187017544910.002
CCA1701515288686557920.002
PPTG_21201259108268860.002
PHYCA_1133794175714558890.002
H310_1374115094012538880.002
PYVX_244395567322551900.002
H310_14634151227420134910.003
PHYCA_126315428496350840.003
PHYCA_1256914278733852900.003
H310_10924150191612178900.003
PYIW_2304316372310849860.003
PHYCA_53504388326861840.004
PHYCA_1054974094119445880.004
PHYSO_378048390645147820.005
PHYCA_4815238409217103880.005
H310_0719314925650752890.005
PHYCA_12358842612206105870.006
CCA2753115798240651880.006
PHYSO_3749975393310851850.006
PHYCA_102337405899457840.006
PHYCA_963704000847952870.007
H310_1283415070068651870.009
PHYCA_960031238244550860.010
CCA2684015756611355830.010
PYAR_2222410468569955870.010
H310_14627151221635156860.012
H310_097561498611268171860.012
PYIW_281511677407454800.013
SPRG_20927670150252850.014
PPTG_227022727954995850.014
PHYCA_12837243045286106850.015
H310_042561412741174150850.016
H257_1568214545970547850.017
PHYCA_154633721933950840.018
PYIW_266971659859368800.020
PHYSO_4326935551512143810.021
H310_0461514878323452830.023
PYIR_252345161035851830.024
CCA24593156436216112820.026
CCA215854844217955820.027
PHYSO_4085915482514042810.028
PHYCA_53569388366352770.029
H310_0346814855433843810.049
H257_181601468529446770.053
PPTG_063221995221456790.066
PHYCA_1008984042611298770.070
H257_16271145790324157790.075
H257_13188144159714157790.099
H310_02779148377794160790.10
H310_15126151491100757790.10
H257_1204614352881150780.12
PHYRA_7745670460106755780.13
H310_1258815061136246780.13
H310_1360514352881828780.14
PHYCA_1288094308335994770.15
PHYCA_1283154302639618770.15
PITG_12173994454169770.16
H310_126757447718888760.19
H310_0846014953543628760.22
PHYCA_986704024612151740.23
PITG_224371722510248730.24
CCA2665115746637857760.24
PYU1_G0118759658812249730.25
H257_0546614056447939760.27
H310_1252515059233761750.33
PHYRA_8504372238129249750.34
PHYSO_3095144947512893730.34
H257_1210514357918355740.35
H257_148411450271343172740.41
PHYRA_848177218071996740.41
CCA1669015271678254740.42
H257_1805814678580336740.44
PHYCA_82928398258944700.47
H257_0938714229631854730.48
H257_1029115095650847740.49
PYAR_2618838409291103730.51
PPTG_21839264937453690.51
H310_100041499276246680.54
H310_1204715044458485730.56
PHYCA_123542357417750710.72
PHYCA_1030424068032449720.76
PYAR_13535597156494720.88
PHYCA_1026684063111418690.90
PHYSO_5152921340711218690.93
PPTG_217571779744452711.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81095

Length=139
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYRA_81095                                                           278     3e-97
PYAR_26449                                                            109     1e-29
PHYCA_131788                                                          108     2e-29
PHYCA_123502                                                          104     3e-27
PHYSO_379548                                                          86.7    2e-22
PHYCA_127654                                                          91.7    2e-22
PPTG_07028                                                            89.0    7e-22
PHYRA_80774                                                           89.7    1e-20
PHYRA_78350                                                           89.0    2e-20
PHYRA_87041                                                           88.6    2e-20
PHYSO_333190                                                          84.0    9e-19
PHYSO_415226                                                          82.4    1e-18
PHYCA_101315                                                          79.3    2e-18
PHYCA_106763                                                          77.4    3e-18
PYAR_22624                                                            76.3    5e-18
PHYCA_106692                                                          80.5    9e-18
PHYCA_118513                                                          77.0    1e-17
PHYCA_105797                                                          77.0    1e-17
PHYCA_126068                                                          76.3    2e-17
CCA22262                                                              78.2    1e-16
PPTG_20423                                                            75.1    1e-16
PYAR_26130                                                            76.6    1e-16
PPTG_24067                                                            77.0    3e-16
PHYRA_75602                                                           76.6    4e-16
PHYRA_86868                                                           76.6    4e-16
PHYRA_84422                                                           76.3    4e-16
PYAR_23578                                                            75.1    1e-15
PHYSO_519621                                                          70.5    2e-15
PHYRA_83692                                                           74.3    3e-15
PHYRA_85571                                                           72.8    7e-15
PHYCA_124508                                                          72.8    9e-15
PHYRA_74652                                                           72.4    1e-14
PHYRA_77764                                                           72.0    1e-14
PHYRA_87090                                                           71.6    2e-14
PHYCA_108911                                                          70.5    2e-14
PHYCA_104401                                                          69.7    7e-14
PYAR_22314                                                            70.1    7e-14
PYAR_26570                                                            67.8    7e-14
PHYSO_530693                                                          68.9    1e-13
H257_06962                                                            68.6    2e-13
PHYCA_51885                                                           63.9    2e-13
PHYRA_85429                                                           67.0    9e-13
PHYSO_342106                                                          66.6    1e-12
PYAR_23050                                                            64.3    3e-12
CCA25708                                                              65.1    4e-12
PYIW_17614                                                            64.3    6e-12
PYVX_23916                                                            63.9    8e-12
PPTG_23088                                                            63.5    1e-11
PHYRA_85914                                                           62.4    3e-11
PHYCA_132571                                                          61.6    5e-11
PHYCA_62442                                                           57.8    6e-11
PITG_08034                                                            60.5    1e-10
PHYCA_122033                                                          60.1    2e-10
PHYCA_133709                                                          58.9    2e-10
PPTG_21423                                                            57.4    3e-10
PHYRA_85792                                                           59.7    3e-10
PHYCA_97306                                                           58.9    4e-10
PHYSO_482594                                                          57.0    4e-10
H310_11400                                                            58.5    8e-10
PHYSO_388784                                                          57.4    1e-09
PYIW_27461                                                            55.5    2e-09
PHYSO_309620                                                          56.6    3e-09
PHYCA_114143                                                          53.1    4e-09
PYAR_26707                                                            54.7    4e-09
PHYSO_261195                                                          56.2    4e-09
PPTG_00243                                                            55.1    6e-09
PHYSO_374083                                                          52.8    7e-09
PHYCA_98759                                                           54.7    7e-09
PHYSO_416157                                                          52.0    1e-08
PHYSO_403766                                                          53.5    2e-08
H257_13207                                                            54.7    2e-08
PHYCA_102404                                                          52.0    2e-08
PHYCA_123491                                                          53.9    2e-08
H310_03908                                                            53.5    2e-08
PHYRA_78352                                                           54.3    2e-08
H257_14705                                                            54.3    2e-08
PHYSO_412316                                                          53.1    2e-08
PHYCA_68972                                                           53.5    3e-08
PYIW_16340                                                            52.8    3e-08
H310_13354                                                            53.5    4e-08
PHYCA_65750                                                           53.5    4e-08
SDRG_17372                                                            53.5    4e-08
SDRG_17367                                                            53.5    4e-08
PHYRA_85507                                                           53.1    5e-08
PHYCA_119571                                                          51.6    6e-08
PHYSO_408655                                                          50.8    1e-07
PHYCA_127584                                                          50.1    1e-07
PHYSO_413621                                                          50.1    1e-07
PHYCA_96803                                                           51.6    1e-07
PHYCA_103492                                                          50.8    2e-07
PYIW_17069                                                            51.2    2e-07
H310_10891                                                            51.6    2e-07
PHYRA_77067                                                           51.2    2e-07
H257_18441                                                            50.8    4e-07
PHYCA_62543                                                           48.1    4e-07
PHYSO_532673                                                          49.7    4e-07
PHALS_04869                                                           48.5    5e-07
PHYSO_299586                                                          50.1    5e-07
PHYCA_131357                                                          50.1    5e-07
PHYCA_72350                                                           47.4    6e-07
PHYRA_81909                                                           50.1    6e-07
PHYCA_42434                                                           47.0    9e-07
PITG_19012                                                            47.4    9e-07
PHYCA_133032                                                          47.4    9e-07
PHYRA_78074                                                           49.3    1e-06
PHALS_11866                                                           47.0    1e-06
PHYCA_111030                                                          47.0    1e-06
PHYRA_85982                                                           48.5    2e-06
PHALS_04710                                                           46.6    3e-06
PPTG_23990                                                            48.1    3e-06
PHYSO_354718                                                          46.2    3e-06
PHYRA_86827                                                           48.1    3e-06
PHYCA_107311                                                          46.6    5e-06
H310_12522                                                            46.2    9e-06
H310_04614                                                            46.2    9e-06
H257_18954                                                            46.2    1e-05
H257_13808                                                            46.2    1e-05
PPTG_16122                                                            45.8    2e-05
H257_13377                                                            45.8    2e-05
PHYCA_128121                                                          43.5    2e-05
PPTG_22307                                                            45.8    2e-05
H310_02566                                                            45.4    2e-05
PYVX_23592                                                            45.1    3e-05
PHYSO_403711                                                          44.7    3e-05
PYAR_15076                                                            45.1    3e-05
PHYCA_100340                                                          44.7    4e-05
PHYSO_434001                                                          42.7    4e-05
PHYCA_119324                                                          44.7    5e-05
PYAP_23024                                                            43.9    6e-05
PHYRA_86147                                                           44.3    7e-05
PHYRA_85934                                                           44.3    7e-05
PHYCA_78763                                                           43.9    8e-05
H257_09910                                                            43.9    1e-04
H257_07762                                                            43.9    1e-04
PHYSO_457550                                                          40.4    1e-04
PHYRA_83670                                                           43.5    1e-04
H257_02096                                                            43.1    1e-04
PHYCA_106652                                                          42.4    1e-04
H310_01656                                                            42.7    2e-04
PHYCA_103334                                                          40.0    2e-04
H310_01813                                                            43.1    2e-04
H257_01623                                                            42.7    2e-04
PYAR_25195                                                            42.7    2e-04
PHYRA_85675                                                           42.7    2e-04
PHYSO_419503                                                          40.4    2e-04
PITG_04073                                                            42.0    3e-04
H257_04448                                                            42.4    3e-04
H310_01160                                                            41.6    3e-04
PHYCA_122030                                                          42.4    3e-04
H310_15218                                                            42.4    3e-04
H257_12330                                                            42.4    3e-04
H257_14645                                                            42.4    3e-04
PHYCA_125288                                                          41.2    3e-04
PHYCA_123947                                                          40.0    4e-04
H310_14304                                                            41.6    4e-04
PHYRA_85588                                                           41.6    5e-04
H257_04889                                                            41.6    6e-04
H257_18790                                                            41.6    6e-04
H310_10595                                                            39.7    6e-04
H310_13336                                                            41.2    7e-04
H257_09473                                                            41.2    7e-04
SPRG_08815                                                            40.8    8e-04
PHYCA_17466                                                           40.8    9e-04
PHYCA_51481                                                           37.7    0.001
H257_09053                                                            40.4    0.001
PYAP_25332                                                            39.7    0.002
CCA17015                                                              40.0    0.002
PPTG_21201                                                            37.7    0.002
PHYCA_113379                                                          38.9    0.002
H310_13741                                                            38.5    0.002
PYVX_24439                                                            39.3    0.002
H310_14634                                                            39.7    0.003
PHYCA_126315                                                          37.0    0.003
PHYCA_125691                                                          39.3    0.003
H310_10924                                                            39.3    0.003
PYIW_23043                                                            37.7    0.003
PHYCA_53504                                                           37.0    0.004
PHYCA_105497                                                          38.5    0.004
PHYSO_378048                                                          36.2    0.005
PHYCA_48152                                                           38.5    0.005
H310_07193                                                            38.9    0.005
PHYCA_123588                                                          38.1    0.006
CCA27531                                                              38.5    0.006
PHYSO_374997                                                          37.4    0.006
PHYCA_102337                                                          37.0    0.006
PHYCA_96370                                                           38.1    0.007
H310_12834                                                            38.1    0.009
PHYCA_96003                                                           37.7    0.010
CCA26840                                                              36.6    0.010
PYAR_22224                                                            38.1    0.010
H310_14627                                                            37.7    0.012
H310_09756                                                            37.7    0.012
PYIW_28151                                                            35.4    0.013
SPRG_20927                                                            37.4    0.014
PPTG_22702                                                            37.4    0.014
PHYCA_128372                                                          37.4    0.015
H310_04256                                                            37.4    0.016
H257_15682                                                            37.4    0.017
PHYCA_15463                                                           37.0    0.018
PYIW_26697                                                            35.4    0.020
PHYSO_432693                                                          35.8    0.021
H310_04615                                                            36.6    0.023
PYIR_25234                                                            36.6    0.024
CCA24593                                                              36.2    0.026
CCA21585                                                              36.2    0.027
PHYSO_408591                                                          35.8    0.028
PHYCA_53569                                                           34.3    0.029
H310_03468                                                            35.8    0.049
H257_18160                                                            34.3    0.053
PPTG_06322                                                            35.0    0.066
PHYCA_100898                                                          34.3    0.070
H257_16271                                                            35.0    0.075
H257_13188                                                            35.0    0.099
H310_02779                                                            35.0    0.10 
H310_15126                                                            35.0    0.10 
H257_12046                                                            34.7    0.12 
PHYRA_77456                                                           34.7    0.13 
H310_12588                                                            34.7    0.13 
H310_13605                                                            34.7    0.14 
PHYCA_128809                                                          34.3    0.15 
PHYCA_128315                                                          34.3    0.15 
PITG_12173                                                            34.3    0.16 
H310_12675                                                            33.9    0.19 
H310_08460                                                            33.9    0.22 
PHYCA_98670                                                           33.1    0.23 
PITG_22437                                                            32.7    0.24 
CCA26651                                                              33.9    0.24 
PYU1_G011875                                                          32.7    0.25 
H257_05466                                                            33.9    0.27 
H310_12525                                                            33.5    0.33 
PHYRA_85043                                                           33.5    0.34 
PHYSO_309514                                                          32.7    0.34 
H257_12105                                                            33.1    0.35 
H257_14841                                                            33.1    0.41 
PHYRA_84817                                                           33.1    0.41 
CCA16690                                                              33.1    0.42 
H257_18058                                                            33.1    0.44 
PHYCA_82928                                                           31.6    0.47 
H257_09387                                                            32.7    0.48 
H257_10291                                                            33.1    0.49 
PYAR_26188                                                            32.7    0.51 
PPTG_21839                                                            31.2    0.51 
H310_10004                                                            30.8    0.54 
H310_12047                                                            32.7    0.56 
PHYCA_123542                                                          32.0    0.72 
PHYCA_103042                                                          32.3    0.76 
PYAR_13535                                                            32.3    0.88 
PHYCA_102668                                                          31.2    0.90 
PHYSO_515292                                                          31.2    0.93 
PPTG_21757                                                            32.0    1.2  
PHYRA_79146                                                           31.6    1.4  
H310_11315                                                            31.6    1.4  
PHYSO_307114                                                          31.6    1.4  
PHYSO_412070                                                          30.8    1.7  
H310_10893                                                            31.2    1.7  
H310_11566                                                            31.2    1.8  
PHYCA_82945                                                           29.3    2.1  
H257_13196                                                            30.8    2.1  
H257_09094                                                            31.2    2.2  
H310_12370                                                            31.2    2.4  
H310_10198                                                            30.8    2.4  
CCA28028                                                              30.8    2.4  
H257_18261                                                            29.6    2.7  
H310_02792                                                            30.8    2.8  
CCA26204                                                              30.4    2.9  
H257_07229                                                            30.8    3.1  
H257_04234                                                            30.4    4.0  
H257_12679                                                            30.0    4.3  
H257_02848                                                            29.6    4.7  
PHYSO_382131                                                          29.6    4.8  
H310_03902                                                            30.0    4.8  
PHYCA_96022                                                           29.3    4.9  
PHYSO_410625                                                          28.5    6.5  
SPRG_05572                                                            29.6    7.1  
H257_18091                                                            29.6    7.3  
H310_09698                                                            29.3    8.0  
PPTG_17262                                                            28.9    8.5  
PITG_15404                                                            28.5    9.4  

>PHYRA_81095
Length=138

 Score = 278 bits (710),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/138 (100%), Positives = 138/138 (100%), Gaps = 0/138 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD
Sbjct  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120
            GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD
Sbjct  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120

Query  121  DVWRIHVGADPPADVEPL  138
            DVWRIHVGADPPADVEPL
Sbjct  121  DVWRIHVGADPPADVEPL  138

>PYAR_26449
Length=211

 Score = 109 bits (272),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 84/136 (62%), Gaps = 1/136 (1%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C  SVT+DLRI TA GPL+L    C V +  +DE LLGR+T+++IGID D + +Q     
Sbjct  71   CSESVTVDLRITTAAGPLHLTNVRCLVLENHDDEVLLGRETLREIGIDVDNMIDQLAGPD  130

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
            RV+ A  DD+ +   ++       DI   LDRML +A   GF+P  +  LR++V E  DV
Sbjct  131  RVAAADNDDLEDDYVEV-ASTSGSDIDGLLDRMLIDAAAAGFDPQYMPVLRSVVREFRDV  189

Query  123  WRIHVGADPPADVEPL  138
            WRI +G D PADVEPL
Sbjct  190  WRITLGMDEPADVEPL  205

>PHYCA_131788
Length=216

 Score = 108 bits (270),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (57%), Gaps = 0/137 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            M+C  +V LD+ + T  G + LR   C V D  +  FLL  +TMQ +GID  R  EQ   
Sbjct  1    MVCTETVCLDVLVRTTAGAVMLRRLECLVLDTEKPGFLLRHRTMQSLGIDVKRQMEQLAG  60

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120
            G R+++  GD        + F + + ++H NL+RML EA+ EG +     +LR LV   +
Sbjct  61   GDRITELDGDGDLPAGTRINFNVKLSEMHENLERMLSEAESEGNDTVWAAKLRALVMRFE  120

Query  121  DVWRIHVGADPPADVEP  137
            +VWR+ VG DPPA+ EP
Sbjct  121  NVWRVSVGPDPPANAEP  137

>PHYCA_123502
Length=290

 Score = 104 bits (260),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 71/104 (68%), Gaps = 1/104 (1%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            ++CR +V LDLRIETA GPL+L    C V +G EDEFLLGRKTMQD+GID DRLF+Q + 
Sbjct  158  VVCRDAVILDLRIETAAGPLHLADVPCLVMEGHEDEFLLGRKTMQDVGIDTDRLFDQ-LA  216

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGF  104
             G V DA  DDVT+ +  + F +D D++   L++M+  A   G 
Sbjct  217  SGHVGDADADDVTSDNPQVAFSVDGDEVSGYLNKMVDAAGAAGL  260

>PHYSO_379548
Length=64

 Score = 86.7 bits (213),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 0/63 (0%)

Query  1   MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
           MLCR S T DL+IETA GPL+L   SC V DG+E+EFLLGRKTMQDIGID DRL EQ   
Sbjct  2   MLCRDSATPDLQIETAAGPLHLASVSCLVMDGNEEEFLLGRKTMQDIGIDIDRLLEQLAG  61

Query  61  GGR  63
           G +
Sbjct  62  GNQ  64

>PHYCA_127654
Length=258

 Score = 91.7 bits (226),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 77/139 (55%), Gaps = 9/139 (6%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            CR SVTL++ + TA G + L   +C V +GS+ +FLLG  T+  +GID +   EQ     
Sbjct  57   CRDSVTLNIVLHTAAGTVRLHKVTCLVMEGSKSDFLLGNGTLVSLGIDVNHQLEQLAGNA  116

Query  63   RVSDA---AGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEH  119
               D     G+D    DADL     + DI   L+ M+  A D GF    L  LR  V E+
Sbjct  117  LPEDVDLFEGEDCP--DADL----SITDIRGKLEDMVTAASDNGFYQGYLPSLRDTVLEY  170

Query  120  DDVWRIHVGADPPADVEPL  138
            ++++RI +GADPPAD+ PL
Sbjct  171  ENIFRIDLGADPPADIAPL  189

>PPTG_07028
Length=195

 Score = 89.0 bits (219),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 0/78 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            M+CR+SV LDLRI+TA GPL+L    C V DG E+EFLL R +MQ IGID DRLFEQ  D
Sbjct  116  MVCRSSVMLDLRIKTAAGPLSLHNVVCLVLDGDEEEFLLDRNSMQGIGIDIDRLFEQLAD  175

Query  61   GGRVSDAAGDDVTNYDAD  78
              +V+DA+ +D  +   D
Sbjct  176  SDQVTDASANDAQSTTLD  193

>PHYRA_80774
Length=1072

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 81/139 (58%), Gaps = 1/139 (1%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            MLC   + LD++I TA GPL L G  C V +  E+E LLG+ T+Q IG+D D +FEQ   
Sbjct  390  MLCHEKIHLDVQIVTAAGPLRLSGIECLVLEAPEEELLLGKSTLQSIGVDLDGVFEQLAQ  449

Query  61   GG-RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEH  119
                 ++   DD+     D+    + +++   L  M+ EA   GFEP + DELR +V E+
Sbjct  450  QHIEAAEFEADDIPCEHMDVLGNSEDNEVDTLLHNMVDEAIQAGFEPAMADELRQMVLEY  509

Query  120  DDVWRIHVGADPPADVEPL  138
             DV+R+ +G D  ADV+PL
Sbjct  510  SDVFRVRLGRDEAADVQPL  528

>PHYRA_78350
Length=1190

 Score = 89.0 bits (219),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 1/139 (1%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            MLC   + LD++I TA GPL L G  C V +  E+E LLG+ T+Q IG+D D +FEQ   
Sbjct  82   MLCHEKIHLDVQIVTAAGPLRLSGIECLVLEAPEEELLLGKSTLQSIGVDLDGVFEQLAQ  141

Query  61   GG-RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEH  119
                 ++   DD+     D+    + ++I   L  M+ EA   GFEP + DELR +V E+
Sbjct  142  QHIEAAEFEADDIPCDHMDVLGNSEDNEIDTLLHNMVDEAIQAGFEPAMADELRQMVLEY  201

Query  120  DDVWRIHVGADPPADVEPL  138
             DV+R+ +G D  ADV+PL
Sbjct  202  SDVFRVRLGRDEAADVQPL  220

>PHYRA_87041
Length=1058

 Score = 88.6 bits (218),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 78/138 (57%), Gaps = 5/138 (4%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            ++C  SV LDLR++T  GP++L   +C V +G E+EF+LG   +  +GID +    Q + 
Sbjct  392  IVCHDSVKLDLRLQTVAGPVHLTEVTCTVFEGQEEEFILGNDMLVSLGIDVNAQLSQ-LA  450

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120
            GG V      D   ++ +    +D  D+   L+ M+  A + GF    L  L  LV E +
Sbjct  451  GGHVM----QDNDPFEPEEPQGVDPSDVRHLLEAMVTAAGENGFPLEYLPPLLDLVMEFE  506

Query  121  DVWRIHVGADPPADVEPL  138
            DV+RI +G DPPADVEPL
Sbjct  507  DVFRIELGNDPPADVEPL  524

>PHYSO_333190
Length=619

 Score = 84.0 bits (206),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 73/140 (52%), Gaps = 11/140 (8%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ-PVDG  61
            C     +D+++ TA  P+NLR   C V DG  DEFLLG +T++ +GI+ D L E+    G
Sbjct  370  CTEMCEVDVQLLTAASPVNLRRLQCVVIDGDADEFLLGDRTLKSLGINVDHLLERLAAKG  429

Query  62   GRVSDAAG---DDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYE  118
            G   D  G   DD+           ++D+I   LD ML +A    F     D LR    E
Sbjct  430  GPEEDEDGIPEDDIVG-------ATNLDEIMDRLDVMLDDAVKARFPHEFKDALRDATKE  482

Query  119  HDDVWRIHVGADPPADVEPL  138
              D+WR  +GADPPA +EPL
Sbjct  483  EVDLWRTKLGADPPAKLEPL  502

>PHYSO_415226
Length=310

 Score = 82.4 bits (202),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 72/133 (54%), Gaps = 13/133 (10%)

Query  9    LDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAA  68
            +D+++ TA GP+NLR   C V DG  DEFLLG + ++ +GI  +RL  +   G    D  
Sbjct  173  VDVQLLTAAGPVNLRRLQCVVIDGDADEFLLGDRPLKSLGISVERLAAK---GAPEEDED  229

Query  69   G---DDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRI  125
            G   DD+           ++D+I   LD ML +A   GF     D LR +  E  D+WR 
Sbjct  230  GIPEDDIVGA-------TNLDEIMDRLDVMLDDAVKAGFPHKFKDALRDVTKEEVDLWRT  282

Query  126  HVGADPPADVEPL  138
             +GADPPA +EPL
Sbjct  283  KLGADPPAKLEPL  295

>PHYCA_101315
Length=160

 Score = 79.3 bits (194),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 75/136 (55%), Gaps = 8/136 (6%)

Query  5    ASVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGR  63
             SV + LRI TA GP+ L +   C V D  E+EF+LG+  +  +GID DR  EQ V    
Sbjct  30   GSVDVKLRINTAAGPVCLTKPVRCLVIDEDEEEFILGKDVLTTLGIDVDRQLEQLVG---  86

Query  64   VSDAAGD-DVTNYDADLRFEIDMDD-IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDD  121
             SD AGD D  N + D    ++ D+ +   +D ++++A + GF     DEL  +     D
Sbjct  87   -SDVAGDEDPVNCNDDYEIGVECDNEVRVAIDELVEKAINNGFPRERRDELLKIAVMF-D  144

Query  122  VWRIHVGADPPADVEP  137
            +WR+ +G DPPA V P
Sbjct  145  IWRLKLGGDPPAKVPP  160

>PHYCA_106763
Length=125

 Score = 77.4 bits (189),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 72/125 (58%), Gaps = 5/125 (4%)

Query  15   TAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVT  73
            T  GP+N+ +   C V +  +DEFLLG   ++ +GID +R  E  +     +D  GD+ T
Sbjct  2    TVAGPVNIHKPVPCLVLENDDDEFLLGDDVLKFLGIDVERQLEL-LAARNCNDGEGDEET  60

Query  74   NYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPA  133
                 +    D +DI   ++ MLQ A DEGF    L+ LRT+VY + DVWR+ +G DPPA
Sbjct  61   --PDVMVVGNDAEDIRVAVEAMLQRALDEGFPAGKLERLRTVVYAY-DVWRLVLGNDPPA  117

Query  134  DVEPL  138
             VEP+
Sbjct  118  KVEPM  122

>PYAR_22624
Length=102

 Score = 76.3 bits (186),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 59/98 (60%), Gaps = 1/98 (1%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGR-VS  65
            VTLDL I TA GP+ + G +C V +  EDEFLLGR T+Q++GID DRLFEQ V     V+
Sbjct  1    VTLDLEIHTAAGPIIIAGVNCLVLEADEDEFLLGRTTLQELGIDLDRLFEQLVMQTHDVA  60

Query  66   DAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEG  103
            DA  DDV     ++        +   ++RM+ EA  +G
Sbjct  61   DAEADDVPTEQVEVGGGDGAAAVEIEIERMVNEAARDG  98

>PHYCA_106692
Length=330

 Score = 80.5 bits (197),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 3/138 (2%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + C   V LD+ ++   G +N+RG +C + +  EDEFLLG +T++ +GID D L    V 
Sbjct  128  ITCTEYVELDIGLQKVAGRVNIRGMACIITETDEDEFLLGSETLKSLGIDVDELLAGLVV  187

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120
             G       DD  +Y    R   DM+ IH  L  M+ EA D GF     DEL  +  +  
Sbjct  188  KGPADVDPFDDDRDYRPIER--PDMNAIHGRLREMVAEAVDNGFPADRSDELFEIASKR-  244

Query  121  DVWRIHVGADPPADVEPL  138
            D+WR+ +  DPPA + P 
Sbjct  245  DIWRLQISDDPPARLPPF  262

>PHYCA_118513
Length=160

 Score = 77.0 bits (188),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 75/136 (55%), Gaps = 8/136 (6%)

Query  5    ASVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGR  63
             SV + LRI TA GP+ L +   C V D  E+EF+LG+  +  +GID DR  EQ V    
Sbjct  30   GSVDVKLRINTAAGPVCLTKPVRCLVIDEDEEEFILGKDVLTTLGIDVDRQLEQLVG---  86

Query  64   VSDAAGD-DVTNYDADLRFEIDMDD-IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDD  121
             SD AGD D  N + D    ++ D+ +   +D ++++A + GF     D+L  +     D
Sbjct  87   -SDVAGDEDPVNCNDDYEIGVECDNEVRVAVDELVEKAINNGFPRERRDDLLKIAVMF-D  144

Query  122  VWRIHVGADPPADVEP  137
            +WR+ +G DPPA V P
Sbjct  145  IWRLKLGGDPPAKVPP  160

>PHYCA_105797
Length=160

 Score = 77.0 bits (188),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 75/136 (55%), Gaps = 8/136 (6%)

Query  5    ASVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGR  63
             SV + LRI TA GP+ L +   C V D  E+EF+LG+  +  +GID DR  EQ V    
Sbjct  30   GSVDVKLRINTAAGPVCLTKPVRCLVIDEDEEEFILGKDVLTTLGIDVDRQLEQLVG---  86

Query  64   VSDAAGD-DVTNYDADLRFEIDMDD-IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDD  121
             SD AGD D  +   D    ++ D+ +   +D+++++A D GF     D+L  +     D
Sbjct  87   -SDVAGDEDPVDCSDDYEIGVECDNEVRVAVDKLVEKAIDNGFPRERRDDLLKIAVMF-D  144

Query  122  VWRIHVGADPPADVEP  137
            +WR+ +G DPPA V P
Sbjct  145  IWRLKLGGDPPAKVPP  160

>PHYCA_126068
Length=155

 Score = 76.3 bits (186),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 71/133 (53%), Gaps = 2/133 (2%)

Query  7    VTLDLRIETAVGPLNLRG-ASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVS  65
            V L L + TA GP+ + G   C + +  E EF+LG+  +  +GID DR  EQ        
Sbjct  1    VCLRLLLNTAAGPVAIHGPVQCLIIESDEPEFILGQDVLLSLGIDVDRQLEQLAGRNDDE  60

Query  66   DAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRI  125
            D    +  +   D+      +D+   L+R++  A + GF   L  ++R +V +HD +WR+
Sbjct  61   DDGESEWKDNLIDIAPPRTNEDLQDALERLVAAALENGFPRKLETKIRAIVAKHD-IWRL  119

Query  126  HVGADPPADVEPL  138
             +G DPPA+VEPL
Sbjct  120  QLGKDPPANVEPL  132

>CCA22262
Length=845

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 49/144 (34%), Positives = 74/144 (51%), Gaps = 12/144 (8%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            ++CR  VTLD+++ TA GP+N+ G  C V D  ED F+L +  +  +GID   +  +  +
Sbjct  168  LVCRERVTLDVQLRTAAGPVNIMGNECLVLDEEEDIFILAKGVLSSLGIDVGAMIAKLAE  227

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNL------DRMLQEAKDEGFEPTLLDELRT  114
            G        D  T+   +L  ++D D +  NL        +L+E +D G    L  EL  
Sbjct  228  GAATDTDGDDLTTHLAVELGVDVDSDIL--NLLSSWEHAALLEEDEDCG----LAHELYE  281

Query  115  LVYEHDDVWRIHVGADPPADVEPL  138
            L  +H D+WR  +  DPPA VE L
Sbjct  282  LAVQHRDIWRNQLDYDPPAVVETL  305

>PPTG_20423
Length=189

 Score = 75.1 bits (183),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 73/139 (53%), Gaps = 4/139 (3%)

Query  1    MLCRASVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPV  59
            +L   SV L + + TA GP+  ++     V D  E+EF+LG   + D+GI  DR  EQ  
Sbjct  48   ILASRSVLLRIMLHTAAGPVTPVKPYEVLVIDEDEEEFILGEDILTDLGISIDRQLEQLA  107

Query  60   DGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEH  119
                  D  GD +   DA        +++ + ++ M+  A + GF     D+LRT+VY +
Sbjct  108  KETSADD--GDPIPVEDAFRAGCTPDEEVRQAVEGMIMTAIENGFPADKEDKLRTIVYMY  165

Query  120  DDVWRIHVGADPPADVEPL  138
            D VWRI +G DPPA V PL
Sbjct  166  D-VWRIRLGPDPPAKVPPL  183

>PYAR_26130
Length=311

 Score = 76.6 bits (187),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 73/134 (54%), Gaps = 7/134 (5%)

Query  6    SVTLDLRIETAVGPLNLR-GASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRV  64
            +V L L + TA GP+N+     C V DG + EFLLGR  +  +GID ++  E     G  
Sbjct  99   TVYLTLSLRTAAGPVNINEPVECLVVDG-DGEFLLGRDVLARLGIDVEKQLELLASTGHD  157

Query  65   SDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWR  124
             D    D T+ D  +    D  +I   ++ M+  A +EGF    +D LR ++Y +D VWR
Sbjct  158  ED----DGTDEDPVVGAGPDDMEIRSAVETMIARALEEGFPRDRVDRLRAVIYAYD-VWR  212

Query  125  IHVGADPPADVEPL  138
            I +GADPPA V PL
Sbjct  213  IKLGADPPAKVPPL  226

>PPTG_24067
Length=637

 Score = 77.0 bits (188),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 24/150 (16%)

Query  1    MLCRASVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ--  57
            + C  SV L + + TA G + L +   C V +  E EF+LGR  ++ +GID DR  EQ  
Sbjct  382  ITCTTSVHLRVLLNTAAGLVALHKPVECLVIEDDEPEFILGRDLLKALGIDIDRQLEQLV  441

Query  58   ---------PVDGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTL  108
                      VD   +   AG D T             D+H  ++++++ A D GF   L
Sbjct  442  IRDTDEEEDLVDLDEMLPGAGPDPTG-----------SDLHNAIEKLIRTALDHGFPHLL  490

Query  109  LDELRTLVYEHDDVWRIHVGADPPADVEPL  138
               LR +V +H D+WR+ +G DPPA VEPL
Sbjct  491  APRLRAIVLKH-DIWRLELGNDPPAKVEPL  519

>PHYRA_75602
Length=1319

 Score = 76.6 bits (187),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 72/120 (60%), Gaps = 9/120 (8%)

Query  28   FVRDGSEDEFLLGRKTMQDIGIDNDRL----FEQPVD---GGR--VSDAAGDDVTNYDAD  78
            F  D   D  ++ +  +Q++G  +  +     E PV+   GG   V++A  DD+T  D +
Sbjct  337  FCADSGADSSIISQAMVQELGTLDSTVVLVPLEPPVEVKGGGESTVAEADHDDITASDPE  396

Query  79   LRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            L F  + D+IH  + +++ +A D GF+ +L  +LR LV+E++DVWR+ +GAD PA VEP+
Sbjct  397  LGFSDETDEIHTVVSKLVDDAVDAGFDSSLTGDLRALVHEYEDVWRLKIGADEPAKVEPM  456

>PHYRA_86868
Length=916

 Score = 76.6 bits (187),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 72/136 (53%), Gaps = 5/136 (4%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C    T+ L + TA GP+++R   C V D   +E LLG   M+ +GID +R+ EQ     
Sbjct  332  CLEKATVALELVTAAGPVHMRDVVCLVLDSDMEELLLGNDVMKSLGIDVERMIEQLTGAS  391

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
             + +   D+    D  +      D +   LD+++ EA   G     +D LR+LV+EH DV
Sbjct  392  LLEE--KDEFPVGDELIPANSGEDGV---LDQLVDEALANGMPGEHVDRLRSLVHEHGDV  446

Query  123  WRIHVGADPPADVEPL  138
            +R  +G DPPA VEPL
Sbjct  447  FRERLGDDPPALVEPL  462

>PHYRA_84422
Length=894

 Score = 76.3 bits (186),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 72/136 (53%), Gaps = 5/136 (4%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C    T+ L + TA GP+++R   C V D   +E LLG   M+ +GID +R+ EQ     
Sbjct  358  CLEKATVALELVTAAGPVHMRDVVCLVLDSDMEELLLGNDVMKSLGIDVERMIEQLTGAS  417

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
             + +   D+    D  +      D +   LD+++ EA   G     +D LR+LV+EH DV
Sbjct  418  LLEE--KDEFPVGDELIPANSGEDGV---LDQLVDEALANGMPGEHVDRLRSLVHEHGDV  472

Query  123  WRIHVGADPPADVEPL  138
            +R  +G DPPA VEPL
Sbjct  473  FRERLGDDPPALVEPL  488

>PYAR_23578
Length=407

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 69/118 (58%), Gaps = 1/118 (1%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSD  66
            VT+D+RI TA G L+L    C V DG +DE LL R T++DIGID + +F+Q     RV+ 
Sbjct  15   VTIDVRITTAAGLLHLANVRCLVLDGHDDEVLLDRGTLRDIGIDVENMFDQLAGPNRVAR  74

Query  67   AAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWR  124
               DD  + D  L       DI   L+ ML+EA+ E F+   + +LR LV E+ DVWR
Sbjct  75   GDADDFDDEDYVL-VSKQSADIDTLLEDMLREAEAECFDMVEMPKLRDLVQEYSDVWR  131

>PHYSO_519621
Length=132

 Score = 70.5 bits (171),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 61/113 (54%), Gaps = 3/113 (3%)

Query  26   SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDADLRFEIDM  85
             C V DG  DEFLLG +T++ +GI+ D L E+    G   +   D+    + D+    ++
Sbjct  2    QCVVIDGDADEFLLGDRTLKSLGINVDHLLERLAAKGAPEE---DEDGIPEDDIVGATNL  58

Query  86   DDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            D+I   LD ML +A   GF     D LR    E  D+WR  +GADPPA +EPL
Sbjct  59   DEIMDRLDVMLDDAVKAGFPHEFKDALRDATKEEVDLWRTKLGADPPAKLEPL  111

>PHYRA_83692
Length=613

 Score = 74.3 bits (181),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 74/136 (54%), Gaps = 5/136 (4%)

Query  8    TLDLRIETAVGPLNLRGASCFVR----DGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG-  62
            T+   I T++ P  L   + ++     +  E+E LLG+ T+Q IG+D D +FEQ      
Sbjct  67   TVARSIRTSLKPRVLEHVAHYILKKEVETPEEELLLGKSTLQSIGVDLDGVFEQLAQQHI  126

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
              ++   DD+     D+    + +++   L  M+ EA   GFEP + DELR +V E+ DV
Sbjct  127  EAAEFEADDIPCEHMDVLGNSEDNEVDTLLHNMVDEAIQAGFEPAMADELRQMVLEYSDV  186

Query  123  WRIHVGADPPADVEPL  138
            +R+ +G D  ADV+PL
Sbjct  187  FRVRLGRDEAADVQPL  202

>PHYRA_85571
Length=381

 Score = 72.8 bits (177),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 62/106 (58%), Gaps = 1/106 (1%)

Query  34   EDEFLLGRKTMQDIGIDNDRLFEQPVDGG-RVSDAAGDDVTNYDADLRFEIDMDDIHRNL  92
            E+E LLG+ T+Q IG+D D +FEQ        ++   DD+     D+    + +++   L
Sbjct  2    EEELLLGKSTLQSIGVDLDGVFEQLAQQHIEAAEFEADDIPCEHMDVLGNSEDNEVDTLL  61

Query  93   DRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
              M+ EA   GFEP + DELR +V E+ DV+R+ +G D  ADV+PL
Sbjct  62   HNMVDEAIQAGFEPAMADELRQMVLEYSDVFRVRLGRDEAADVQPL  107

>PHYCA_124508
Length=507

 Score = 72.8 bits (177),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 6/136 (4%)

Query  4    RASVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            R SV L +R+ TA GP+ L    +C + +  +DEF++G   +  +GI+ DR  EQ + GG
Sbjct  253  RESVLLAIRLHTAAGPVELAEPVNCLIIEQIDDEFIVGNDVLLSLGINVDRQLEQ-LAGG  311

Query  63   RVSDAAGDDVTNYDADLRFEIDMD-DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDD  121
            ++ D   +D    D + R     D DI   L+ +   A D GF    ++ELR +  +H D
Sbjct  312  KLKD--DEDPIVSDDEFRPGHANDFDIQEGLENLFTAALDNGFPVESMEELRRITKKH-D  368

Query  122  VWRIHVGADPPADVEP  137
            +WR+ +  DPPA V P
Sbjct  369  IWRLVLCDDPPAKVPP  384

>PHYRA_74652
Length=636

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 68/136 (50%), Gaps = 1/136 (1%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + CR S  +D+ + TA GP N+      + D  E+EFLLG   +  +GID  R  EQ   
Sbjct  282  LACRTSCDVDVMMGTAAGPANVTNVRYIIVDDDEEEFLLGNPMLVALGIDVGRQMEQLAM  341

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120
                 D+  +D    D +   + D  ++   LD+++  A D GF P  +  LR +V ++ 
Sbjct  342  SSSGVDSEENDGLPDDPETG-QDDEAEVQELLDQLVANAGDNGFSPEHMSTLRRVVSDYR  400

Query  121  DVWRIHVGADPPADVE  136
            DVW I VGA  P  VE
Sbjct  401  DVWSIRVGAGEPTRVE  416

>PHYRA_77764
Length=1728

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 75/138 (54%), Gaps = 7/138 (5%)

Query  6    SVTLDLRIETAVGPLNLRGA-SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRV  64
            +  L + I TA GP+    A  C + D  +DEF++GR  +  +GID DR  EQ +   R 
Sbjct  474  TTMLHVLIHTAAGPVEPADAVPCLIVDMDDDEFIIGRDLLATLGIDVDRQLEQ-LATHRD  532

Query  65   SDAAGD----DVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120
             + +GD    +     AD       +D+H  ++ ++Q A + GF P  +D+LR +V+ + 
Sbjct  533  DETSGDPFDLEADEPPADPSQSTTDEDVHAAVETLIQRALEHGFPPDKVDKLRLIVHAY-  591

Query  121  DVWRIHVGADPPADVEPL  138
            DVWR+ +  DPPA V PL
Sbjct  592  DVWRLVLRDDPPARVPPL  609

>PHYRA_87090
Length=791

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 73/140 (52%), Gaps = 13/140 (9%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C    T+ L + TA GP+++R   C V D   +E LLG   M+ +GID +R+ EQ     
Sbjct  15   CLEKATVVLELVTAAGPVHMRDVECLVLDSDVEELLLGNDAMKSLGIDVERMIEQLAGAS  74

Query  63   RVSDA----AGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYE  118
             + +      GD++   ++        D +   LD+++ EA   G     +D LR+LV+E
Sbjct  75   LLEEKDEFPVGDELIPANS------GEDGV---LDQLVDEALANGMPGEHVDRLRSLVHE  125

Query  119  HDDVWRIHVGADPPADVEPL  138
            H DV+R  +G DPPA VE L
Sbjct  126  HGDVFRERLGDDPPALVELL  145

>PHYCA_108911
Length=274

 Score = 70.5 bits (171),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 6/136 (4%)

Query  4    RASVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            R SV L +R+ TA GP  L    +C + +  +DEF++G   +  +GI+ DR  EQ + GG
Sbjct  72   RESVLLAIRLHTASGPAELAEPVNCLIIEQIDDEFIVGNDVLLSLGINVDRQLEQ-LAGG  130

Query  63   RVSDAAGDDVTNYDADLRFEIDMD-DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDD  121
            ++ D   +D    D +LR     D DI   L+ +   A D GF    ++ELR +  +H D
Sbjct  131  KLRD--DEDPIVSDDELRPGHANDFDIQEGLENLFSAALDNGFPVEYMEELRRIAKKH-D  187

Query  122  VWRIHVGADPPADVEP  137
            +WR+    DPPA V P
Sbjct  188  IWRLVPCDDPPAKVPP  203

>PHYCA_104401
Length=314

 Score = 69.7 bits (169),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 66/136 (49%), Gaps = 2/136 (1%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C   V+LDL + T  G ++LR   C +  G  DEFLLG   ++ +GID ++   Q + G 
Sbjct  151  CTQEVSLDLELTTLAGLVSLRSVPCLILAGDGDEFLLGSDVLKGLGIDIEQQLAQ-LAGP  209

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
             + +A  D+    D D+            +  +L  A   G        LR L+ E  DV
Sbjct  210  TLLEADVDEFPAGD-DIPVPRVGSTATSQVGLLLDRAVANGLPTEQAGALRNLLEEFPDV  268

Query  123  WRIHVGADPPADVEPL  138
            WR  VG DPPA+VEPL
Sbjct  269  WRDEVGLDPPANVEPL  284

>PYAR_22314
Length=468

 Score = 70.1 bits (170),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (57%), Gaps = 9/104 (9%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            M C  SVT+DL IETA G L LR   C V D  EDEFLLG+ T+++IGID D +FE+   
Sbjct  374  MECCESVTVDLVIETAAGQLYLRNVWCLVMDAEEDEFLLGKHTLREIGIDIDGMFEELAS  433

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGF  104
               ++ A  DD+           D D +  N ++++Q A + GF
Sbjct  434  NHALALADHDDLGE---------DQDVLAINDEKVIQAALERGF  468

>PYAR_26570
Length=201

 Score = 67.8 bits (164),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 59/104 (57%), Gaps = 3/104 (3%)

Query  35   DEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDR  94
            DEFLLG +T++ +GI+ D+  EQ  + G   D   D   +    +    +MD++   L  
Sbjct  1    DEFLLGDETLKSLGINVDQQLEQLAERGAPDDDHDDIADDDIVGVS---NMDEVRERLSV  57

Query  95   MLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            ML+EAKD GF P   D L   + +  DVWR  +GADPPA +EPL
Sbjct  58   MLKEAKDAGFPPEHYDALCRALDDTLDVWRTKLGADPPAKLEPL  101

>PHYSO_530693
Length=332

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 57/104 (55%), Gaps = 2/104 (2%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + C  SV LD+ ++T  G +N+RG +C + + +EDEFLLG++T++ +G D D L    V 
Sbjct  228  ITCTQSVDLDIGLQTVAGRVNIRGLTCVITETNEDEFLLGKRTLRSLGSDVDELLAGLVT  287

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGF  104
             G       DD  NY A  R   D D I   L  M+ EA D GF
Sbjct  288  QGSSDVDPFDDERNYKAIAR--PDTDAIKARLHEMIAEAVDNGF  329

>H257_06962
Length=1357

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 53/149 (36%), Positives = 74/149 (50%), Gaps = 20/149 (13%)

Query  7    VTLDLRIETAVGPLNLRGAS-CFV-RDGSEDEFLLGRKTMQDIGIDNDRLFEQPV-----  59
            V L LRI+TA GP+ + G   C+V  DG  DEFL+   T++ IGID DRL EQ       
Sbjct  118  VDLTLRIQTAAGPVKVPGKRRCYVVNDG--DEFLVSNHTLKTIGIDIDRLLEQVARLQVD  175

Query  60   -DGGRVSDAAGD--------DVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLD  110
             DG  + +  GD         V          +  +++   L  M+  A D GF    + 
Sbjct  176  EDGDDLEEVGGDCEELPQRSAVRTATMKAALPVAKNEVEGALHGMIDGAVDNGFPMEHVK  235

Query  111  ELRTLVYEHDDVWRIHV-GADPPADVEPL  138
             L  ++ +H D+WRI   G+DPPA V+PL
Sbjct  236  YLWDVLSKH-DIWRIKFDGSDPPAKVKPL  263

>PHYCA_51885
Length=87

 Score = 63.9 bits (154),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 0/63 (0%)

Query  1   MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
           M+C  +V LD+ + T  GP+ LRG  C V D  E EFLLG +TMQ +GID  R  EQ   
Sbjct  25  MVCTETVCLDVLVRTTAGPVMLRGLECLVLDADEPEFLLGHRTMQSLGIDVKRQMEQLAG  84

Query  61  GGR  63
           G R
Sbjct  85  GDR  87

>PHYRA_85429
Length=1485

 Score = 67.0 bits (162),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 74/136 (54%), Gaps = 9/136 (7%)

Query  9    LDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDA  67
            L + I TA GP+  +    C + D  +DEF++G+  +  +GID DR  EQ +   R  D 
Sbjct  415  LHVLIHTAAGPVQPVEAVPCLIVDTDDDEFIIGQDLLIALGIDVDRQLEQ-LASHREDDT  473

Query  68   AGDDVTNYDADLR-----FEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
             GD   + +AD R          +++   ++ +++ A +  F P  +D+LRT+V+ + DV
Sbjct  474  GGDPF-DLEADERPMNPSHVASDEEVRAAVETLIERALEHNFPPEKVDKLRTIVHMY-DV  531

Query  123  WRIHVGADPPADVEPL  138
            WR+ +  DPPA V PL
Sbjct  532  WRLELRDDPPARVPPL  547

>PHYSO_342106
Length=568

 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 72/141 (51%), Gaps = 12/141 (9%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ-PV  59
            + C + VT+DL ++TA G ++LR   C V +  E+E L+GR  +  +GID D +  Q  V
Sbjct  358  LTCGSMVTVDLDLQTAAGVMHLRDVPCVVMESDEEERLVGRDILSTLGIDIDDMLAQLAV  417

Query  60   DG--GRVSD--AAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTL  115
            DG    V D  A GDD  +            DI   L+R++ +A  +G +      L  L
Sbjct  418  DGMPAEVDDGVAVGDDSMDPPV-------FADIRPELERLVSDAVAKGLDAEHAPMLLVL  470

Query  116  VYEHDDVWRIHVGADPPADVE  136
            + E  DVW+  +G  PPAD E
Sbjct  471  LLEFPDVWQDSLGGGPPADSE  491

>PYAR_23050
Length=265

 Score = 64.3 bits (155),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 1/114 (1%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C  SV +D+RI TA GPL+L      V D  +DE LLGR+ ++DIGID D L +Q     
Sbjct  152  CTESVMIDVRITTAAGPLHLANVRSLVLDDHDDEVLLGREALRDIGIDIDNLLDQLAGPD  211

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLV  116
            RV+    DD  + D  L    +  D+   L+ ML EA+ EGF+   +  LR LV
Sbjct  212  RVARGDADDFDDEDFVL-VSKETADVDTLLEGMLGEAEAEGFDMVEMPNLRDLV  264

>CCA25708
Length=904

 Score = 65.1 bits (157),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 62/119 (52%), Gaps = 9/119 (8%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            ++CR  VTL++++ TA GP+N++G  C V DG  D+F+LG+     +GID   +  + V+
Sbjct  419  LVCRERVTLNVQVRTAAGPVNIKGVDCLVLDGKGDKFILGKAVFSSLGIDVGAMIAKLVE  478

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEH  119
            G        D  TN   ++  ++D D +  NL   L+ A        LL+EL    + H
Sbjct  479  GPATDTDGDDLTTNLAVEVGVDVDSDIL--NLLSSLEHA-------ALLEELPNNAFSH  528

>PYIW_17614
Length=464

 Score = 64.3 bits (155),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 45/151 (30%), Positives = 78/151 (52%), Gaps = 16/151 (11%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGA-SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPV  59
            ++ R +V L + + TA  P+  +   +C V +  EDEF++G   + ++ ID +R  E  +
Sbjct  226  VVLRTAVELYITLHTAAEPVRCQDKKACLVVEDGEDEFIVGNGLLTELDIDVERQLE--M  283

Query  60   DGGRVSDAAGDDVTNYDADLRFEIDMD------------DIHRNLDRMLQEAKDEGFEPT  107
               RV D+  D +   +A    + ++D            D+ R LD ++  A + GF   
Sbjct  284  LAARVEDSDEDPIPEEEAPNPVQRNVDVARAPEPVQRHVDVARVLDELVNHAVERGFPVE  343

Query  108  LLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
              ++L+TLV  +D +WR+ +  DPPA VEPL
Sbjct  344  SKEKLKTLVMAYD-LWRVGLSDDPPARVEPL  373

>PYVX_23916
Length=411

 Score = 63.9 bits (154),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 68/133 (51%), Gaps = 3/133 (2%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + C   V LDL++ T+ G + +R   C + D  EDEFL+G+  + ++GID D        
Sbjct  270  LSCPDVVKLDLQLRTSAGNVIIRNVCCVITDTDEDEFLVGKPLLLELGIDVDNQLATFAR  329

Query  61   GGRVSDAAGDDVTNY-DADLRFEID-MDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYE  118
             G +         +Y DAD + E+D    I   ++  + EA D GF    ++ LR ++  
Sbjct  330  VGEIDLDDDPLDISYIDADRKDEVDAATAITEMIEVRISEAVDNGFPVEHVNRLRDILTR  389

Query  119  HDDVWRIHVGADP  131
            + D+WRI +G DP
Sbjct  390  Y-DIWRIKLGNDP  401

>PPTG_23088
Length=977

 Score = 63.5 bits (153),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 61/135 (45%), Gaps = 21/135 (16%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C   V LDL + T  G ++L+  +C V  G  DEFLLGR  ++ +GID +    Q  +G 
Sbjct  268  CSEEVLLDLELVTIAGTVSLKSVTCVVLPGDGDEFLLGRDALRTLGIDVEAQLTQLAEG-  326

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
                             R E +M+    NL   +  A   G     +  ++  + E+ DV
Sbjct  327  -----------------RSEPEMNAALVNL---MARAVANGLPAEYIGVVQETLAEYADV  366

Query  123  WRIHVGADPPADVEP  137
            WR  +G  PPA VEP
Sbjct  367  WRETIGPGPPALVEP  381

>PHYRA_85914
Length=571

 Score = 62.4 bits (150),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 10/137 (7%)

Query  9    LDLRIETAVGPLNLRGASCFVRDGSED-EFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDA  67
            L L I TA GP+   GA   +    +D EF++G   +  +GID  R  E   D G   D 
Sbjct  396  LHLLIHTAAGPVQPMGAVDVLIVDVDDDEFIVGNDLLNLLGIDVARQLEMLADRG--DDE  453

Query  68   AGDDVTNYDAD------LRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDD  121
               D    +AD        +E   DDI   ++R++  A D GF    +++LRT+ + +D 
Sbjct  454  TSGDSIELEADDLPTTASAYEPSDDDIFAAVERLIDRAVDNGFPLDKVEQLRTIAHAYD-  512

Query  122  VWRIHVGADPPADVEPL  138
            VWR+ + ADPPA+V PL
Sbjct  513  VWRLELRADPPANVPPL  529

>PHYCA_132571
Length=294

 Score = 61.6 bits (148),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 59/114 (52%), Gaps = 5/114 (4%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            CR +VTLDL ++T  GP++L    C V +G E +F+LG  T++ +GID +    Q   G 
Sbjct  186  CREAVTLDLLLQTVAGPVHLSDVYCKVMEGLESDFILGNDTLKTLGIDVNEQLSQLASGP  245

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLV  116
             V+D        +D  +   +   ++H  L+ ++  A D GF+   L  LR  V
Sbjct  246  PVADE-----DPFDLGVPPVMPPTEVHVKLEELVAAAGDSGFDRNYLVGLREAV  294

>PHYCA_62442
Length=92

 Score = 57.8 bits (138),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)

Query  84   DMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            D +DI   ++ MLQ A DEGF    L+ LRT+VY + DVWR+ +G DPPA VEP+
Sbjct  36   DAEDIRVAVEAMLQRALDEGFPAGKLERLRTIVYAY-DVWRLVLGNDPPAKVEPM  89

>PITG_08034
Length=268

 Score = 60.5 bits (145),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 65/122 (53%), Gaps = 15/122 (12%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            ++CR SVTL++ ++TA G + L+  +C V +G+E +FLLG  T+  +GID +   EQ   
Sbjct  150  VVCRDSVTLNIVLQTATGTVRLQEVTCLVMEGNESDFLLGNDTLVSLGIDVNHQLEQ---  206

Query  61   GGRVSDAAGDDVTNY------DADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRT  114
                  A  +DV  +      DADL     + DI   L+ M+  A + GF+   +  LR 
Sbjct  207  --LAGSALPEDVDPFEEEECPDADL----SVADIREKLEDMVVAAGNSGFDQGYMSFLRD  260

Query  115  LV  116
            ++
Sbjct  261  II  262

>PHYCA_122033
Length=451

 Score = 60.1 bits (144),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 0/57 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            M C   V +DL I TA GPL L    C V D  E+E LLGR T+Q IG+D D +FE+
Sbjct  393  MQCHEKVHIDLHIVTAAGPLALTNIECLVLDAHEEELLLGRTTLQSIGVDLDDVFER  449

>PHYCA_133709
Length=220

 Score = 58.9 bits (141),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            C   V +DL+I TA GPL L    C V D  E+E LLGR T+Q IG+D D +FE+
Sbjct  164  CHEKVHIDLQIVTAAGPLALTNIKCLVMDAHEEELLLGRTTLQSIGVDLDDVFER  218

>PPTG_21423
Length=135

 Score = 57.4 bits (137),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 6/125 (5%)

Query  6    SVTLDLRIETAVGPLNLR-GASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRV  64
            S+T  L + TA GP+ L     C + +  E EF+LG+  +  +GID DR  EQ     RV
Sbjct  7    SLTPRLLLNTAAGPVALHEPVECLIVEEEEPEFILGQDVLLSLGIDVDRQLEQL--ANRV  64

Query  65   SDAAGDDVTNYD--ADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
            +D    D    D   DL      +++   LDR++  A   GF   L ++LR +V +H D+
Sbjct  65   NDVDDGDTELKDDLPDLAHPGTDEELSEALDRLVTMALANGFPHKLEEKLRDIVLKH-DI  123

Query  123  WRIHV  127
            WR+ V
Sbjct  124  WRLEV  128

>PHYRA_85792
Length=543

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 69/136 (51%), Gaps = 9/136 (7%)

Query  9    LDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDA  67
            L L I TA GP+  +      + D  +DEF++G   +  +GID DR  EQ  D G   D 
Sbjct  390  LHLLIHTAAGPVEPMNAVDVLIVDVDDDEFIIGNDLLMTLGIDVDRQLEQLADRG--DDE  447

Query  68   AGDDVTNYDAD-----LRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
               D    +AD        +   DDI   ++ ++  A + GF    +++LRT+ + + DV
Sbjct  448  TCGDPIELEADDPPVSTATQPSDDDIFTAVECLIARAVENGFPADKVEQLRTIAHAY-DV  506

Query  123  WRIHVGADPPADVEPL  138
            WR+ + ADPPA V PL
Sbjct  507  WRLELRADPPAKVPPL  522

>PHYCA_97306
Length=387

 Score = 58.9 bits (141),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 73/139 (53%), Gaps = 10/139 (7%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            +  +A   L + I TA GP+ L  A   + D  +DEF++G   +  +GID DR  EQ   
Sbjct  253  VTAKAKALLHVMIHTAAGPVQLADAILCMIDTEDDEFIVGHDVLGALGIDVDRQLEQ---  309

Query  61   GGRVSDAAGD-DVTNYDAD----LRFEIDMDD-IHRNLDRMLQEAKDEGFEPTLLDELRT  114
               + D  G  D    +AD    +  +  MD+ +   ++ ++ +A + GF P  +D+LR 
Sbjct  310  LASLHDGEGSGDPFELEADEPPVIMAQSVMDEGVRAAVETLIDKALENGFPPGKVDKLRV  369

Query  115  LVYEHDDVWRIHVGADPPA  133
            +V+ + DVWR+ +  DPPA
Sbjct  370  IVHMY-DVWRLVLRDDPPA  387

>PHYSO_482594
Length=144

 Score = 57.0 bits (136),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 65/140 (46%), Gaps = 11/140 (8%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + C     +D+ + TA GP++LR   C + D  E+   LG   +  +GID DR  EQ   
Sbjct  13   LACNTCCDVDVVLSTAAGPVHLRRVHCVILDDDEE---LGNPALVSLGIDVDRQMEQ---  66

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMD---DIHRNLDRMLQEAKDEGFEPTLLDELRTLVY  117
                S    D     D     EI  D   ++   ++ +L  A   GF    +  LR +V 
Sbjct  67   --LASGGGLDGDDGDDIRGDPEIGRDSDAEMTEFVNGLLNTAGANGFPEEEMPALRRIVL  124

Query  118  EHDDVWRIHVGADPPADVEP  137
            ++ D+WR  +GAD PA V+P
Sbjct  125  DYKDMWRSRLGADEPARVKP  144

>H310_11400
Length=535

 Score = 58.5 bits (140),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 5/132 (4%)

Query  11   LRIETAVGPLNLRGASCFVRDG-SEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAG  69
            L  +TA GPL LRG   ++ +  S  E  LG   MQ +G +   L E   +   V D + 
Sbjct  387  LEFKTACGPLMLRGLRVWIDESVSNVELTLGLPVMQKLGYNEQTLLESAYNQQAVWDFSE  446

Query  70   DDVTNYDAD----LRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRI  125
              V+   A     L +    + +H  L   + EA  +G E T +++LR+ + E+ DV+++
Sbjct  447  QPVSTPGAAMFRALHWTGRDEAVHTILMAKVNEAAAQGAEKTAIEDLRSFLLEYRDVFQL  506

Query  126  HVGADPPADVEP  137
              G D P  V+P
Sbjct  507  EFGRDSPVKVDP  518

>PHYSO_388784
Length=264

 Score = 57.4 bits (137),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 60/114 (53%), Gaps = 7/114 (6%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C   V +DL+++TA G + +   +C V  G E  FLL  + ++ +GID  R  EQ   G 
Sbjct  158  CTHEVVVDLQLQTAAGMVRVASVACLVMGGGETGFLLVDEMLKSLGIDVHRQLEQLAGGD  217

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLV  116
             V D   DD+   +A      D D + R LD ML     EGF+P+L +ELR L+
Sbjct  218  AVLD---DDLFEPEAP---PADTDVVVR-LDDMLVAVLREGFDPSLYEELRQLM  264

>PYIW_27461
Length=158

 Score = 55.5 bits (132),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 64/140 (46%), Gaps = 20/140 (14%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + C  +V +DL    A  P+ LR   C V  G E   +LG  T+  + +D + L +Q   
Sbjct  10   LFCYEAVLMDLLSNKAAAPIRLRVMYCVVIGGDETNLILGNGTLVSLDVDVNHLIKQ---  66

Query  61   GGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAK--DEGFEPTLLDELRTLVYE  118
               ++DAA  D            ++D +  + + +L + +    GF+   L  L  +V E
Sbjct  67   ---LADAAPSD------------NIDPLSTDNEELLSQTEPVKNGFDSAYLGHLHDVVME  111

Query  119  HDDVWRIHVGADPPADVEPL  138
            H+D++   +G D P D E L
Sbjct  112  HEDIFTADLGPDEPVDTELL  131

>PHYSO_309620
Length=323

 Score = 56.6 bits (135),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 6/86 (7%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + C  SV LD+ ++TA G + LR   C V +GSE +FLLG  T+  +GID +   EQ  +
Sbjct  235  VTCFDSVVLDIVLQTAAGAVKLREVKCLVMEGSETDFLLGNDTLVSLGIDVNHQLEQLAE  294

Query  61   GGRVSDAAGDDVTNYDADL-RFEIDM  85
            G     A  +DV  ++ D+ +F++ +
Sbjct  295  G-----AVPEDVDPFEVDIFKFKVKI  315

>PHYCA_114143
Length=102

 Score = 53.1 bits (126),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 7/103 (7%)

Query  39   LGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDADLRF---EIDMDDIHRNLDRM  95
            +G+  ++ +GID D   EQ     +  D   DD  + D  L     +    D+   +++M
Sbjct  1    MGQDLLKALGIDIDHQLEQ---LAKRVDNVEDDSVDLDEMLPGSGPDPTAKDLQEAMEKM  57

Query  96   LQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            ++ A + GF   L  +LR +VY+HD +WR+ +G DPPA V+PL
Sbjct  58   VRAALEHGFPQHLEAQLRAIVYKHD-IWRLELGNDPPAKVKPL  99

>PYAR_26707
Length=172

 Score = 54.7 bits (130),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 1/52 (2%)

Query  87   DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            +I   ++ M++ A +EGF P  LD LRT++Y H D+WR+ +G DPPA V+PL
Sbjct  27   EIKVAVEDMIRRAVEEGFPPEKLDRLRTVIYMH-DIWRVRLGNDPPARVDPL  77

>PHYSO_261195
Length=481

 Score = 56.2 bits (134),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 57/114 (50%), Gaps = 4/114 (4%)

Query  4    RASVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            R    L L + TA GP+N L+   C + D  EDEFLLG   ++ +GID +R  E      
Sbjct  344  REMTKLRLSLMTAAGPVNILKPVPCLILDNKEDEFLLGDNVLKALGIDVERQLELLATPR  403

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLV  116
                   ++V    A    + D + I + ++ M+Q A DEGF    ++ LRT+V
Sbjct  404  GDDGDDDEEVPEAAAG---DNDAEAIRQAVEAMIQRALDEGFPADKVERLRTIV  454

>PPTG_00243
Length=232

 Score = 55.1 bits (131),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 70/133 (53%), Gaps = 22/133 (17%)

Query  7    VTLDLRIETAVGPLNLR-GASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVS  65
            V L LR+ TA GP+ L+    C + +  E EF+LGR   +D G ++ +            
Sbjct  97   VRLRLRLNTAAGPVGLQEPVDCLIIECDEPEFILGRDEGEDEGEEDLQ-----------D  145

Query  66   DAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRI  125
            D     +++ D DL+           L+R++  A D+GF   L  +LR +V++HD +WR+
Sbjct  146  DLPSISLSSTDKDLQ---------DALERIISSALDQGFPSHLEQQLRAIVFKHD-IWRL  195

Query  126  HVGADPPADVEPL  138
             +G DPPA+VE L
Sbjct  196  ELGNDPPANVEAL  208

>PHYSO_374083
Length=102

 Score = 52.8 bits (125),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 54/114 (47%), Gaps = 29/114 (25%)

Query  39   LGRKTMQDIGIDNDRLFEQPVD--------------GGRVSDAAGDDVTNYDADLRFEID  84
            LG+  ++  GID DR  EQ  +              G  VS +   D             
Sbjct  1    LGQDLLKQPGIDVDRQLEQLAEREADDGEDPVDDDDGAPVSSSPPTDA------------  48

Query  85   MDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
              D+H+ ++R++Q A   GF   L ++LR +  +HD +WRI +G DPPA V+PL
Sbjct  49   --DLHQAVERLVQMALQHGFPRHLEEQLRAIAIKHD-IWRIELGNDPPARVKPL  99

>PHYCA_98759
Length=197

 Score = 54.7 bits (130),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 9/98 (9%)

Query  47   IGIDNDRLFEQPVDGGRVSDAAGDDVTNYDAD---LRFE---IDMDDIHRNLDRMLQEAK  100
            +GID +R  EQ + G  V + +GD V   +AD   +R E    + DD+   ++R++++A 
Sbjct  2    LGIDVERQLEQ-LAGRNVDETSGDPV-ELEADESPVRLEEPQAENDDVFAAVERLVEQAV  59

Query  101  DEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            + GF    LD LRT+V+ + DVWR+ +  DPPA V PL
Sbjct  60   ENGFPADKLDRLRTIVHAY-DVWRLTLQDDPPARVPPL  96

>PHYSO_416157
Length=98

 Score = 52.0 bits (123),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 9/98 (9%)

Query  47   IGIDNDRLFEQPVDGGRVSDAAGDDVTNYDAD-LRF-----EIDMDDIHRNLDRMLQEAK  100
            +GI+ D+  EQ    GR  D    D  + +AD L F     E   DDI   ++R++  A 
Sbjct  1    LGINVDQQLEQ--LAGRGEDETSGDSFDLEADDLPFSPGQPESSDDDIFAAVERLISRAV  58

Query  101  DEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            + GF    +++LRT+V+ +D VWR+ + ADPPA+V PL
Sbjct  59   ENGFPADRVEQLRTIVHAYD-VWRLELRADPPANVPPL  95

>PHYSO_403766
Length=184

 Score = 53.5 bits (127),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 1/56 (2%)

Query  2    LCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
             C  +  +D++I T+ GP+NL    C V +G E +FLL RK M+ +GID  R FEQ
Sbjct  129  FCHEAAQIDVQIRTSAGPVNLYKLDCLVVEG-EKQFLLSRKVMKRLGIDVKRAFEQ  183

>H257_13207
Length=517

 Score = 54.7 bits (130),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 68/149 (46%), Gaps = 20/149 (13%)

Query  7    VTLDLRIETAVGPLNLRGAS-CFV-RDGSEDEFLLGRKTMQDIGIDNDRLFEQ-------  57
            V L L ++TA GP+ + G   C+V  DG  DEFL+   T++ IGID D L EQ       
Sbjct  288  VDLTLTMQTAAGPVKVPGKRRCYVVNDG--DEFLVSDDTLKTIGIDIDHLLEQVGRLQWD  345

Query  58   -------PVDGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLD  110
                    V G  V       V          +  +++   L  M+  A D GF    + 
Sbjct  346  EDSDDQEEVCGYCVESPQRSAVRAATMKAVLPVAKNEVEEALQGMIDGADDNGFPMEHVK  405

Query  111  ELRTLVYEHDDVWRIHV-GADPPADVEPL  138
             L  ++ +H D+WRI   G+D PA V+PL
Sbjct  406  YLWDVLSKH-DIWRIKFDGSDSPAKVKPL  433

>PHYCA_102404
Length=122

 Score = 52.0 bits (123),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 1/53 (2%)

Query  86   DDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            +++ + ++ M+  A + GF     D+LRT+VY +D +WR+H+G DPPA VEPL
Sbjct  1    NEVRQAVEGMIANALENGFPAEKEDQLRTIVYMYD-IWRLHLGPDPPAKVEPL  52

>PHYCA_123491
Length=291

 Score = 53.9 bits (128),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (8%)

Query  3    CRASVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDG  61
             +    L L I TA GP+  ++     V D  + EF++G   +  +GID D   EQ    
Sbjct  117  AKLKAKLHLMIHTAAGPVEPMKMVDVLVVDIDDGEFIVGNDLLTSLGIDVDHQLEQ--LA  174

Query  62   GRVSDAAGDDVTNYDAD-LRFEIDM------DDIHRNLDRMLQEAKDEGFEPTLLDELRT  114
             R  D    D    +AD +   +D       D I   ++R++  A   GF    +++LRT
Sbjct  175  TRCEDETSGDPIELEADEMPVNLDASNPSGDDAIFAAVERLIDRALANGFPVEYVEQLRT  234

Query  115  LVYEHDDVWRIHVGADPPADVEPL  138
              + +D +WR+ +  DPPA+V PL
Sbjct  235  TAHAYD-IWRLELRDDPPANVPPL  257

>H310_03908
Length=242

 Score = 53.5 bits (127),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 68/150 (45%), Gaps = 17/150 (11%)

Query  4    RASVTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPV---  59
             A V L L ++TA GP+   G   C+V   S DEFL    T++ + ID +RL EQ     
Sbjct  34   HAFVDLTLNLQTAAGPVKTPGNRLCYVVH-SGDEFLASDDTLKAVAIDINRLLEQVATLQ  92

Query  60   -----DGGRVSDAAGD-----DVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLL  109
                 D G   DA  +      V    A L      D +   L  +++EA   GF    +
Sbjct  93   LDNGDDLGEDGDALKELSHCSTVRANSAMLGLPDAKDAVEHFLQELVEEAVGNGFPNEFV  152

Query  110  DELRTLVYEHDDVWRIHV-GADPPADVEPL  138
              L  ++ +HD  WR    G+DPPA V+PL
Sbjct  153  QHLWRVLTKHD-TWRAKFDGSDPPARVKPL  181

>PHYRA_78352
Length=370

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 61/142 (43%), Gaps = 14/142 (10%)

Query  2    LCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDG  61
            +C   + LDL + T  G +NLR   C V +G  DE LLG+  ++ +GI  D+   Q  D 
Sbjct  58   VCEMEIVLDLELVTIAGAVNLRAVPCLVLEGEGDEVLLGKDALKRLGIVVDQTLAQLADS  117

Query  62   GRVSD-----AAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLV  116
              + D       GD++   DA +            LD +L      G        +R ++
Sbjct  118  TLLEDEEEEYPVGDELPG-DASIPIT--------TLDELLDRTVANGLPHEHTTAVRDML  168

Query  117  YEHDDVWRIHVGADPPADVEPL  138
                ++WR  V +   A VEPL
Sbjct  169  DLFPEIWRDAVSSGAAASVEPL  190

>H257_14705
Length=1230

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 67/135 (50%), Gaps = 15/135 (11%)

Query  15   TAVGPLNLRGA-SCFV-RDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGD--  70
            TA GP+ + G   C+V  DG  DEFL+   T++ IGID DRL +   DG  + +  GD  
Sbjct  604  TASGPVKVAGKRHCYVVNDG--DEFLVSDDTIKTIGIDIDRL-QVDEDGDNLEEVGGDCV  660

Query  71   ------DVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWR  124
                   V          +  +++   L  M+  A D GF    +  L  ++ +H D+WR
Sbjct  661  ELPQRSAVRAATMKAVLPVATNEVEEALQGMIDGAVDNGFPMEHVKYLWDVLSKH-DIWR  719

Query  125  IHV-GADPPADVEPL  138
            I   GADPPA V+PL
Sbjct  720  IKFNGADPPAKVKPL  734

>PHYSO_412316
Length=188

 Score = 53.1 bits (126),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 1/56 (2%)

Query  2    LCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
             C  +  +D++I T+ GP+NL    C V +G E +FLL RK M+ +GID  R FEQ
Sbjct  132  FCHEAAQIDVQIRTSAGPVNLYKLDCLVVEG-EKQFLLSRKVMKRLGIDVKRAFEQ  186

>PHYCA_68972
Length=232

 Score = 53.5 bits (127),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 56/115 (49%), Gaps = 1/115 (1%)

Query  3    CRASVTLDLRIETAVGPLNLRG-ASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDG  61
            C++ V L L + TA GP+ + G   C + +  E EF+LG+  +  +GID DR  EQ    
Sbjct  118  CKSYVCLRLLLNTAAGPVAIHGPVQCLIIESDEPEFILGQDVLLSLGIDVDRQLEQLAGR  177

Query  62   GRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLV  116
                D    +  +   D+      +D+   L+R++  A + GF   L  +LR +V
Sbjct  178  NDDEDDGESEEKDNLIDIAPPCTNEDLQDALERLVATALENGFPRKLETKLRAIV  232

>PYIW_16340
Length=207

 Score = 52.8 bits (125),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 62/133 (47%), Gaps = 3/133 (2%)

Query  7    VTLDLRIETAVGPLNLR-GASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVS  65
            V L + + TA GP+  +    C V    EDE ++G+  + ++GID  R  E         
Sbjct  62   VDLFVTLHTAAGPVRCQDSKGCLVVSNDEDELIVGKPLLIELGIDISRQLEMLATQAVNL  121

Query  66   DAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRI  125
            DA          + R  +D+ +    ++ ML  A         L++LR + Y  D +WR+
Sbjct  122  DADDPSKLAEAPEPRACVDVSE-AEAIEGMLATAVRRDMPKENLEKLRVVFYMFD-IWRL  179

Query  126  HVGADPPADVEPL  138
             +G DPP+ VEPL
Sbjct  180  VLGDDPPSKVEPL  192

>H310_13354
Length=507

 Score = 53.5 bits (127),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 19/152 (13%)

Query  6    SVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVS  65
            +V L +++ TA G + L G   F    + DE ++ + ++Q IG+D  +L EQ        
Sbjct  306  TVDLSVKLHTAAGQVKLPGKHRFYVVDTNDELIVSKYSLQSIGLDMTKLLEQVAVRQGEG  365

Query  66   DAAGDDVTNYDADLRFEI---DMDDIHRNLDRMLQEAKDEGFE------PTLL-------  109
            D       N   D+ F+I   ++ D+++ LD     A ++ FE       TL+       
Sbjct  366  DGDDIGDPNEGEDVAFKICVRNLHDMNKQLDAEDMSAAEQLFEMAMKTNSTLVADDAVQR  425

Query  110  DELRTLVYE--HDDVWRIHV-GADPPADVEPL  138
            D+L+ +V +     VWR    G DPPADV+P+
Sbjct  426  DQLKMVVIDAAASGVWRSKFRGTDPPADVDPM  457

>PHYCA_65750
Length=453

 Score = 53.5 bits (127),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 0/66 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            +LC  +  LDLR++T  GP++L   +C V +G E+EF+LG   +  +GID +    Q   
Sbjct  363  ILCHDAAKLDLRLQTVAGPVHLSDVNCIVLEGDEEEFILGNDMLVSLGIDVNEQLSQLAS  422

Query  61   GGRVSD  66
            G  V D
Sbjct  423  GTFVED  428

>SDRG_17372
Length=695

 Score = 53.5 bits (127),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 53/172 (31%), Positives = 75/172 (44%), Gaps = 44/172 (26%)

Query  4    RASVTLDLRIETAVGPLNLRGA-SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            + SV + L+I+TA GP+N+ GA +C+V D  E EFLL   T++ IGID DRL EQ     
Sbjct  394  KDSVDIKLQIQTAAGPVNIPGAQTCYVVDDGE-EFLLSNATLKSIGIDIDRLLEQL--AA  450

Query  63   RVSDAAGDDV---------------------------TNYDADLRFEIDMDDIHRNLDRM  95
            R  D  G D+                            +  A+ R  +D       + R+
Sbjct  451  RQFDDDGHDLATDDDDDACARVPPRPTSGTSGVPVVPVSTTAETRRVVDARASEAVVGRL  510

Query  96   -----------LQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGA-DPPADV  135
                       + EA  +GF   + + L  +V +H DVWR      DPPA V
Sbjct  511  PFEAVAGLKISIDEATAQGFPAEMRNRLWRIVTKH-DVWRTAFDPRDPPAMV  561

>SDRG_17367
Length=674

 Score = 53.5 bits (127),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 53/172 (31%), Positives = 75/172 (44%), Gaps = 44/172 (26%)

Query  4    RASVTLDLRIETAVGPLNLRGA-SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            + SV + L+I+TA GP+N+ GA +C+V D  E EFLL   T++ IGID DRL EQ     
Sbjct  373  KDSVDIKLQIQTAAGPVNIPGAQTCYVVDDGE-EFLLSNATLKSIGIDIDRLLEQL--AA  429

Query  63   RVSDAAGDDV---------------------------TNYDADLRFEIDMDDIHRNLDRM  95
            R  D  G D+                            +  A+ R  +D       + R+
Sbjct  430  RQFDDDGHDLATDDDDDACARVPPRPTSGTSGVPVVPVSTTAETRRVVDARASEAVVGRL  489

Query  96   -----------LQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGA-DPPADV  135
                       + EA  +GF   + + L  +V +H DVWR      DPPA V
Sbjct  490  PFEAVAGLKISIDEATAQGFPAEMRNRLWRIVTKH-DVWRTAFDPRDPPAMV  540

>PHYRA_85507
Length=686

 Score = 53.1 bits (126),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)

Query  2    LCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDG  61
            +C   V LDL + T  G +NLR   C V +G  DEFLLG+  ++ +GID D+   Q  D 
Sbjct  358  VCEMEVVLDLELVTIAGAVNLRAVPCLVLEGEGDEFLLGKDALKRLGIDVDQTLAQLADS  417

Query  62   GRVSD  66
              + D
Sbjct  418  TLLED  422

>PHYCA_119571
Length=157

 Score = 51.6 bits (122),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 15/110 (14%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + C+ S+ LDL + T  G + +R  +C + +  EDEFLLGR T++ +GID +        
Sbjct  28   ITCKESIQLDLELITPAGRVRMRQVTCVITETEEDEFLLGRLTLEALGIDVE--------  79

Query  61   GGRVSDAAGDDVTNYD-----ADLRFE-IDMDDIHRNLDRMLQEAKDEGF  104
             G++S  A  ++ ++D       + F   D   I   L  ++ EA   GF
Sbjct  80   -GQLSALANKEIVDFDPLESEPPVNFNPPDKGKIMGRLCELINEAVTNGF  128

>PHYSO_408655
Length=154

 Score = 50.8 bits (120),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 55/108 (51%), Gaps = 15/108 (14%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C  S+ LDL + T  G + +R  +C + +  EDEFLLGR T++ +GID +         G
Sbjct  50   CDESIQLDLELITPAGKVRMRKVTCIMTETEEDEFLLGRLTLKTLGIDVE---------G  100

Query  63   RVSDAAGDDVTNYD---ADLRFEIDMDDIHRNLDR---MLQEAKDEGF  104
            ++S  A  ++ ++D   ++     D  D  + + R   ++ EA   GF
Sbjct  101  QLSALANKEIVDFDPFESETPMSFDPPDKKKVIARLCELINEAVANGF  148

>PHYCA_127584
Length=124

 Score = 50.1 bits (118),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 1/52 (2%)

Query  87   DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            D+   +++M+  A + GF   L  +LR +VY+HD +WR+ +G DPPA V+PL
Sbjct  26   DLQEAMEKMVCAALEHGFPQHLKAQLRAVVYKHD-IWRLELGNDPPAKVKPL  76

>PHYSO_413621
Length=120

 Score = 50.1 bits (118),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            C     +D+++ TA G +NLR   C V DG  DEFLLG +T++ +GI+ + L E+
Sbjct  64   CTEMCEVDVQLLTAAGAVNLRRLQCVVIDGDADEFLLGDRTLKSLGINVNHLLER  118

>PHYCA_96803
Length=292

 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 14/117 (12%)

Query  9    LDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDA  67
            L + I TA GP+ L     C + D  +DEF++GR  +  +GID DR  EQ     RV D 
Sbjct  181  LHVLIHTAAGPVQLAETVPCLIMDVDDDEFIIGRDLLTSLGIDVDRQLEQ--LASRVDDE  238

Query  68   AGDDVTNYDADLRFEIDMDDIHRNLDR--------MLQEAKDEGFEPTLLDELRTLV  116
               D    +AD   E+  +  H   D         +++ A   GF P  +D+LR +V
Sbjct  239  TSGDPFELEAD---ELPANPTHVASDEEVRAAVEVLIERALKNGFPPDKVDKLRVIV  292

>PHYCA_103492
Length=210

 Score = 50.8 bits (120),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 50/103 (49%), Gaps = 23/103 (22%)

Query  47   IGIDNDRLFEQ-----------PVDGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRM  95
            +GID D   EQ           PVD   +   +G D T             D+   +++M
Sbjct  1    LGIDIDHQLEQLAKRADNVEDDPVDLDEMLPVSGPDPT-----------AKDLQEVMEKM  49

Query  96   LQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            ++ A   GF   L  +LR +VY+HD +WR+ +G DPPA V+PL
Sbjct  50   VRAALKHGFPQHLEAQLRAVVYKHD-IWRLELGNDPPAKVKPL  91

>PYIW_17069
Length=252

 Score = 51.2 bits (121),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 54/115 (47%), Gaps = 7/115 (6%)

Query  26   SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDADLR--FEI  83
             C V +  EDEF++GR  + ++GID D   E          A  DD    D  L     +
Sbjct  97   QCLVIESQEDEFIVGRLMLVELGIDVDCQLEMLA----AQSAGYDDPMEMDEALNPVAGV  152

Query  84   DMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
              +D+ + +D ++ E   +GF     ++LR   +    +WR  +G DPPA V PL
Sbjct  153  KSEDVAKAIDFLVGEVIRKGFPAANREKLRVACHMW-GIWRFALGDDPPAKVGPL  206

>H310_10891
Length=648

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 40/154 (26%), Positives = 68/154 (44%), Gaps = 32/154 (21%)

Query  11   LRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDG---------  61
            +++ET+ GPL LRG         + + L+G+  M+ +G   D +  Q +           
Sbjct  367  VQLETSFGPLVLRGLK------QDCDLLIGKPVMEVLGFSQDGMLVQALRKKTAWDHDDV  420

Query  62   -------GRVSD------AAGDDVTNYD----ADLRFEIDMDDIHRNLDRMLQEAKDEGF  104
                   GR+S        AG+   + D     +++    + ++ R L+  + EA++ G 
Sbjct  421  EVPTTPLGRISRLRDVSVEAGEGTVDDDLCTTPEVKLRSVVAEVKRILNMKVAEARECGL  480

Query  105  EPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
                   L  +V  H DV+R+  G DPP DVEPL
Sbjct  481  SEHQCSTLHGIVMRHVDVFRLEFGQDPPVDVEPL  514

>PHYRA_77067
Length=1021

 Score = 51.2 bits (121),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 4/97 (4%)

Query  10   DLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSD--A  67
            +L  E    PL        V +G +D+FLLGR T+++IGID D L EQ   GGR  +  A
Sbjct  359  ELGAEVTTAPLA--EVPVVVLEGPKDKFLLGRVTLKEIGIDIDYLLEQLASGGREGEIGA  416

Query  68   AGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGF  104
            A +D    + +LRFE +  D+   +  ++ +A   GF
Sbjct  417  ADEDDLPPEEELRFEAEDGDVAAAMGYLVDDAVANGF  453

>H257_18441
Length=626

 Score = 50.8 bits (120),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 69/147 (47%), Gaps = 20/147 (14%)

Query  7    VTLDLRIETAVGPLNLR-GASCFV-RDGSEDEFLLGRKTMQDIGIDNDRLFEQPV-----  59
            V L L ++TA GP+ +     C+V  DG  DEFL+   T++ IGID DRL EQ       
Sbjct  451  VDLTLTMQTAAGPVKVPDKRRCYVVNDG--DEFLVSDDTLKTIGIDVDRLLEQVARLQVD  508

Query  60   -DGGRVSDAAGDDVTNYDADLRFEIDM--------DDIHRNLDRMLQEAKDEGFEPTLLD  110
             DG  +    GD V            M        +++   L  M+  A D GF    + 
Sbjct  509  EDGDDLDKVGGDCVELPQRSAVRAATMKAVLPAAKNEVEEALQGMIDGAVDNGFPMEHVK  568

Query  111  ELRTLVYEHDDVWRIHV-GADPPADVE  136
             L  ++ +H D+WRI   G+DPPA V+
Sbjct  569  YLWDVLSKH-DIWRIKFDGSDPPAKVK  594

>PHYCA_62543
Length=99

 Score = 48.1 bits (113),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 54/97 (56%), Gaps = 7/97 (7%)

Query  47   IGIDNDRLFEQPVDGGRVSDAAGDDVTNYDADLRFEIDMD-----DIHRNLDRMLQEAKD  101
            +GID DR  EQ +    V D +GD V     D+   ++ D     DI   ++R++  A +
Sbjct  2    LGIDVDRQLEQ-LAVHNVDDMSGDPVELEADDMPINLNEDPSEDDDIFAAVERLIDRAVE  60

Query  102  EGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             GF    +++LRT+ + +D VWR+ +  DPPA+V P+
Sbjct  61   NGFPLDRVEQLRTIAHAYD-VWRLELRGDPPANVPPM  96

>PHYSO_532673
Length=185

 Score = 49.7 bits (117),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 55/108 (51%), Gaps = 15/108 (14%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C  S+ LDL + T  G + +R  +C + +  EDEFLLGR T++ +GID +         G
Sbjct  51   CDESIQLDLELITPAGKVLMRKVTCIITETEEDEFLLGRLTLKALGIDVE---------G  101

Query  63   RVSDAAGDDVTNYD---ADLRFEIDMDDIHRNLDR---MLQEAKDEGF  104
            ++S  A  ++ ++D   ++     D  D  + + R   ++ EA   GF
Sbjct  102  QLSALANKEIVDFDPFESETPMSFDPPDKKKVIARLCELINEAVANGF  149

>PHALS_04869
Length=129

 Score = 48.5 bits (114),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 62/134 (46%), Gaps = 11/134 (8%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSD  66
            V LDL+I TA GP+N+    C+V +  +D+F+LGR  ++ +GI+     +   +     +
Sbjct  2    VFLDLQIRTAAGPVNVHNVKCYVLEEGDDQFMLGRDVLEALGINVKSALKHLANTS--IE  59

Query  67   AAGDDVTNYD--ADLRFEIDMDDIHRNLDRMLQEAKDEG---FEPTLLDELRTLVYEHDD  121
               DD+ N     DL  E    ++    D +  +  DE    F   LLD    +      
Sbjct  60   LNRDDLPNEPKVGDLIDEKVNVELKWMCDEITVQTSDETQRDFNAKLLD----IHNSCKR  115

Query  122  VWRIHVGADPPADV  135
            +WR  VG D PA V
Sbjct  116  LWRTKVGPDEPALV  129

>PHYSO_299586
Length=267

 Score = 50.1 bits (118),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/177 (25%), Positives = 68/177 (38%), Gaps = 40/177 (23%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSED----EFLLGRKTMQDIGIDNDRLFE  56
            M+ +  + LDLR +T  G L L+  +C+V  G       +FLL    M+ +G +   L +
Sbjct  78   MMIKQEIKLDLRFDTIYGGLTLKNLTCWVVSGGRPPGMGDFLLSEGVMERLGYNAQALLD  137

Query  57   QPVDGGRVSD----------------AAGDDVTNYDADLRFEIDMDDIHRN---------  91
            Q      V D                +A        A  + E+  D+  R          
Sbjct  138  QARSISDVYDMDEDVAPTGVRSVLTYSAATTTQPEPASEKKELQPDEEQRCFPDIDVAQD  197

Query  92   -----------LDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEP  137
                       L+  L EA   G       EL  +++E+ DV+RI +G DPP D+ P
Sbjct  198  RDEARALEWEILESKLDEAAKLGCSAEFRAELAKILFEYRDVFRIKLGRDPPVDMPP  254

>PHYCA_131357
Length=270

 Score = 50.1 bits (118),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 44/76 (58%), Gaps = 9/76 (12%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + C+ S+ LDL + T  G + +R  +C + +  EDEFLLGR T++ +GID +        
Sbjct  199  ITCKESIQLDLVLITPAGRVRMRQVTCVITETEEDEFLLGRLTLEALGIDVE--------  250

Query  61   GGRVSDAAGDDVTNYD  76
             G++S  A  ++ ++D
Sbjct  251  -GQLSALANKEIVDFD  265

>PHYCA_72350
Length=93

 Score = 47.4 bits (111),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 54/97 (56%), Gaps = 12/97 (12%)

Query  47   IGIDNDRLFEQPVDGGRVSDAAGDD---VTNYDADLRFEIDMDD--IHRNLDRMLQEAKD  101
            +GID +R  EQ      +++  GDD   + + D+   F   + D  +   +++++Q+A  
Sbjct  1    LGIDINRQLEQ------LAEREGDDDACLVDEDSAPIFTSTLKDTDLKEAVEQLVQKALG  54

Query  102  EGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             GF      +LR +  +HD +WRI++G DPPA V+PL
Sbjct  55   HGFPREFEQQLRAIALKHD-IWRINLGKDPPARVKPL  90

>PHYRA_81909
Length=840

 Score = 50.1 bits (118),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 67/160 (42%), Gaps = 31/160 (19%)

Query  10   DLRIETAVGPLNLRGASCFVRDGSEDEFL-LGRKTMQDIGIDNDRLF--------EQPVD  60
            ++ +ET  GPL LRG  C++ +  +   L + R  M+ +G    +L         E  +D
Sbjct  456  EVTLETPAGPLMLRGLVCWIDENDKSHALTISRLVMKRLGYSTPKLLADAKVRSDEYHLD  515

Query  61   GGRVSDAAGDDVTNYDADLR----------------------FEIDMDDIHRNLDRMLQE  98
               +S+AA    T   A +R                       EID   +       +QE
Sbjct  516  EMDLSEAADRKFTRMHAIMRNKTEEYFEADEVDDLVTTPSLIAEIDQQGVQAVSAAKVQE  575

Query  99   AKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            A++ G     ++ L+ L+  + D++R+  G DPP  V PL
Sbjct  576  AREAGLPSDCVETLQQLLVRYCDIFRLAFGNDPPIKVPPL  615

>PHYCA_42434
Length=93

 Score = 47.0 bits (110),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 55/97 (57%), Gaps = 12/97 (12%)

Query  47   IGIDNDRLFEQPVDGGRVSDAAGDD---VTNYDADLRFEIDMDD--IHRNLDRMLQEAKD  101
            +GID +R  EQ      +++  GDD   +++ D+   F   + D  +   +++++Q+A +
Sbjct  1    LGIDINRQLEQ------LAEREGDDDACLSDEDSAPIFTSTLKDTDLKEAVEQLVQKALE  54

Query  102  EGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             GF      +LR +  +HD +WRI++G  PPA V+PL
Sbjct  55   HGFPREFEQQLRAIALKHD-IWRINLGKGPPARVKPL  90

>PITG_19012
Length=111

 Score = 47.4 bits (111),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 35/63 (56%), Gaps = 0/63 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            ++C  SV +D+ ++TA G + L   +C V +G E +  LG  T+  +GID  +  EQ   
Sbjct  48   VICFDSVKVDVVLQTAAGTVKLPDVTCLVMEGEETDLFLGNNTLASLGIDVSQQLEQLAG  107

Query  61   GGR  63
            G R
Sbjct  108  GAR  110

>PHYCA_133032
Length=110

 Score = 47.4 bits (111),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDR  53
            C  SVTLD+ ++TA G   L   +C + +GSE +FLLG  T+  +GID + 
Sbjct  57   CCDSVTLDIVLQTAAGTGRLHEVTCLIMEGSESDFLLGNDTLVSLGIDVNH  107

>PHYRA_78074
Length=1098

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 15/120 (13%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            C  S+ LD+ + T  G + +R  +C + +  E EFLLGR T++ +GID +         G
Sbjct  73   CDESIQLDMELITPAGKVRMRKVTCIITETEEHEFLLGRLTLKALGIDVE---------G  123

Query  63   RVSDAAGDDVTNYDAD-----LRFE-IDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLV  116
            ++S  A  ++ ++D+      + F+  D   I   L  ++ EA   GF      EL  +V
Sbjct  124  QLSALANKEIVDFDSSESETPMSFDPPDKKKIIAQLCELINEAVANGFPAERKRELFEVV  183

>PHALS_11866
Length=117

 Score = 47.0 bits (110),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (60%), Gaps = 0/57 (0%)

Query  1   MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           + C + V LDL+I TA  P+N+    C+V +  +D+F+LGR  ++ + I+     EQ
Sbjct  27  LTCTSMVFLDLQIRTAARPVNVHNVKCYVLEKGDDQFMLGRDVLEALVINVKSALEQ  83

>PHYCA_111030
Length=119

 Score = 47.0 bits (110),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 5/109 (5%)

Query  27   CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDADLRFEIDMD  86
              + DG ++EF++G   +  +GID  R  EQ  D G   + +GD +     ++   +D  
Sbjct  6    VLIVDGDDEEFIVGNDLLTSLGIDVHRQLEQLADRGD-DETSGDPIELEADEMSVNVDGV  64

Query  87   D---IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPP  132
            D   I   ++R++  A   GF    +++LRT+ + +  VWR+ +  DPP
Sbjct  65   DSRGIFAAVERLIDRAVANGFLQDRVEQLRTIAHAY-AVWRLELCGDPP  112

>PHYRA_85982
Length=552

 Score = 48.5 bits (114),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 8/136 (6%)

Query  7    VTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ-PVDGGRV  64
            V + L + TA GP+  +    C +    +DE ++GR  + ++GID DR  EQ  V   R 
Sbjct  54   VDVYLCLNTAAGPVRCQDPKRCLIVKSDDDELIVGRVLLAELGIDVDRELEQLAVRNLRD  113

Query  65   SDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDE--LRTLVYEHDDV  122
             D  GD        +R E   +++   +D M+ +  + G      +E  LR +++  +  
Sbjct  114  DDEFGDPT---GIPVREETLDEEVATVIDGMITDCLERGIVSPGAEEERLRAILFSFNG-  169

Query  123  WRIHVGADPPADVEPL  138
            WR+ +G DPPA V PL
Sbjct  170  WRLVLGDDPPAKVPPL  185

>PHALS_04710
Length=140

 Score = 46.6 bits (109),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (58%), Gaps = 0/57 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            + C + V LDL+I  A GP N+    C+V +  +D F+LGR  ++ +GI+   ++  
Sbjct  77   LTCTSMVFLDLQIRAAAGPGNIHNVKCYVFEEGDDHFMLGRDVLEALGINIKSIWNN  133

>PPTG_23990
Length=557

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 68/159 (43%), Gaps = 35/159 (22%)

Query  11   LRIETAVGPLNLRG--ASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD--------  60
            +++ T  GPL LR   A  F  + S+   +L R  M+ +G   D +  +  D        
Sbjct  301  IQLRTTAGPLLLRNTRAWVFEEETSKPVLVLSRPVMEHLGYSADTILARACDTRQEWDLQ  360

Query  61   ---GGR------------VSDAAGDDVTNYDADLRF---EIDM---DDIHRNLDRMLQEA  99
               GG             +SD+A  D T    DLR    E+D    D +   L   ++EA
Sbjct  361  ELGGGERSASINLIRDNSLSDSARLDTT----DLRVATPELDGKQGDQVAAILQERVEEA  416

Query  100  KDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
               G     +++LR L+ E  DV+R   G DPP  VEPL
Sbjct  417  AIAGLREAEVEQLRLLLLEFQDVFRTSFGHDPPVRVEPL  455

>PHYSO_354718
Length=125

 Score = 46.2 bits (108),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 0/55 (0%)

Query  6   SVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
           S  LDL + T  GP++L    C + +G  DEFLLG+  ++ +GID D+   +  D
Sbjct  22  SSVLDLELVTIAGPVSLGAVPCLILEGGGDEFLLGKDALKRLGIDVDQALAKLAD  76

>PHYRA_86827
Length=813

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 0/65 (0%)

Query  2    LCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDG  61
            +C   + LDL + T  G +NLR   C V +G  DE LLG+  ++ +GI  D+   Q  D 
Sbjct  58   VCEMEIVLDLELVTIAGAVNLRAVPCLVLEGEGDEVLLGKDALKRLGIVVDQTLAQLADS  117

Query  62   GRVSD  66
              + D
Sbjct  118  TLLED  122

>PHYCA_107311
Length=186

 Score = 46.6 bits (109),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSE  34
            ++CR SV LDLRIE A GPL+L   SC V DG E
Sbjct  138  IICRDSVMLDLRIEAAAGPLHLANVSCLVMDGHE  171

>H310_12522
Length=225

 Score = 46.2 bits (108),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 68/163 (42%), Gaps = 40/163 (25%)

Query  15   TAVGPLNLRGASCFVRDGS-EDEFLLGRKTMQDIGIDNDRLF------------------  55
            T  GPL LRG  C++ D S E + ++ R  M  +G   D L                   
Sbjct  14   TTCGPLTLRGLHCWIDDTSPEIDLIISRPVMDLLGFSVDTLLVGARQKNTKWDVSVDDEP  73

Query  56   ------------------EQPV--DGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRM  95
                              ++PV  DG  +  A  +  T  D + R ++  D++   L   
Sbjct  74   PAHGMSKLQRMTTSRHGADEPVLADGDGMECATPEVATVTDEEQRKKMR-DEVFAVLMSK  132

Query  96   LQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            + EA+  G     ++ L+ L+ +H DV+RI +G DPP  VEPL
Sbjct  133  VAEAESCGLTGDDVERLKALLSKHVDVFRIDLGNDPPVKVEPL  175

>H310_04614
Length=231

 Score = 46.2 bits (108),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 69/149 (46%), Gaps = 21/149 (14%)

Query  6    SVTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRV  64
            +V L + + TA G + L G   C+V D S DE ++ +   Q IG+D  +L EQ       
Sbjct  36   TVDLSVTLHTAAGQVKLPGKYRCYVVD-SNDELIVSKHLPQSIGLDMSKLLEQVTVRQGE  94

Query  65   SDAAGDDVTNYDADLRFEI---DMDDIHRNLDRMLQEAKDEGFE------PTLL------  109
             D  G    N    + F+I   ++ D+++ LD     A +  FE      PTL+      
Sbjct  95   GDGDGIGDHNESEYVTFDICVRNLHDMNKQLDAEDMSAAEHLFELAMKTNPTLVAGDAVQ  154

Query  110  -DELRTLVY--EHDDVWRIH-VGADPPAD  134
             D+L+ +V       +WR   +G DPPAD
Sbjct  155  RDQLKMVVIAAAASGMWRSKFLGTDPPAD  183

>H257_18954
Length=657

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 73/152 (48%), Gaps = 27/152 (18%)

Query  7    VTLDLRIETAVGPLNLRGAS-CFV-RDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRV  64
            V L L ++TA GP+ + G   C+V  DG  DEFL+   T++ I ID DRL EQ     R+
Sbjct  372  VDLTLTMQTAAGPVKVPGKRRCYVVNDG--DEFLVSDDTLKTIRIDIDRLLEQ---VARL  426

Query  65   S-DAAGDDVTNYDADLRFEIDMDDIHR--NLDRMLQEAKDE--------------GFEPT  107
              D  GDD+    AD   E+      R   +   L  AK+E              GF   
Sbjct  427  QVDEDGDDLEEVGADC-VELPQRSAVRAATMKAALPVAKNEVEEALQGIDGAVDNGFPME  485

Query  108  LLDELRTLVYEHDDVWRIHV-GADPPADVEPL  138
             +  L  ++ +H D+ RI   G+DPPA V+PL
Sbjct  486  RVKYLWDVLSKH-DIRRIKFDGSDPPAKVKPL  516

>H257_13808
Length=1239

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 41/125 (33%), Positives = 58/125 (46%), Gaps = 19/125 (15%)

Query  29   VRDGSEDEFLLGRKTMQDIGIDNDRLFEQPV------DGGRVSDAAGD--------DVTN  74
            V DG  DEF+    T++ IGID DRL EQ        DG  + +  GD         V  
Sbjct  617  VNDG--DEFV-SDDTLKTIGIDIDRLLEQVARLQVDEDGDDLEEVGGDCVELPQRSAVRA  673

Query  75   YDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHV-GADPPA  133
                    +  +++   L  M+  A D GF    +  L  ++ +H D+WRI   G+DPPA
Sbjct  674  ATMKAVLPVAKNEVEEALQGMIDGAVDNGFPMEHVKYLWDVLSKH-DIWRIKFDGSDPPA  732

Query  134  DVEPL  138
             V+PL
Sbjct  733  KVKPL  737

>PPTG_16122
Length=370

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 71/173 (41%), Gaps = 43/173 (25%)

Query  4    RASVTLDLRIETAVGPLNLRGASCFVRDGS----EDEFLLGRKTMQDIGIDNDRL-----  54
            R+ V LDLR  T  GPL LR   C+V + S      + LL    M+ +G  + +L     
Sbjct  183  RSKVKLDLRFTTPGGPLILRNVICWVTEDSLPAGVGDLLLSHYIMERLGYSSKKLIAAAQ  242

Query  55   -FEQPVDGGRVSD--------------------------AAGDD-----VTNYDADLRFE  82
              ++  D G V D                             DD       ++D   R E
Sbjct  243  SLQEVWDMGDVEDDCELGLSSVFAYSGVPSAIEPTVEEIQLHDDEDHACFPSFDGAARSE  302

Query  83   IDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADV  135
               D++   L+  L E K+ G     +++LR ++ +  DV+R+ +G DPP D+
Sbjct  303  --HDEVAAVLEEKLAEVKEAGASREYVEQLRVVLVKFKDVFRLQIGRDPPVDM  353

>H257_13377
Length=1079

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 62/157 (39%), Gaps = 28/157 (18%)

Query  10   DLRIETAVGPLNLRGASCFVRDG-SEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAA  68
             L  + A GPL LRG   +V +  +  E  LG   MQ +G +   L E       V D  
Sbjct  279  SLEFKAACGPLMLRGLRVWVDEAVAPVELTLGLPVMQKLGYNEQTLLENARRQQAVWDFG  338

Query  69   GDDVTNYDADLRFEIDMDDIHRNLD----------------------RMLQEAK-----D  101
               +T     +   + M ++   +D                      R++ EAK      
Sbjct  339  DQLITTPGVAMYRTLRMGELSDGIDDDEGMACATPELGNAPDDDGPVRIVLEAKVVKAAT  398

Query  102  EGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             G     +++LR L+ E  DV+R+  G DPP  VEPL
Sbjct  399  AGMTTAAVEQLRGLLMEFRDVFRLKFGRDPPVKVEPL  435

>PHYCA_128121
Length=109

 Score = 43.5 bits (101),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (52%), Gaps = 7/93 (8%)

Query  48   GIDNDRLFEQPVDGGRVSDAAGD-DVTNYDADLRFEIDMDD-IHRNLDRMLQEAKDEGFE  105
            GID DR  EQ V     SD  GD D  N + D    ++ D+ +   +D ++++A D GF 
Sbjct  1    GIDVDRQLEQLVG----SDVTGDEDSVNCNDDYEIGVECDNEVRIAVDELVEKAIDNGFP  56

Query  106  PTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
                D+L   + E   +WR+ +G DPPA V  L
Sbjct  57   RERRDDL-LKIAEMFGIWRLKLGGDPPAKVPAL  88

>PPTG_22307
Length=1044

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 45/176 (26%), Positives = 71/176 (40%), Gaps = 43/176 (24%)

Query  4    RASVTLDLRIETAVGPLNLRGASCFVRDGS----EDEFLLGRKTMQDIGIDNDRL-----  54
            R  V LDLR  T   PL LR  +C+V + S      + LL    M+ +G  +  L     
Sbjct  399  RTKVKLDLRFTTPGEPLILRTVNCWVTEDSLPAGVGDSLLSYYIMEHLGYSSKTLIAAAQ  458

Query  55   -FEQPVDGGRVSDAA--------------------------GDD-----VTNYDADLRFE  82
              ++  D G V D                             DD       ++D   R E
Sbjct  459  SLQEIWDMGDVEDDCELGLSKVLAYSEAPSAIEPTVEKTQLHDDKDRACFPSFDGATRSE  518

Query  83   IDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
               D++   L+  L E K+EG     +++LR ++ +  DV+R+ +G DPP D+  +
Sbjct  519  --DDEVAAVLEEKLAEVKEEGASREYVEQLRVVLVKFKDVFRLKIGRDPPVDMPAM  572

>H310_02566
Length=453

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 66/147 (45%), Gaps = 31/147 (21%)

Query  13   IETAVGPLNLRGASCFV---RDGSEDEFLLGRKTMQDIGIDNDRL----FEQPVDGGRVS  65
            +ET  GPL LRG   +V       E   LL R  M+ +G+  D L    +++ V+   VS
Sbjct  224  LETPCGPLALRGLKVWVDTWPKPGEHLLLLSRSVMERLGLSEDDLLTAAYQKQVEWD-VS  282

Query  66   DA-------------------AGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEP  106
            DA                   A    TN     R E   + + + L   L++A DEG  P
Sbjct  283  DAVLMTALTPKMGCCAPHPTFAQSQGTNNPELARRE---EQVKQMLATKLEQAMDEGLAP  339

Query  107  TLLDELRTLVYEHDDVWRIHVGADPPA  133
             L ++L  L+ E + V+R+ +G DPP+
Sbjct  340  VLAEKLGHLL-EKNMVFRLEIGHDPPS  365

>PYVX_23592
Length=290

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (51%), Gaps = 10/116 (9%)

Query  27   CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVS---DAAGDDVTNYDADLRFEI  83
            C + +  EDEFL+G + + D+GI+ DR  E      R +   D+ GD V       R ++
Sbjct  121  CLIIESPEDEFLVGNELLTDLGINVDRQLE--YLASREADDFDSLGDPVC---VPPREQV  175

Query  84   DMDDIHRNLDRMLQEAKDEG-FEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
              + +   +D ++Q+A   G  + +  + L +++Y+    W + +  DPPA V PL
Sbjct  176  ADELVTNAVDSLIQDAVGRGMLDESTTERLTSIIYQFKG-WILELSDDPPASVPPL  230

>PHYSO_403711
Length=229

 Score = 44.7 bits (104),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 62/136 (46%), Gaps = 3/136 (2%)

Query  4    RASVTLDLRIETAVGPLNLRGASCFVRDG-SEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            R +   ++ + T+  P+ LR  +C+V +  S  E  +GR  M+ +G   D+L + P  G 
Sbjct  46   RMATFSEIVLTTSADPIMLRNLACYVEEANSRTELTVGRPIMKILGYSTDKLLD-PGPGA  104

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDV  122
               D    +       L+   ++ ++ R L+  ++ A   G       +LR ++    D 
Sbjct  105  EEEDIERHETRTALPCLQ-PTNLAEVTRYLEAKVEIATRMGLTLDDCTKLRGILQMRADS  163

Query  123  WRIHVGADPPADVEPL  138
            +R+  G DPP  V P+
Sbjct  164  FRLEFGHDPPVRVAPM  179

>PYAR_15076
Length=475

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 42/81 (52%), Gaps = 14/81 (17%)

Query  6    SVTLDLRIETAVGPLNLRG-ASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ-------  57
            +V L + +ETA GP+ L+    C + D +EDE ++GR  + ++GID DR  E        
Sbjct  376  AVYLKITMETAAGPVRLQELKKCVILDSNEDELIVGRGLLNELGIDVDRQLEMLATQAVE  435

Query  58   ------PVDGGRVSDAAGDDV  72
                  P D  +V + A DDV
Sbjct  436  DIDPLDPEDEMKVGEPATDDV  456

>PHYCA_100340
Length=229

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 68/138 (49%), Gaps = 11/138 (8%)

Query  6    SVTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRV  64
            +V + L + TA GP+  +    C + +  EDE L+G+  + ++GID ++  E     G  
Sbjct  59   AVDIRLTLNTAAGPVRCQEPKRCLIVESDEDEMLVGKTLLSELGIDIEQQLEYLASRGAD  118

Query  65   SDAAGDDVTNYDADLRFEIDMDDIHRN-LDRMLQEAKDEGFEPTLLDELRTLVYE---HD  120
             D + D+          +  + D+  N +D ++Q+A D G   T+ D + +  Y+     
Sbjct  119  DDDSFDEPDGMPP---CKSSVGDVVTNVVDALVQDAIDRG---TIDDYITSRPYDVVRKY  172

Query  121  DVWRIHVGADPPADVEPL  138
              WR+ +G DPPA V PL
Sbjct  173  GGWRLELGDDPPARVPPL  190

>PHYSO_434001
Length=109

 Score = 42.7 bits (99),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)

Query  99   AKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            A + GF+   L  LR  V E++D++RI +GADPPAD+ PL
Sbjct  13   AGNNGFDQGYLSFLRDSVLEYEDIFRIDLGADPPADIAPL  52

>PHYCA_119324
Length=461

 Score = 44.7 bits (104),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            +LC   V LD++I TA GPL L    C V +  E+E LLG+ T+Q IG+D D +F Q
Sbjct  385  ILCHEKVQLDVQIVTAAGPLCLNSLECLVLEAPEEELLLGKPTLQSIGVDLDGVFAQ  441

>PYAP_23024
Length=252

 Score = 43.9 bits (102),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 1/44 (2%)

Query  95   MLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            M+  A  EGF    +D LRT+VY  D +WR+ +G DPPA V P+
Sbjct  1    MISAAVKEGFAIGKVDRLRTIVYMFD-IWRLALGDDPPAKVPPM  43

>PHYRA_86147
Length=956

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 65/179 (36%), Gaps = 48/179 (27%)

Query  4    RASVTLDLRIETAVGPLNLRGASCFVR-DGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            R +   ++ + T+ GPL LR  +CFV  D S  E  +GR  M+ +G   D+L  +  D  
Sbjct  484  RMATFSEIVLTTSAGPLLLRNLACFVEEDNSRMELTVGRPIMKILGYSTDKLLVEARDAQ  543

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEG-------------------  103
               +  GD     D D      +  I+    R+   A+D G                   
Sbjct  544  AEWELGGDTSPKVDKDQSSPTSLQRIY----RLAVAAQDPGPDAEEEDIYRHETRTALPC  599

Query  104  FEPTLLDE------------------------LRTLVYEHDDVWRIHVGADPPADVEPL  138
             +PT L E                        LR ++    D +R+  G DPP  V P+
Sbjct  600  MQPTNLAEVTHYLESKVEIATRMGLTLDGSAKLRGILQMRADSFRLEFGHDPPVRVAPM  658

>PHYRA_85934
Length=1402

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 64/164 (39%), Gaps = 37/164 (23%)

Query  10   DLRIETAVGPLNLRGASCFVRDGSEDEFL---LGRKTMQDIGIDNDRLF-----EQP---  58
            ++   T+ GPL LR   C V +  ED  L   +GR  M  +G   D L       QP   
Sbjct  503  EVEFATSAGPLLLRNLDCLVHE--EDRSLALTVGRPVMNRLGYSTDDLLAAARTRQPEYC  560

Query  59   ------------------VDGGRVS-----DAAGDDVTNYDADLRFEIDMD-DIHRNLDR  94
                              V   R       D  GDD+    A  R   +    +   L+ 
Sbjct  561  LTEPAEEDSDKNNSPLVRVQAMRTRLLDELDVDGDDLDELVASPRLVAETTRAVQEALEL  620

Query  95   MLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             +QEA+  G      D+L+ L++ H DV+R+  G DPP  V PL
Sbjct  621  KIQEARANGLTSKEGDDLQELLFRHIDVFRLSFGDDPPVRVPPL  664

>PHYCA_78763
Length=272

 Score = 43.9 bits (102),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 56/122 (46%), Gaps = 16/122 (13%)

Query  5    ASVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGR  63
            A   L + I TA GP+  +    C + D  +DEF++GR  +  +GID DR  EQ      
Sbjct  157  AKAMLHVLINTAAGPVEPMEPVECLIVDSIDDEFIVGRDLLLSLGIDVDRQLEQ------  210

Query  64   VSDAAGDDVTNYDADLRF---EIDMDD------IHRNLDRMLQEAKDEGFEPTLLDELRT  114
            ++   G D      DL      +D D       +   ++ +++ A + GF    ++ELR 
Sbjct  211  LASRGGGDTDGDPFDLEVGEPPVDTDQPVLDALVRSAVENLIENAVECGFPADRVEELRL  270

Query  115  LV  116
            LV
Sbjct  271  LV  272

>H257_09910
Length=856

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 60/162 (37%), Gaps = 38/162 (23%)

Query  11   LRIETAVGPLNLRGASCFVRDG-SEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAG  69
            L   T  GPL  RG   ++ +  +  E  LG   MQ +G     L E      R   A  
Sbjct  183  LEFNTGCGPLMFRGLRVWIDEAEAAVELTLGLPVMQKVGYSEQTLLEN----ARRQQAVW  238

Query  70   D-----DVTNYDA---DLRFE-------------------------IDMDDIHRNLDRML  96
            D     D T   A    LR E                          D + +H  L   +
Sbjct  239  DFDDQPDTTPGIAMHRTLRMEELSDGIDDDEGMCCATPELGMIPSLADAETVHTVLMAKV  298

Query  97   QEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             EA  +G E   ++ L+ L+ E  DV+R+  G DPP  V+PL
Sbjct  299  AEAAADGMEEPAVETLQDLLLEFRDVFRLRFGRDPPVRVKPL  340

>H257_07762
Length=1252

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/156 (24%), Positives = 55/156 (35%), Gaps = 33/156 (21%)

Query  10   DLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAG  69
             L  +T  GPL LRG    +         LG   MQ +G +   L E       V D   
Sbjct  334  SLEFKTTCGPLMLRGLRHLL------SLALGLPVMQKLGYNEQTLLENARRQQAVWDFGD  387

Query  70   DDVTNYDADLRFEIDMDDIHRNLD---------------------------RMLQEAKDE  102
              +T     +   + M ++   +D                             + EA   
Sbjct  388  QPITTPGVAMHRTLRMGELSEGIDDDEGMAYSTPELGDAPDDDGLVRTVLNAKVAEAATA  447

Query  103  GFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            G     +++LR L+ E  DV+R+  G +PP  VEPL
Sbjct  448  GMPAEAVEQLRDLLMEFRDVFRLKFGRNPPVKVEPL  483

>PHYSO_457550
Length=57

 Score = 40.4 bits (93),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 0/45 (0%)

Query  6   SVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGID  50
           SV LDL ++T  GP++L   +C + +G E++F+LG      +GID
Sbjct  2   SVKLDLMLQTIAGPVHLTEVTCLMFEGDEEDFILGNGMTVYLGID  46

>PHYRA_83670
Length=908

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 28/48 (58%), Gaps = 0/48 (0%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGID  50
            C   V LDL   T  GP+++R  +C V  G  DEFLLG   ++ +GID
Sbjct  313  CDNEVLLDLEPFTIAGPVSMRAVTCVVLAGEGDEFLLGCDALKTLGID  360

>H257_02096
Length=330

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 70/159 (44%), Gaps = 23/159 (14%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            ++ + +V L + + TA G + L G   F      DE ++ +  +  IG+D DRL EQ   
Sbjct  152  VIAKTTVELRVTLSTAAGQVKLPGKQLFYVVDDNDELIISKYALMSIGLDMDRLLEQV--  209

Query  61   GGRVSDAAGDDV--TNYDADLRFEIDMDDIHRN---LDRMLQEAKDEGFEPTLLDE----  111
              R +   GDD+       D+ F + +  +H N   LD    +A ++ ++  ++      
Sbjct  210  AMRQTHEDGDDIGDPGEAEDIAFGVSVQGLHANDEQLDVEDMQAAEQLYKMAIISANAAE  269

Query  112  ---------LRTLVYE--HDDVWRIHV-GADPPADVEPL  138
                     LR +V +     VWR    G D PA+V+ +
Sbjct  270  QEQTVAFKLLRGIVVDTAAKGVWRTKFRGTDLPANVKAM  308

>PHYCA_106652
Length=156

 Score = 42.4 bits (98),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 0/56 (0%)

Query  2   LCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           LC   V LDL +    G + LR   C V  G  DEFL+G + ++ +GID ++   Q
Sbjct  25  LCDEEVLLDLGLTPVAGLVVLRSVPCLVLAGDGDEFLVGHEVLKGLGIDVEQQLSQ  80

>H310_01656
Length=263

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 63/155 (41%), Gaps = 27/155 (17%)

Query  11   LRIETAVGPLNLRGASCFVRDGSED-EFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAG  69
            ++ +TA GPL LRG   +V +     E  LG   M+ +G  +  L         V D + 
Sbjct  48   VQFQTAYGPLLLRGLRAWVDETVPAIELTLGLPVMKILGYTDQGLRNNARQKNAVWDISE  107

Query  70   DDV----TNYDADLRF-----EIDMDD-----------------IHRNLDRMLQEAKDEG  103
            +      T     LRF     +ID D+                 I   L   +  A  EG
Sbjct  108  ESTVVPSTAMHRTLRFGQVDDDIDEDEGMCCATPDLSGSPDTAQIKALLASKVDAAITEG  167

Query  104  FEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
              P  + EL+ ++ E +DV+R+  G DPP  VE L
Sbjct  168  MAPENVSELQAMLLEFEDVFRVSFGRDPPVRVESL  202

>PHYCA_103334
Length=49

 Score = 40.0 bits (92),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 0/38 (0%)

Query  13  IETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGID  50
           + T  G + LR   C V  G  DEFLLGRK ++ +GID
Sbjct  1   LTTVAGLVALRSVPCLVLAGDGDEFLLGRKVLKGLGID  38

>H310_01813
Length=824

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 44/97 (45%), Gaps = 12/97 (12%)

Query  48   GIDNDRLFEQPVDGGRVSDAAGDDVTNYD---ADLRFEIDMD---DIHRNLDRMLQEAKD  101
            G D  R F+      R+ +  GDD    D   + L  E   D    I R LD  + EA +
Sbjct  111  GEDKPRTFQ------RLQEMYGDDAEELDVACSTLSMEKTADPYGQIRRILDEKIAEAME  164

Query  102  EGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             G       ELR ++  H DV+R+  G D P DVEPL
Sbjct  165  RGLTDAQAMELRRILTHHIDVFRLEFGRDLPVDVEPL  201

>H257_01623
Length=1370

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  7     VTLDLRIETAVGPLNLRGAS-CFV-RDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
             V L L ++TA GP+ + G   C+V  DG  DEFL+   T++ IGID DRL EQ
Sbjct  971   VDLTLTMKTAAGPVKVPGKRRCYVVNDG--DEFLVSDDTLKTIGIDIDRLLEQ  1021

>PYAR_25195
Length=425

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 0/45 (0%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDI  47
            C  +V LDL++ TA GP+NLR  +C V   +  E LLG +T++ +
Sbjct  381  CEGTVLLDLQVITAAGPVNLRQVTCVVLPTTRAEVLLGDETLRAL  425

>PHYRA_85675
Length=720

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 65/173 (38%), Gaps = 41/173 (24%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRD----GSEDEFLLGRKTMQDIGIDNDRLFEQP----  58
            V L+L + T  G L L    C++        + + LL R  M+ +G D   +  +     
Sbjct  284  VKLNLAVNTPAGKLLLTNVVCWISPEELPAGKGDVLLSRPLMRKLGYDPVEILAKARALN  343

Query  59   -----------VDGG----RVSDAAGDDVTNYDADLRF------------------EIDM  85
                       V+GG        A  D +T    +  F                  E + 
Sbjct  344  SVMDMEDVTAGVEGGLRHVMAVAARSDRLTTAPEEASFYPDEDQACFPTIARDRDLEAEQ  403

Query  86   DDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             ++   L + +QEA+  G     L  L  L++E  D +R+ +G DPP D+ PL
Sbjct  404  KEVWDALLKKIQEAEANGASVKYLKRLEKLLWEKVDTFRLKLGNDPPVDMPPL  456

>PHYSO_419503
Length=78

 Score = 40.4 bits (93),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query  9   LDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           L + I TA GP+  +   SC + D  ++EF++G   + ++GID DR  EQ
Sbjct  8   LHVLIHTAAGPVEPMEAVSCLIVDSDDEEFIIGSDLLGELGIDVDRQLEQ  57

>PITG_04073
Length=178

 Score = 42.0 bits (97),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 49/104 (47%), Gaps = 9/104 (9%)

Query  4    RASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGR  63
            + S+ LDL +    G   +R  +C + +  EDEFLLGR T++ +GI  + L         
Sbjct  52   KKSIQLDLELIIPAGRARMRHMTCIITETEEDEFLLGRLTLEALGIYVEGLL------AV  105

Query  64   VSDAAGDDVTNYDADLRFEIDMDDIHR---NLDRMLQEAKDEGF  104
            +++   DD   ++++     +  D  R    L  ++ EA   GF
Sbjct  106  LANKEIDDFEPFESETPVSFNPPDKGRIMGQLCELINEAVTNGF  149

>H257_04448
Length=363

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 9/100 (9%)

Query  6    SVTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRV  64
            +  L +R+ TA GP+NL G   C+V   S D  L+ R  +Q IGI+ + L E        
Sbjct  251  AANLRIRLSTAAGPVNLPGVQICYVISRS-DSLLVSRYALQSIGINMNHLLEHVAHHQSH  309

Query  65   SDAAGDDV--TNYDADLRFEIDMDDIH---RNLDRMLQEA  99
             D  GDDV   + D D+ F +    +    +NLD++ ++A
Sbjct  310  ED--GDDVGEPDEDEDIAFGVPTRRLQGGEQNLDKLDEDA  347

>H310_01160
Length=177

 Score = 41.6 bits (96),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  84   DMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEP  137
            D+  +   L   + +A  EG     ++ LR LV+E +DV+R+  G DPP  VEP
Sbjct  118  DVAAVRAVLTAKVDDAAAEGLSAASVNTLRHLVFEFEDVFRLRFGKDPPEKVEP  171

>PHYCA_122030
Length=308

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)

Query  92   LDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            L +++ EA + GF+    D+LR +V ++ DV+R+ +G D PADVEPL
Sbjct  16   LQQLVDEAVEAGFDVDHADQLRRIVVDYADVFRLRLGRDEPADVEPL  62

>H310_15218
Length=706

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 39/140 (28%), Positives = 58/140 (41%), Gaps = 12/140 (9%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGS----EDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            V L L+ ET VGPL L    C++  G       + LL R  M  +G D   +        
Sbjct  464  VKLTLKFETDVGPLVLANVKCWLSSGDLPSGVGDILLSRPIMYKLGYDPQSMLRDAASEE  523

Query  63   RVSD----AAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYE  118
             +      A   D+T  D       +  ++   LD M+  A   G        L  L+ +
Sbjct  524  ALVPMELAACFPDMTPVDP----AGEQANVQVVLDAMVAGAMVAGCGTEYALGLSKLLAK  579

Query  119  HDDVWRIHVGADPPADVEPL  138
            + DV+R+ +G DPP D+ PL
Sbjct  580  YVDVFRLTLGHDPPVDMPPL  599

>H257_12330
Length=735

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 36/71 (51%), Gaps = 1/71 (1%)

Query  69   GDDVTNYDADLRFEIDMD-DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHV  127
             +DV      +   +D D +I   LD M+ EA   G  P    EL+ ++ +  DV+R+  
Sbjct  31   AEDVACSTPTMEKPVDQDGEIKHILDGMIAEATHLGLSPAQEGELQRILGDLGDVFRLEF  90

Query  128  GADPPADVEPL  138
            G D P DVEPL
Sbjct  91   GQDLPVDVEPL  101

>H257_14645
Length=753

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  7    VTLDLRIETAVGPLNLRGAS-CFV-RDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            V L L ++TA GP+ + G   C+V  DG  DEFL+   T++ IGID DRL EQ
Sbjct  654  VDLTLTMQTAAGPVKVPGKRRCYVVNDG--DEFLVSDDTLKTIGIDIDRLLEQ  704

>PHYCA_125288
Length=147

 Score = 41.2 bits (95),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 65/138 (47%), Gaps = 9/138 (7%)

Query  6    SVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDR---LFEQPVDG  61
            +V L++++ T  G +++     C +  G   EFLLG   +  +GID +R   L   P+  
Sbjct  12   TVNLNVKLRTIAGNVHVAEPVECLIIPGDSGEFLLGNDLLLKLGIDVERQLDLSAAPLAA  71

Query  62   GRVSDAAGD-DVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120
                D   D D       + ++   +D+   + ++++ A  +GF      EL  +    D
Sbjct  72   DGNEDEFDDADEPTIGKSVHYD---EDVRAGILKLVETAIADGFPREFQHELTRIALRFD  128

Query  121  DVWRIHVGADPPADVEPL  138
             VWR  +GADPPA V P+
Sbjct  129  -VWRTQLGADPPAKVPPM  145

>PHYCA_123947
Length=96

 Score = 40.0 bits (92),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query  9   LDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           L + I TA GP+  +    C + D  +DEF++GR  +  +GID DR  EQ
Sbjct  2   LHVLINTAAGPVEPMEPVECLIVDSIDDEFIVGRDLLLSLGIDVDRQLEQ  51

>H310_14304
Length=238

 Score = 41.6 bits (96),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 59/142 (42%), Gaps = 30/142 (21%)

Query  11   LRIETAVGPLNLRGASCFVRDGS-EDEFLLGRKTMQDIGIDNDRLF--------------  55
            L +ET++GPL LRG   +V + S +   L+GR  M  +G+  D +               
Sbjct  82   LTLETSIGPLALRGLKVWVDEQSPQINLLIGRPVMDRLGLSVDGMLVDALKKRQTWEVGD  141

Query  56   -----EQPVDGGRVSDAAGDDVTNYD-------ADLRFEIDMD---DIHRNLDRMLQEAK  100
                 ++P    R+ +  GDD    D       + L  E   D    I R LD  + EA 
Sbjct  142  LGDGEDKPRTVQRLRETYGDDAEELDSVEGVACSTLSMEKTTDPDGQIRRILDEKVAEAM  201

Query  101  DEGFEPTLLDELRTLVYEHDDV  122
            + G       ELR ++ +H DV
Sbjct  202  ERGLMDVQAVELRRILTQHIDV  223

>PHYRA_85588
Length=1677

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query  4    RASVTLDLRIETAVGPLNLRGASCFVR-DGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            R +   ++ + T+ GPL LR  +CFV  D S  E  +GR  M+ +G   D+L  +  D  
Sbjct  484  RMATFSEIVLTTSAGPLLLRNLACFVEEDNSRMELTVGRPIMKILGYSTDKLLVEARDAQ  543

Query  63   RVSDAAGDDVTNYDADLRFEIDMDDIHR  90
               +  GD     D D      +  I R
Sbjct  544  AEWELGGDTSPKVDKDQSSPTSLQRICR  571

>H257_04889
Length=890

 Score = 41.6 bits (96),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 36/71 (51%), Gaps = 6/71 (8%)

Query  5    ASVTLDLRI--ETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDG  61
            A V  +LRI   TA GP NL G   C+V   S D  L+ R  +Q IGID + L EQ    
Sbjct  758  ADVAANLRICLSTAAGPANLPGVQLCYVLSRS-DSLLVSRYALQSIGIDLNHLLEQVAQH  816

Query  62   GRVSDAAGDDV  72
                D  GDDV
Sbjct  817  QSHED--GDDV  825

>H257_18790
Length=341

 Score = 41.6 bits (96),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPV  59
            M    +  L +R+ TA GP+NL G   C+V   S D F + R  +Q  GI+ + L EQ  
Sbjct  125  MYTDVAANLRIRLSTAAGPVNLPGVQLCYVISRS-DSFPVSRYALQSTGININHLLEQVA  183

Query  60   DGGRVSDAAGDDVTNYDAD  78
                  D  GDDV   D D
Sbjct  184  QDQSHED--GDDVGEPDED  200

>H310_10595
Length=99

 Score = 39.7 bits (91),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  99   AKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            A  +G + T +DELR L+ E  DV+R+  G DPP  V PL
Sbjct  7    AVAQGMDETAVDELRNLLVEFQDVFRLKFGRDPPVKVAPL  46

>H310_13336
Length=615

 Score = 41.2 bits (95),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 68/166 (41%), Gaps = 33/166 (20%)

Query  2    LCRASVTLDLRIETAVGPLNLRGASCFVRD-GSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + R +    + +ET  GPL LRG   ++ D  S  +  + R  M+ +G   D L      
Sbjct  260  MSRRATFGKVTLETTCGPLVLRGLKAWIDDTASTIDLNISRPVMEVLGFSVDDLLV----  315

Query  61   GGR-------VSDAAGDD-------------VTNYDADLRFEIDMDDIHR-NLDRML---  96
            G R       VSD   D               T    D +F  D D++ R   DR+L   
Sbjct  316  GARRQKSEWDVSDGVEDPPDPCIDDNDGMQCATAEVVDPKFTGDSDEVRREKRDRVLAVL  375

Query  97   ----QEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
                 EA+  G +   +  L  L+ +H DV+R  +G DP   VEPL
Sbjct  376  IARVNEAQRRGLDADDMQRLTALLMKHVDVFREDLGNDPTVKVEPL  421

>H257_09473
Length=854

 Score = 41.2 bits (95),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 36/71 (51%), Gaps = 1/71 (1%)

Query  69   GDDVTNYDADLRFEIDMD-DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHV  127
             +DVT     +    D D +I R L+  + EA   G  P    ELR ++ +H DV+R+  
Sbjct  54   AEDVTCSTPAMEKPADQDCEIKRILNGKIAEAIQLGLSPAHESELRRILGDHTDVFRLEF  113

Query  128  GADPPADVEPL  138
            G   P DVEPL
Sbjct  114  GQALPVDVEPL  124

>SPRG_08815
Length=290

 Score = 40.8 bits (94),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 64/133 (48%), Gaps = 19/133 (14%)

Query  9    LDLRIETAVGPLNLRG-ASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ-PVDGGRVSD  66
            L L++ TA GP+N+ G  +C+V D   DE L+    +  +GID +RL EQ  +   RV D
Sbjct  16   LRLQLLTAAGPVNVPGLQACYV-DDEGDEILVSNDVLVMLGIDLERLLEQVALKAIRVDD  74

Query  67   AAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWR-I  125
            A   D           +D +D      R + E+    F     + L  +V + +++W  +
Sbjct  75   ALDTD----------RLDREDAASMPARSILES----FSAERYERLEKIV-KSNEIWHTV  119

Query  126  HVGADPPADVEPL  138
                D PADVEP+
Sbjct  120  FRDTDLPADVEPM  132

>PHYCA_17466
Length=385

 Score = 40.8 bits (94),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query  9    LDLRIETAVGPLNLRGA-SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            L + I TA GP+ L  A  C + D  +D+F++GR  +  +GID DR  EQ
Sbjct  294  LHVMIHTAAGPVQLAEAMPCLIVDTEDDDFIVGRDALGALGIDVDRQIEQ  343

>PHYCA_51481
Length=51

 Score = 37.7 bits (86),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (64%), Gaps = 1/47 (2%)

Query  92   LDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            ++R++  A   GF    +++LRT  + +D +WR+ +  DPPA+V PL
Sbjct  3    VERLIDRALANGFPAEYVEQLRTTAHAYD-IWRLELRDDPPANVPPL  48

>H257_09053
Length=606

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  6    SVTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            +  L +R+ TA GP+NL G   C+V   S D  L  R  +Q IGI  + L EQ
Sbjct  150  AANLRIRLSTAAGPVNLPGVQLCYVISRS-DSLLASRHALQSIGIGMNHLLEQ  201

>PYAP_25332
Length=175

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query  95   MLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            M+     EGF    +D LRT+VY  D VW + +G DPPA V P+
Sbjct  1    MISAVVKEGFPVDKVDRLRTIVYMFD-VWWLALGDDPPAKVPPM  43

>CCA17015
Length=865

 Score = 40.0 bits (92),  Expect = 0.002, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 0/57 (0%)

Query  82   EIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            EI MD +   L   L+E K  G   + +D L  ++ ++++V+R+   ADPP  V  L
Sbjct  111  EIQMDTVRTILKSRLEEVKAAGASKSSVDRLELVLAKYENVFRVEFAADPPVKVPAL  167

>PPTG_21201
Length=82

 Score = 37.7 bits (86),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 36/68 (53%), Gaps = 2/68 (3%)

Query  72   VTNYDADLRFEIDMD-DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGAD  130
            + N++ D  F ++ D ++   +D ++ +A D GF       L  +    D +WR+ +G D
Sbjct  4    LKNFNDDFEFGVESDSEVRVAVDVLVDKAIDNGFPRERRGNLLKIAVMCD-IWRLKLGGD  62

Query  131  PPADVEPL  138
            PPA V PL
Sbjct  63   PPAKVPPL  70

>PHYCA_113379
Length=145

 Score = 38.9 bits (89),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (57%), Gaps = 1/58 (2%)

Query  1    MLCRASVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            +L   SV L + + TA GP+  ++     V D  E+EF++G   + D+GI+ DR  EQ
Sbjct  48   ILASRSVLLRIMLHTAAGPVRPVKPYEVLVIDEDEEEFIMGEDILTDLGINIDRQLEQ  105

>H310_13741
Length=125

 Score = 38.5 bits (88),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)

Query  99   AKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVE  136
            A++E F    L++LR L+ E+ DV+R+ +G DPP  VE
Sbjct  53   AEEECFSAVSLEQLRRLLKENTDVFRVEMGCDPPVKVE  90

>PYVX_24439
Length=225

 Score = 39.3 bits (90),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (61%), Gaps = 1/51 (2%)

Query  7    VTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFE  56
            V L L + TA G +++     C + +G EDEF+LG+  ++ +GID DR  E
Sbjct  150  VDLKLSLHTAAGQVDVSEPVECLIAEGDEDEFILGQDVLRSLGIDIDRQLE  200

>H310_14634
Length=420

 Score = 39.7 bits (91),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 59/134 (44%), Gaps = 32/134 (24%)

Query  36   EFLLGRKTMQDIGIDNDRLFEQPVDGGRV---SDAAGDDVTNYDADLRFE------IDMD  86
            EFL+   +++ IGID +RL EQ  +  R+    D  G D   +D D+  +       D++
Sbjct  5    EFLVSDDSLKSIGIDVERLLEQVAERQRLDEGDDLEGKDAPEFDLDIMLDDVVDSYNDIN  64

Query  87   DIHRN---------------------LDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRI  125
             + R+                     +  ML +A + GF     D L  +V +  D+WR 
Sbjct  65   QVERSWVEDGEPEKVRSIVNTTDYDGVKDMLSKAYEAGFPEDRADALGAIVRKA-DIWRT  123

Query  126  HVGA-DPPADVEPL  138
               A DPPA+V P+
Sbjct  124  KFRASDPPANVPPM  137

>PHYCA_126315
Length=63

 Score = 37.0 bits (84),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query  9   LDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           L +RI TAVGP+  +      + D  +DEF++G   +  +GID DR  EQ
Sbjct  2   LQVRIHTAVGPVEPMNRVDVLIVDCDDDEFIVGNDLLTLLGIDVDRQLEQ  51

>PHYCA_125691
Length=338

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 31/52 (60%), Gaps = 1/52 (2%)

Query  6    SVTLDLRIETAVGPLNLRG-ASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFE  56
            +V + + ++TA GP+++     C +  G  +EFLLG + +  +GID DR  E
Sbjct  275  AVNIHVTLQTAAGPVSINSPVQCLIVPGELEEFLLGTEILASLGIDVDRELE  326

>H310_10924
Length=612

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 65/178 (37%), Gaps = 54/178 (30%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGSED-EFLLGRKTMQDIGIDNDRLFEQPVDGGRVS  65
            VTLD    T  GPL LRG   ++ + S   +F++ R  M+ +G   D L     +G R  
Sbjct  419  VTLD----TTCGPLTLRGLQAWIDETSTAMDFIVSRPVMEVLGFSIDDLL----NGARRQ  470

Query  66   DAAGDDVTNYDA---------------------------------------------DLR  80
             A  D     D                                              D R
Sbjct  471  QAEWDVSPGSDGPVTSMSRVQHLLAEERYSPEPELADTDGMACASPEVEIPPPSDQEDER  530

Query  81   FEIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
              +  D +   L   + EA+  G  P+ L+ ++ L+ +H DV+R  +G D P  VEPL
Sbjct  531  HRMKRDKVFGILMAKVAEAETRGLAPSDLERVKILLSKHVDVFREDLGDDAPVKVEPL  588

>PYIW_23043
Length=108

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  6    SVTLDLRIETAVGPLNLR-GASCFVRDGSEDEFLLGRKTMQDIGIDNDR  53
            +V L + + TA  PL  +    C V    EDEF++GR  + ++GID DR
Sbjct  58   AVNLFVTLHTAAAPLRCQDSKQCLVVSSDEDEFIVGRPLLIELGIDIDR  106

>PHYCA_53504
Length=68

 Score = 37.0 bits (84),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query  7   VTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVS  65
           V L +R+ TA GP+ L    +  + +  +DEF++G   +  +GI+ DR  EQ + GG++ 
Sbjct  1   VLLAIRLHTAAGPVELAEPVNRLIIEQIDDEFIVGNDVLLSLGINVDRQLEQ-LAGGKLK  59

Query  66  D  66
           D
Sbjct  60  D  60

>PHYCA_105497
Length=194

 Score = 38.5 bits (88),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  9    LDLRIETAVGPLNLR-GASCFVRDGSEDEFLLGRKTMQDIGIDND  52
            L LR+ TA GP+ L+    C + +  E EF+LGR  ++ +GID D
Sbjct  150  LRLRLNTAAGPVGLQEPVDCLIIECDEPEFILGRDVLKSLGIDID  194

>PHYSO_378048
Length=51

 Score = 36.2 bits (82),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 31/47 (66%), Gaps = 1/47 (2%)

Query  92   LDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            ++R++  A + GF    +++L  + + +D VWR+ + ADPPA+V PL
Sbjct  3    VERLIDRAVENGFPLEHVEQLCKIAHAYD-VWRLELRADPPANVPPL  48

>PHYCA_48152
Length=217

 Score = 38.5 bits (88),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (49%), Gaps = 6/103 (6%)

Query  4    RASVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
            R  + + + I TA GP+   +   C V +  E+EF+LG+  ++ +GID ++  EQ     
Sbjct  119  RNVIEVRILIHTAAGPVTPTQRFRCLVIEDEEEEFILGQDILRTLGIDVNQQLEQLAR--  176

Query  63   RVSDAAGDDVTNYDADLRF-EIDMDDIHRNLDRMLQEAKDEGF  104
              S    DD    D D R  +   +++   ++ ++Q A   GF
Sbjct  177  --STQENDDPVEMDDDARTRKFTSEEVKEAVEELIQRALKNGF  217

>H310_07193
Length=507

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (56%), Gaps = 0/52 (0%)

Query  87   DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            +I R LD  + EA D G      DELR ++  H  V+R+  G + P DVEPL
Sbjct  10   EIKRILDGKVLEAVDRGLSAAQEDELRRILKRHVGVFRLDFGRELPVDVEPL  61

>PHYCA_123588
Length=206

 Score = 38.1 bits (87),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 54/105 (51%), Gaps = 7/105 (7%)

Query  6    SVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRV  64
               L L I  A G +  ++     +    +DEF+LG   +  +GID +R  EQ + G  V
Sbjct  84   KAKLHLMIRIAAGQVKPMKAVDVLIVGVDDDEFILGNDLLMMLGIDVERQLEQ-LAGRNV  142

Query  65   SDAAGDDVTNY--DADLRFE---IDMDDIHRNLDRMLQEAKDEGF  104
             + +GD V     ++ +R E    ++D++   ++R++++A D GF
Sbjct  143  DETSGDPVEREADESPVRLEEHQPEIDNVFAAVERLVEQAVDNGF  187

>CCA27531
Length=406

 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 0/51 (0%)

Query  88   IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            IH  L+  L++AK  G E   ++ LR    + +DV+R+   ADP   VEPL
Sbjct  98   IHGVLENKLKDAKKRGAEDESIERLRKFFLKDEDVFRVEFAADPLVKVEPL  148

>PHYSO_374997
Length=108

 Score = 37.4 bits (85),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (51%), Gaps = 0/51 (0%)

Query  88   IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            +H  LD  L  A+ +G     +  LR ++    D +R+  G+DPP  V PL
Sbjct  3    VHDMLDSKLAAARAKGLSAKGVKRLREILLRRQDSFRLEFGSDPPVKVAPL  53

>PHYCA_102337
Length=94

 Score = 37.0 bits (84),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (2%)

Query  2   LCRASVTLDLRIETAVGPLNLRGA-SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           + +A   L + I TA G + L  A  C + D  +D+F++GR  +  + ID DR  EQ
Sbjct  1   MAKAKALLHVMIHTAAGLVQLAEAMPCLIIDTEDDDFIVGRDVLGALRIDVDRQLEQ  57

>PHYCA_96370
Length=479

 Score = 38.1 bits (87),  Expect = 0.007, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 31/52 (60%), Gaps = 1/52 (2%)

Query  6    SVTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFE  56
            +V   L + TA GP+  + A  C + +  EDEF++G+  + ++GID DR  E
Sbjct  425  TVEARLTLNTAAGPVRCQDAKKCLIVETDEDEFIVGKLLLAELGIDVDRQLE  476

>H310_12834
Length=686

 Score = 38.1 bits (87),  Expect = 0.009, Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 27/51 (53%), Gaps = 0/51 (0%)

Query  88   IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            + R L   + EA+  G     L  LR +++ + DV+RI  G DPP  V PL
Sbjct  212  VRRLLHERVLEAEANGLAGDHLSRLRAMLHRYVDVFRIEFGRDPPFKVPPL  262

>PHYCA_96003
Length=445

 Score = 37.7 bits (86),  Expect = 0.010, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query  9    LDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            + +RI TAVGP+  +      V D ++DEF++G   +  +GID DR  EQ
Sbjct  390  MRVRIHTAVGPVEPMELVDVLVMDVNDDEFIVGNDLLTALGIDVDRQLEQ  439

>CCA26840
Length=113

 Score = 36.6 bits (83),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (55%), Gaps = 0/55 (0%)

Query  84   DMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            D   +++ L   L +A+  G    +L +++ L+    D +R+ +G +PP DV PL
Sbjct  19   DSSRVNKVLMEKLNKARKNGCPEEMLGQMKDLLLAKQDCFRLELGQEPPVDVSPL  73

>PYAR_22224
Length=699

 Score = 38.1 bits (87),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 31/55 (56%), Gaps = 1/55 (2%)

Query  2    LCRASVTLDLRIETAVGPLNLRGASCFVRDGSED-EFLLGRKTMQDIGIDNDRLF  55
            + RA+   ++ + T+ GPL LR  SC+V +G+   E  +GR  M+ +G   D L 
Sbjct  475  VSRAATFREVVLTTSAGPLMLRNLSCYVEEGNLGMEVTVGRPIMKILGYSTDELL  529

>H310_14627
Length=635

 Score = 37.7 bits (86),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 60/156 (38%), Gaps = 30/156 (19%)

Query  10   DLRIETAVGPLNLRGASCFVRDGSED-EFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAA  68
             L  +TA   L L G S +  +   + E  LG   M+ +G D   L E       V D A
Sbjct  380  SLEFKTASRSLLLCGLSVWADESDPNVELTLGLPVMKTLGYDEQTLLETARKQQAVWDFA  439

Query  69   GDDVTN---------YDADLRFEIDMDD--------------------IHRNLDRMLQEA  99
               VT          +  +L  E D D+                    +H  L   + +A
Sbjct  440  DQPVTTPGVAMHRALHLVELSDEFDDDEGMCCATPEVEESPGSDDGEHVHAVLMSKVDDA  499

Query  100  KDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADV  135
              +G + T +D LR L+ E  DV+R+  G DPP  V
Sbjct  500  VAQGMDETAVDALRNLLVEFQDVFRLKFGRDPPLKV  535

>H310_09756
Length=1268

 Score = 37.7 bits (86),  Expect = 0.012, Method: Composition-based stats.
 Identities = 41/171 (24%), Positives = 65/171 (38%), Gaps = 39/171 (23%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGS----EDEFLLGRKTMQDIGIDNDRLFEQPV---  59
            V +DL+ ET  GPL L    C++  GS     D+ LL R  +     D   +  +     
Sbjct  213  VKIDLKFETDAGPLMLTNVKCWLSVGSLPAGVDDLLLSRAIVCKRDYDPHSMLREAAAVC  272

Query  60   ---DGGRVSDAAG--------------DDVTNYDADLR-FEI--------------DMDD  87
               D   V   +G              DD+ + +  L   E+              +   
Sbjct  273  SEYDMSDVESPSGVVKAVLLATQQEFIDDLADEEEPLMPMELAVCFSGMALVDPAAEHAK  332

Query  88   IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            +   LD  + EA + G        L  L+ ++ DV+R+ +G DPP D+ PL
Sbjct  333  VQLILDAKVVEASEAGCGAEFASGLAELLTKYVDVFRLTLGRDPPVDMPPL  383

>PYIW_28151
Length=74

 Score = 35.4 bits (80),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (2%)

Query  4   RASVTLDLRIETAVGPLNLR-GASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFE  56
           R +V L + + TA GP+  +   +C V +  EDEF++G   + ++ ID +R  E
Sbjct  13  RTAVELYITLHTAAGPVRCQDKKTCLVVEDGEDEFIVGNGLLTELDIDVERQLE  66

>SPRG_20927
Length=502

 Score = 37.4 bits (85),  Expect = 0.014, Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 31/52 (60%), Gaps = 2/52 (4%)

Query  7    VTLDLRIETAVGPLNLRG-ASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            V L L++ TA  P+N+ G  +C+V D   DEFL+    +  +GID  RL EQ
Sbjct  396  VQLRLQLHTAASPVNVPGLQACYVAD-EGDEFLVSNDVLVMLGIDLKRLLEQ  446

>PPTG_22702
Length=549

 Score = 37.4 bits (85),  Expect = 0.014, Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (51%), Gaps = 15/95 (16%)

Query  50   DNDRLFEQPVDGGRVSDAAGDDVTNYDADLRFEIDMDDIHRN------LDRMLQEAKDEG  103
            D + + EQ  +  +  DA GD        L  E+D   + R       ++ +++ A + G
Sbjct  425  DEELILEQLANRQQ-DDATGDP-------LELEVDDPPVSRAEAATEAVEVLIKRALENG  476

Query  104  FEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            F    +++LR +V+ +D VWR+ +  DPPA V PL
Sbjct  477  FPVEKVEKLRVIVHMYD-VWRLELRDDPPARVPPL  510

>PHYCA_128372
Length=286

 Score = 37.4 bits (85),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 6/106 (6%)

Query  1    MLCRASVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPV  59
            +  R  + + + I TA GP+   +   C V +  E+EF+LG+  ++ +GID ++  EQ  
Sbjct  185  ITARNVIEVRILIHTAAGPVTPTQRFRCLVIEDEEEEFILGQDILRTLGIDVNQQLEQLA  244

Query  60   DGGRVSDAAGDDVTNYDADLRF-EIDMDDIHRNLDRMLQEAKDEGF  104
                 S    DD    D D R  +   +++   ++ ++Q A   GF
Sbjct  245  R----STQENDDPVEMDDDARTRKFTSEEVKEAVEELIQRALKNGF  286

>H310_04256
Length=1174

 Score = 37.4 bits (85),  Expect = 0.016, Method: Composition-based stats.
 Identities = 39/150 (26%), Positives = 55/150 (37%), Gaps = 40/150 (27%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGSEDE----FLLGRKTMQDIGIDNDRLFEQPVDGG  62
            V L L  ET VGPL L    C++  G         LL R  + +             D G
Sbjct  97   VKLTLNFETDVGPLVLTDVKCWLSSGDLPSGVGGILLSRPIISE------------YDMG  144

Query  63   RVSDAAG--------------DDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDEGFEPTL  108
             V   +G              DD+ + +  L            LD  + EA   G     
Sbjct  145  DVESTSGVVKAVMLATKQELVDDLADEEKALAV----------LDAKVAEAMAAGCGSEF  194

Query  109  LDELRTLVYEHDDVWRIHVGADPPADVEPL  138
               L  L+ ++ DV+R+ +G DPP D+ PL
Sbjct  195  ALVLSKLLAKYVDVFRLTLGHDPPVDIPPL  224

>H257_15682
Length=705

 Score = 37.4 bits (85),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 0/47 (0%)

Query  92   LDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            L+  + EA   G     +++LR ++ E  DV+R+  G DPP  +EPL
Sbjct  135  LEAKVAEAASAGMPTAAVEQLRNVLMEFRDVFRLKFGRDPPLKMEPL  181

>PHYCA_15463
Length=339

 Score = 37.0 bits (84),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query  9    LDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            + +RI TAVGP+  +      V D ++DEF++G   +  +GID DR  EQ
Sbjct  290  MRVRIHTAVGPVEPMELVDVLVMDVNDDEFIVGNDLLTALGIDVDRQLEQ  339

>PYIW_26697
Length=93

 Score = 35.4 bits (80),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (53%), Gaps = 3/68 (4%)

Query  4   RASVTLDLRIETAVGPLNLR-GASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGG  62
           R +V L + + TA  P+  +   +C V +  EDEF++G   + ++ ID +R  E      
Sbjct  13  RTAVELYITLHTAAEPVRCQDKKACLVVEDGEDEFIVGNGLLTELDIDVERQLEML--AA  70

Query  63  RVSDAAGD  70
           RV D+ GD
Sbjct  71  RVEDSNGD  78

>PHYSO_432693
Length=121

 Score = 35.8 bits (81),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 0/43 (0%)

Query  96   LQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            LQEA++ G      DELR L++ + DV+R+    +PP  V PL
Sbjct  9    LQEARENGLPGPECDELRDLLFRYIDVFRLSFNDNPPVRVPPL  51

>H310_04615
Length=234

 Score = 36.6 bits (83),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  6    SVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
            +V L +++ TA G + L G   F    S DE ++ +   Q IG+D  +L EQ
Sbjct  155  TVDLSVKLHTAAGQVKLPGKYRFYVVDSNDELIVSKHPPQSIGLDMSKLLEQ  206

>PYIR_25234
Length=358

 Score = 36.6 bits (83),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (57%), Gaps = 2/51 (4%)

Query  27   CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDA  77
            C V D  +DEFL+GR  + ++GID DR+ E  +   R SD   D +   DA
Sbjct  299  CLVIDNDDDEFLVGRPLLLELGIDVDRMLE--MLAARCSDYEDDPIEPTDA  347

>CCA24593
Length=216

 Score = 36.2 bits (82),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 48/112 (43%), Gaps = 10/112 (9%)

Query  37   FLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDA-DLR---------FEIDMD  86
             L+ R  M+ +G   + + +   +   + DA+ D  T     D R          E   D
Sbjct  11   LLMDRNLMEIMGYSVEAILQGKREKQAIWDASVDGATAVQTPDKRCLFTPEVKHIEAQQD  70

Query  87   DIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             I+  L   + E ++ G    L+D L+ +  ++ D++R+    +PP  V PL
Sbjct  71   TINNILKEKVHEVQEVGVAMELVDRLKDMFIKYGDIFRVEFALEPPVKVAPL  122

>CCA21585
Length=179

 Score = 36.2 bits (82),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 0/55 (0%)

Query  84   DMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            D + +++ L + L  A+  G    +L +++ L++   D +R+ +  DPP DV PL
Sbjct  109  DSNRVNQVLMQKLNAARKNGCLEAMLGQMKDLLFAKQDCFRLELRQDPPVDVPPL  163

>PHYSO_408591
Length=140

 Score = 35.8 bits (81),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query  94   RMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADV  135
            R++  A + GF    +++LRT+V+ +D VWR+ + AD PA+V
Sbjct  1    RLIDRAVENGFPLEHVEQLRTIVHAYD-VWRLELRADSPANV  41

>PHYCA_53569
Length=63

 Score = 34.3 bits (77),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 1/52 (2%)

Query  7   VTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           V L + + T  GP+ L +   C V +  E EF++G+  ++ +GID D   EQ
Sbjct  1   VHLRVLLNTTAGPVLLHKPVECLVIEDDEPEFIMGQDLLKALGIDIDHQLEQ  52

>H310_03468
Length=338

 Score = 35.8 bits (81),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 26/43 (60%), Gaps = 0/43 (0%)

Query  96   LQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            L  A++EG     L++LR L+  + DV+R+ +   PP  VEPL
Sbjct  230  LVRAEEEGLSAVSLEQLRRLLKVYTDVFRLEMSCYPPIKVEPL  272

>H257_18160
Length=94

 Score = 34.3 bits (77),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 4/46 (9%)

Query  13  IETAVGPLNLRGAS-CFV-RDGSEDEFLLGRKTMQDIGIDNDRLFE  56
           ++TA GP+ + G   C+V  DG  DE L+   T++ IGID DRL E
Sbjct  1   MQTAAGPVEVPGKRRCYVVNDG--DEILVSYDTLKTIGIDIDRLLE  44

>PPTG_06322
Length=214

 Score = 35.0 bits (79),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 29/56 (52%), Gaps = 4/56 (7%)

Query  4    RASVTLDLRIETAVGPLNLRGASCFVRDG----SEDEFLLGRKTMQDIGIDNDRLF  55
            ++ V L+LR  T  GPL LR   C+V +        + LL R  M+ +G   ++LF
Sbjct  86   KSKVKLNLRFTTPGGPLILRNVICWVTEQPLPMGVGDLLLSRWIMERLGYSAEKLF  141

>PHYCA_100898
Length=112

 Score = 34.3 bits (77),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 43/98 (44%), Gaps = 5/98 (5%)

Query  23   RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDADLRFE  82
            +   C V D  E EF++G+  ++ +GI  DR  EQ V+  R  D   +   N D D   +
Sbjct  19   KPVECLVIDKYEPEFIMGQGLLKTLGIGIDRQLEQLVE--RAEDVKDN---NDDFDGEHQ  73

Query  83   IDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHD  120
                 +  N  R L       F   L  +LR +V +++
Sbjct  74   AGQPQLKNNFKRQLIRCYRPLFPLHLEQKLRAIVLKNE  111

>H257_16271
Length=324

 Score = 35.0 bits (79),  Expect = 0.075, Method: Compositional matrix adjust.
 Identities = 39/157 (25%), Positives = 55/157 (35%), Gaps = 35/157 (22%)

Query  10   DLRIETAVGPLNLRGA-SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAA  68
             L  +T  GPL LRG   C     +  E  LG   MQ +G +   L +       V D  
Sbjct  134  SLEFKTTCGPLMLRGLLVCVDETVAPVELTLGLPVMQKLGYNEYTLLKNARWQDAVWDFG  193

Query  69   GDDVTNYDADLRFEIDMDDI----------------HRN-----------LDRMLQEAKD  101
               +T     +   + M  +                H N           L+  + EA  
Sbjct  194  EQTITTPGVAMHRTLWMGALSDGIDDDEGMACATPEHGNAPDGDGPVRIVLEAKVAEASV  253

Query  102  EGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             G     +++LR       DV+R+  G DPP  VEPL
Sbjct  254  AGMPIAAVEQLR-------DVFRLKFGKDPPVKVEPL  283

>H257_13188
Length=714

 Score = 35.0 bits (79),  Expect = 0.099, Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 62/157 (39%), Gaps = 25/157 (16%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGS----EDEFLLGRKTMQDIGID-NDRLFEQPV--  59
            V L ++ E  VG L L    C++  G+      + LL R  M  +G D   +L E     
Sbjct  231  VKLPIKFEADVGSLVLAKVKCWLSVGNLPAGVGDILLSRPIMHKLGCDPQSKLREAAAVC  290

Query  60   ---DGGRVSDAAG--------------DDVTNYDADL-RFEIDMDDIHRNLDRMLQEAKD  101
               D   V   +G              DD+   +  L   E+    +   LD  + +A  
Sbjct  291  SEYDMKDVESTSGVVKTVMLATKQELVDDLAEEEEALVPMELAASKVQAVLDARVADALL  350

Query  102  EGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
             G        L  L+ ++ DV+R+ +G DPP D+ PL
Sbjct  351  AGCGAEFALGLSKLLAKYMDVFRLTLGRDPPVDMPPL  387

>H310_02779
Length=794

 Score = 35.0 bits (79),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 65/160 (41%), Gaps = 32/160 (20%)

Query  10   DLRIETAVGPLNLRGASCFVRDGSED--EFLLGRKTMQDIGIDNDRLFEQP---------  58
            +L + T   PL L+  S +V D S+      +GR  M+ +G   + L +           
Sbjct  593  ELVLLTGEAPLVLKNVSAWV-DTSDSGLNITVGRPVMEALGYSTEDLLKTASATQDAYDL  651

Query  59   -----VDGGRVSDAAGDDVTNYDADLRFEIDMDD---------------IHRNLDRMLQE  98
                 +D    S AA      Y   L    D+DD               + R L++ +QE
Sbjct  652  GDLSVLDFEGASSAARALKARYAQMLAESGDLDDFEDDVPAINGNPKLAVRRILEQKVQE  711

Query  99   AKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            A+ +G   +    L  L+ E ++V+R+    DPP  V+PL
Sbjct  712  AQCKGLSESGAIRLHDLLREFEEVFRVQFQDDPPVAVDPL  751

>H310_15126
Length=1007

 Score = 35.0 bits (79),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 32/57 (56%), Gaps = 0/57 (0%)

Query  82   EIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            E+D   +   L+  +++ +  G    L  +L  L+  ++DV+R+ +G DPP DV PL
Sbjct  31   EVDRMAVRAKLEEKVRDCERVGCGEGLATQLSKLLALYEDVFRLTLGRDPPVDVAPL  87

>H257_12046
Length=811

 Score = 34.7 bits (78),  Expect = 0.12, Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 0/50 (0%)

Query  84   DMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPA  133
            D + +H  L   + E +  G        L TL+  ++DV+R+ +G DPPA
Sbjct  352  DQEVVHAKLKEKVSECRAAGCGEEFATALGTLLLRYEDVFRLSLGRDPPA  401

>PHYRA_77456
Length=1067

 Score = 34.7 bits (78),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (2%)

Query  2    LCRASVTLDLRIETAVGPLNLRGASCFVRDGSED-EFLLGRKTMQDIGIDNDRLF  55
            + R +   ++ + T+ GPL LR  +C+V++ S   +  +GR  M+ +G   D+L 
Sbjct  488  VSRVATFKEVVLTTSAGPLMLRSLACYVKEESLSLDLTVGRPIMKILGYSTDKLL  542

>H310_12588
Length=362

 Score = 34.7 bits (78),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 28/46 (61%), Gaps = 1/46 (2%)

Query  11   LRIETAVGPLNLRGASCFVRDGSED-EFLLGRKTMQDIGIDNDRLF  55
            ++ ET+ GPL LRG   +V + S+D + L+G+  M+ +G   D + 
Sbjct  308  MQFETSFGPLVLRGLKAWVDETSQDCDLLIGKPVMEVLGFSQDGML  353

>H310_13605
Length=818

 Score = 34.7 bits (78),  Expect = 0.14, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  111  ELRTLVYEHDDVWRIHVGADPPADVEPL  138
            EL  L+ +++DV+R+ +G DPP  VEPL
Sbjct  596  ELGRLLVKYEDVFRLKLGRDPPVKVEPL  623

>PHYCA_128809
Length=359

 Score = 34.3 bits (77),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 25/94 (27%), Positives = 48/94 (51%), Gaps = 11/94 (12%)

Query  27   CFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDD---VTNYDADLRFEI  83
            C V    E EF+LG+  ++ +GID +R  EQ      +++  GDD   +++ D+   F  
Sbjct  272  CLVISDGEPEFILGQDVLKTLGIDINRQLEQ------LAEREGDDDACLSDEDSAPIFTS  325

Query  84   DMD--DIHRNLDRMLQEAKDEGFEPTLLDELRTL  115
             +   D+   +++++Q+A   GF      +LR +
Sbjct  326  TLKDTDLKEAVEQLVQKALGHGFPREFEQQLRAI  359

>PHYCA_128315
Length=396

 Score = 34.3 bits (77),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (89%), Gaps = 0/18 (0%)

Query  121  DVWRIHVGADPPADVEPL  138
            DVWRI++G DPPA+V PL
Sbjct  3    DVWRINLGPDPPANVPPL  20

>PITG_12173
Length=541

 Score = 34.3 bits (77),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query  20   LNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSD-----AAGDDVTN  74
            +N+   +C V D  E+E L G+ T+ ++GI+ D +  Q  +G    D       GD   +
Sbjct  400  VNVPSVTCVVMDSEEEELLPGKDTLNELGINVDDMLAQLANGADFVDDSDDYEVGDTSQD  459

Query  75   YDADLRFEI  83
            + A  R +I
Sbjct  460  HRAATREQI  468

>H310_12675
Length=188

 Score = 33.9 bits (76),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 40/88 (45%), Gaps = 13/88 (15%)

Query  48   GIDNDRLFEQPVDGGRVSDAAGDDVTNYDA----DLRFEIDMDDIHRNLDRMLQEAKDEG  103
            G+  D  F  P DG  ++D    DVT+  +       F +D       L   + EA+  G
Sbjct  109  GVPLDADFASPSDGADLTD----DVTSLPSLSLVSAPFAVD-----SLLAARVAEAEAYG  159

Query  104  FEPTLLDELRTLVYEHDDVWRIHVGADP  131
                 L+ LR L+  + DV+R+ +G DP
Sbjct  160  LAGPDLERLRALILRYSDVFRLSIGGDP  187

>H310_08460
Length=436

 Score = 33.9 bits (76),  Expect = 0.22, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  111  ELRTLVYEHDDVWRIHVGADPPADVEPL  138
            +L  L+  ++DV+R+ +G DPP DV PL
Sbjct  112  QLSKLLVRYEDVFRLTLGRDPPVDVAPL  139

>PHYCA_98670
Length=121

 Score = 33.1 bits (74),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (57%), Gaps = 1/51 (2%)

Query  7   VTLDLRIETAVGPLNLRGAS-CFVRDGSEDEFLLGRKTMQDIGIDNDRLFE  56
           V + L + TA GP+  +    C + +  EDE L+G+  + ++GID ++  E
Sbjct  1   VDIRLTLNTAAGPVRCQEPKRCLIVESDEDEMLVGKTLLSELGIDIEQQLE  51

>PITG_22437
Length=102

 Score = 32.7 bits (73),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query  7   VTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDR  53
           V L LR+ T+ G + + +   C +  G   EFLLG   +  +GID  R
Sbjct  3   VNLQLRLRTSAGSVRISKPVECLIIPGDAAEFLLGNDVLTMLGIDVQR  50

>CCA26651
Length=378

 Score = 33.9 bits (76),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 29/57 (51%), Gaps = 0/57 (0%)

Query  82   EIDMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            E   D +   L   + EA+++G     L  L +L+Y + DV+++   ADP   V PL
Sbjct  10   EAQKDVVTEILKSKVVEAREKGANEESLSRLTSLLYRYQDVFKVDFAADPLVKVPPL  66

>PYU1_G011875
Length=122

 Score = 32.7 bits (73),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query  6    SVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDR  53
            +V + L + TA GP+NL +   C V  G +DEFLL    +  +GI+ DR
Sbjct  62   TVEVHLSLRTAAGPVNLEKPIVCLVVPGDDDEFLL--DVLDILGINVDR  108

>H257_05466
Length=479

 Score = 33.9 bits (76),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  100  KDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            +DEG    L  +LR L+ +H DV+ + +  D P  VEPL
Sbjct  245  EDEGLTADLFQKLRLLLVKHCDVFHLEISHDEPIKVEPL  283

>H310_12525
Length=337

 Score = 33.5 bits (75),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (48%), Gaps = 5/61 (8%)

Query  15   TAVGPLNLRGASCFVRDGS-EDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVT  73
            T  GPL LRG  C++ D S E + ++ R  M+ +G   D L      G R  D   D +T
Sbjct  244  TTCGPLTLRGLHCWIDDTSPEIDLIISRPVMELLGFSVDALLV----GARQKDTEWDRMT  299

Query  74   N  74
             
Sbjct  300  T  300

>PHYRA_85043
Length=1292

 Score = 33.5 bits (75),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query  13   IETAVGPLNLRGASCFV-RDGSEDEFLLGRKTMQDIGIDNDRLFEQPVD  60
            + T+ GPL LR  +C+V  D +     +GR  M+ +G   D+L  +  D
Sbjct  453  LTTSAGPLMLRNLACYVEEDNASLVLTVGRPVMKILGYSTDKLLAKAKD  501

>PHYSO_309514
Length=128

 Score = 32.7 bits (73),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 11/93 (12%)

Query  25   ASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGDDVTNYDADLRFEID  84
              C V +  E+ F++G+  +  +GID +R  EQ V+     DA        D D    + 
Sbjct  41   VKCLVIEEDEEGFIIGKDVLATLGIDIERQLEQLVEN---KDA-------LDRDFIVGVR  90

Query  85   MD-DIHRNLDRMLQEAKDEGFEPTLLDELRTLV  116
             D D++ +L+ ++  A   GF     +ELRT V
Sbjct  91   CDADVNASLEELIDTAVVNGFPRERREELRTAV  123

>H257_12105
Length=183

 Score = 33.1 bits (74),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 29/55 (53%), Gaps = 0/55 (0%)

Query  84   DMDDIHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            D + +   L   + EA  +G E   ++ L+ L+ +   V+R+  G DPP  VEPL
Sbjct  94   DAEAVRTVLMAKVAEAAADGMEEPAVEALQDLLLKFQGVFRLIFGRDPPVRVEPL  148

>H257_14841
Length=1343

 Score = 33.1 bits (74),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 65/172 (38%), Gaps = 44/172 (26%)

Query  7    VTLDLRIETAVGPLNLRGASCFVRDGS-------------------EDEFLLGRKTMQDI  47
            VTLD    T  GPL LRG   +V D S                   ED  +  RK  ++ 
Sbjct  435  VTLD----TTCGPLVLRGLKAWVDDASTATELIVSHPVMELLGFSVEDLLVGARKKKEEW  490

Query  48   GIDN------------DRLFEQPVDGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDR-  94
             + +             RL  + ++   +    G + T  +   +  ++ +  HR   + 
Sbjct  491  DVSSVPTNELSGMANVKRLMAEKLNPPELDPDDGMECTTPEVYPKTSVEDEAKHRRTKQG  550

Query  95   --------MLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
                       EA+  G  P     L  L+ +H DV+R ++G DPP  VEPL
Sbjct  551  AVQAILAAKAAEAETRGLAPAEATRLHDLLAKHIDVFRENLGDDPPVKVEPL  602

>PHYRA_84817
Length=719

 Score = 33.1 bits (74),  Expect = 0.41, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query  46   DIGIDNDRLFEQ-PVDGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEA-KDEG  103
            ++GID DR  EQ      R  DA GD        +R E   +++   +D M+ +  + E 
Sbjct  341  ELGIDVDRELEQLAARNLRDDDAFGDPT---GIPVREETLDEEVAIVIDGMVTDCLEREI  397

Query  104  FEPTLLDE-LRTLVYEHDDVWRIHVGADPPADVEPL  138
              P   +E LR +++  +  WR+ +G DPPA V PL
Sbjct  398  VSPGAEEERLRAILFSFNG-WRLVLGDDPPAKVPPL  432

>CCA16690
Length=782

 Score = 33.1 bits (74),  Expect = 0.42, Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 28/54 (52%), Gaps = 1/54 (2%)

Query  3    CRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGID-NDRLF  55
            C   V   L ++T VGP+ L    C++   +  E L+G+  +  +GID  D+L 
Sbjct  366  CCQKVNSQLCLQTPVGPVKLPNTDCYIVQEASWEILIGKPLLNAVGIDVEDKLL  419

>H257_18058
Length=803

 Score = 33.1 bits (74),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  103  GFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            G  P     L  L+ EH DV+R  +G DPP  VEPL
Sbjct  541  GLAPAEATRLHDLLAEHIDVFREDLGDDPPVKVEPL  576

>PHYCA_82928
Length=89

 Score = 31.6 bits (70),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 1/44 (2%)

Query  15  TAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           TA G + +     C V D  ++E ++GR  +  +GID +R  EQ
Sbjct  1   TAAGAVEIAEPVPCLVMDTKDEELIVGRDVLSILGIDVERQLEQ  44

>H257_09387
Length=318

 Score = 32.7 bits (73),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  18   GPLNLRGA--SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAG  69
            GP+ + G   S  V DG  DEFL+   T++ IGID DR+ E  V      +A G
Sbjct  118  GPVKVTGKRRSYVVYDG--DEFLVSDDTLKSIGIDIDRILEHMVQYAVNVNANG  169

>H257_10291
Length=508

 Score = 33.1 bits (74),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 0/47 (0%)

Query  92   LDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPADVEPL  138
            L+  + EA   G     +++L+ L+ E  +V+R+  G DPP  VE L
Sbjct  400  LESKVAEAATAGMPTAAVEQLQDLLMEFREVFRLKFGRDPPVKVESL  446

>PYAR_26188
Length=291

 Score = 32.7 bits (73),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (46%), Gaps = 3/103 (3%)

Query  1    MLCRASVTLDLRIETAVGPLNLRGA-SCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPV  59
            ++ R ++   L I TA G + +     C + + SE E +LG   +  +GI+ +   E+  
Sbjct  191  LVSREALRAQLTIGTAAGVVTITEPRECLILESSESELILGLDVLNTLGINIENQLERL-  249

Query  60   DGGRVSDAAGDDVTNYDADLRFEIDMDDIHRNLDRMLQEAKDE  102
               R S   GD +   D D     D D++   ++ ML  A DE
Sbjct  250  -AARESGVDGDPMPFEDDDRVNATDKDELMAAIEEMLVRALDE  291

>PPTG_21839
Length=74

 Score = 31.2 bits (69),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (2%)

Query  6   SVTLDLRIETAVGPLN-LRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQ  57
           +V L ++I T  G +   +   C + +  +DEF+ G+  ++ +GID DRL +Q
Sbjct  20  AVDLIIQIGTVAGIVEPQKPEECLLIESDDDEFIAGQDLLKVLGIDVDRLLDQ  72

>H310_10004
Length=62

 Score = 30.8 bits (68),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 28/46 (61%), Gaps = 0/46 (0%)

Query  88   IHRNLDRMLQEAKDEGFEPTLLDELRTLVYEHDDVWRIHVGADPPA  133
            + + L   L++A+DE     L ++L  L+ +H D++R+ V  DPP+
Sbjct  2    VKQVLATKLEQARDEVVALVLAEKLGQLLEKHVDMFRLQVRHDPPS  47

>H310_12047
Length=584

 Score = 32.7 bits (73),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 1/85 (1%)

Query  10   DLRIETAVGPLNLRGASCFVRDGSED-EFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAA  68
             +  +TA GPL LRG   ++ D +   E  LG   MQ +G +   L E   +   V D +
Sbjct  449  SIEFKTACGPLILRGLRVWLDDAATGVELTLGLPVMQRLGYNEQTLLENAYNQQAVWDLS  508

Query  69   GDDVTNYDADLRFEIDMDDIHRNLD  93
                T     +   + + D+   LD
Sbjct  509  DQPGTTPGVAMHRALRLGDLSDGLD  533

>PHYCA_123542
Length=177

 Score = 32.0 bits (71),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 0/50 (0%)

Query  1   MLCRASVTLDLRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGID  50
           + C+  + LDL + T  G + +R  +C + +  EDEFLLG  T++ +GID
Sbjct  48  ITCKELIQLDLELITPTGRVRMRQVTCAITETEEDEFLLGLLTLEVLGID  97

>PHYCA_103042
Length=324

 Score = 32.3 bits (72),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query  6    SVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDR  53
            +V L LR+ T  G + + +   C +  G   EFLLG   +  +GID  R
Sbjct  266  TVNLHLRVRTVAGSVRIAKPVECLIIPGDASEFLLGNDVLTMLGIDVHR  314

>PYAR_13535
Length=1564

 Score = 32.3 bits (72),  Expect = 0.88, Method: Composition-based stats.
 Identities = 31/94 (33%), Positives = 44/94 (47%), Gaps = 11/94 (12%)

Query  11   LRIETAVGPLNLRGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFEQPVDGGRVSDAAGD  70
            LR+  A+G +N +G    V DG+E  F L    +    +D   L E   + G VSD   D
Sbjct  420  LRVRQALG-MNEQGID--VADGAESAFSLKELKLSKAQVD---LLE---NAGPVSDDDDD  470

Query  71   --DVTNYDADLRFEIDMDDIHRNLDRMLQEAKDE  102
                 + D DL FE D D+    LD  +++  DE
Sbjct  471  REGRPDSDTDLEFESDDDEYTEVLDSQMEKLYDE  504

>PHYCA_102668
Length=114

 Score = 31.2 bits (69),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 15/18 (83%), Gaps = 0/18 (0%)

Query  121  DVWRIHVGADPPADVEPL  138
            D+WR+++G DPPA V PL
Sbjct  3    DIWRVNLGDDPPAKVPPL  20

>PHYSO_515292
Length=112

 Score = 31.2 bits (69),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)

Query  121  DVWRIHVGADPPADVEPL  138
            DVWR+ +G DPP DVEP+
Sbjct  1    DVWRLVLGDDPPVDVEPM  18

>PPTG_21757
Length=444

 Score = 32.0 bits (71),  Expect = 1.2, Method: Composition-based stats.
 Identities = 17/52 (33%), Positives = 28/52 (54%), Gaps = 1/52 (2%)

Query  6    SVTLDLRIETAVGPLNL-RGASCFVRDGSEDEFLLGRKTMQDIGIDNDRLFE  56
            +V  ++R+ T  G +++     C +  GS  EFLLG   +  +GID +R  E
Sbjct  362  TVKFNVRLRTIAGNVHVAEPVECLIIPGSSGEFLLGNDLLIKLGIDVERQLE  413

Lambda      K        H        a         alpha
   0.324    0.144    0.436    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3695829768

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40