Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_51797111451991999691e-134
PHYSO_501475111452001999264e-128
PHYCA_508469111452001999222e-127
PPTG_09250111452001999003e-124
PITG_13737111451991998952e-123
HYAP_08503111452801998868e-121
PYAP_24850945452001998665e-119
PHYKE_5842111455501998926e-118
PYU1_G013641836652001998492e-116
PYIR_21169836652001998459e-116
PYU1_G0059881001312001998441e-115
PYU1_G005989111452001998441e-115
PYAP_251481017342001998381e-114
PPTG_09275111662001998328e-114
PITG_13763111682001998267e-113
PITG_13761111662001998241e-112
PYU1_G005990111662001998205e-112
PYU1_G005991945452001998205e-112
PYIR_14437111452001998171e-111
PHYKE_4827111662001998111e-110
PHYSO_503540111662001998102e-110
PHYSO_285976836652001998093e-110
PHYSO_5001081001312001998093e-110
PHYRA_96097111662001998032e-109
PYIW_16204836652001998023e-109
PYAP_21524945412001997998e-109
PYU1_G005987945412001997902e-107
PHYCA_118176111662001997868e-107
PHYSO_285972111672001997806e-106
PPTG_20266111672131997764e-105
PHYRA_71949111672001997693e-104
PITG_13762111672001997693e-104
PHYCA_512169111672001997676e-104
PHYCA_5084911001312001997676e-104
PHYRA_71950111682001997652e-103
PYAP_245291013341991997563e-102
PHYRA_71996693812001997494e-101
PHALS_11795111451831827465e-101
PHYKE_1631748182001997486e-101
PHYCA_553014693812001987477e-101
CCA15845111452001997452e-100
CCA274111579022001997452e-100
PPTG_03020748182001997442e-100
CCI42280111452001997416e-100
PHYSO_285975473762001997382e-99
PHYSO_285974111682001997382e-99
PYVX_14995111672001997372e-99
PYAP_245301013352581937423e-99
PPTG_17005435872001997355e-99
PPTG_17006435862001997347e-99
PHYRA_81696473762001997294e-98
PYU1_G001466748182022007279e-98
PHYCA_132728435862001997233e-97
PHYCA_124158426492001997233e-97
PHYCA_19840376012001997233e-97
PHYCA_118207473762001997216e-97
PHYCA_132729435872001997191e-96
PYIW_266101658952001997182e-96
PYVX_13848748182001997103e-95
PYAP_251491017352001997087e-95
PPTG_00540180062011976722e-89
PHYRA_71993508412011976619e-88
PYAR_19739945412041996601e-87
PHYCA_553010452482001996573e-87
PYIR_25908860551991996541e-86
PYU1_G002524860551991996462e-85
PHYSO_492858180062011976427e-85
PHYSO_491760576692011976392e-84
PHYKE_35111671601596352e-84
PHYRA_72407511031991986383e-84
PYAP_215251001311911906365e-84
PHYCA_121985511031991986341e-83
PHYKE_8238771941991986322e-83
PHYRA_82142748182001996314e-83
PYVX_220781116512672706887e-83
PHYSO_327921508412091996281e-82
PYAR_24476111452131486237e-82
PPTG_03053452482251996195e-81
PITG_12444101492001646122e-80
PYAR_22252111672012005776e-75
PHYCA_508489836651561995413e-70
PYIW_26124748181391394641e-58
PITG_19721748181471994536e-57
PYAR_176241031272152194562e-56
PYVX_245031013351131124402e-55
PPTG_202651116889893592e-43
PYIW_24901860551231233543e-42
PYVX_245418124382823461e-41
PYIW_2681716610580973131e-36
PYIW_2566616517675753122e-36
PYIR_1643374818102883054e-35
PYAR_177319454563622964e-34
PYIR_2530985567103652915e-33
PITG_224621723764632686e-30
PHYSO_5259257481873742549e-28
PYVX_220818366545442022e-20
PHYKE_521910013138381535e-13
PHYKE_48268124338381403e-11
PHYSO_32987751103115481429e-11
PITG_11840970410626810.040
CCA203001381958639750.70
PYIR_224077627377589712.6
PYVX_20689682439745703.2
SDRG_16426133753162857703.3
CCA2616614334159475704.3
H310_06144465264541686.4
PHYSO_2886584764412042648.8
PITG_02800245480640679.3
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_51797

Length=199
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYRA_51797                                                           377     1e-134
PHYSO_501475                                                          361     4e-128
PHYCA_508469                                                          359     2e-127
PPTG_09250                                                            351     3e-124
PITG_13737                                                            349     2e-123
HYAP_08503                                                            345     8e-121
PYAP_24850                                                            338     5e-119
PHYKE_5842                                                            348     6e-118
PYU1_G013641                                                          331     2e-116
PYIR_21169                                                            330     9e-116
PYU1_G005988                                                          329     1e-115
PYU1_G005989                                                          329     1e-115
PYAP_25148                                                            327     1e-114
PPTG_09275                                                            325     8e-114
PITG_13763                                                            322     7e-113
PITG_13761                                                            322     1e-112
PYU1_G005990                                                          320     5e-112
PYU1_G005991                                                          320     5e-112
PYIR_14437                                                            319     1e-111
PHYKE_4827                                                            317     1e-110
PHYSO_503540                                                          316     2e-110
PHYSO_285976                                                          316     3e-110
PHYSO_500108                                                          316     3e-110
PHYRA_96097                                                           313     2e-109
PYIW_16204                                                            313     3e-109
PYAP_21524                                                            312     8e-109
PYU1_G005987                                                          308     2e-107
PHYCA_118176                                                          307     8e-107
PHYSO_285972                                                          305     6e-106
PPTG_20266                                                            303     4e-105
PHYRA_71949                                                           300     3e-104
PITG_13762                                                            300     3e-104
PHYCA_512169                                                          300     6e-104
PHYCA_508491                                                          300     6e-104
PHYRA_71950                                                           299     2e-103
PYAP_24529                                                            295     3e-102
PHYRA_71996                                                           293     4e-101
PHALS_11795                                                           291     5e-101
PHYKE_1631                                                            292     6e-101
PHYCA_553014                                                          292     7e-101
CCA15845                                                              291     2e-100
CCA27411                                                              291     2e-100
PPTG_03020                                                            291     2e-100
CCI42280                                                              290     6e-100
PHYSO_285975                                                          288     2e-99 
PHYSO_285974                                                          288     2e-99 
PYVX_14995                                                            288     2e-99 
PYAP_24530                                                            290     3e-99 
PPTG_17005                                                            287     5e-99 
PPTG_17006                                                            287     7e-99 
PHYRA_81696                                                           285     4e-98 
PYU1_G001466                                                          284     9e-98 
PHYCA_132728                                                          283     3e-97 
PHYCA_124158                                                          283     3e-97 
PHYCA_19840                                                           283     3e-97 
PHYCA_118207                                                          282     6e-97 
PHYCA_132729                                                          281     1e-96 
PYIW_26610                                                            281     2e-96 
PYVX_13848                                                            278     3e-95 
PYAP_25149                                                            277     7e-95 
PPTG_00540                                                            263     2e-89 
PHYRA_71993                                                           259     9e-88 
PYAR_19739                                                            258     1e-87 
PHYCA_553010                                                          257     3e-87 
PYIR_25908                                                            256     1e-86 
PYU1_G002524                                                          253     2e-85 
PHYSO_492858                                                          251     7e-85 
PHYSO_491760                                                          250     2e-84 
PHYKE_35                                                              249     2e-84 
PHYRA_72407                                                           250     3e-84 
PYAP_21525                                                            249     5e-84 
PHYCA_121985                                                          248     1e-83 
PHYKE_8238                                                            248     2e-83 
PHYRA_82142                                                           247     4e-83 
PYVX_22078                                                            269     7e-83 
PHYSO_327921                                                          246     1e-82 
PYAR_24476                                                            244     7e-82 
PPTG_03053                                                            243     5e-81 
PITG_12444                                                            240     2e-80 
PYAR_22252                                                            226     6e-75 
PHYCA_508489                                                          213     3e-70 
PYIW_26124                                                            183     1e-58 
PITG_19721                                                            179     6e-57 
PYAR_17624                                                            180     2e-56 
PYVX_24503                                                            174     2e-55 
PPTG_20265                                                            142     2e-43 
PYIW_24901                                                            140     3e-42 
PYVX_24541                                                            137     1e-41 
PYIW_26817                                                            125     1e-36 
PYIW_25666                                                            124     2e-36 
PYIR_16433                                                            122     4e-35 
PYAR_17731                                                            118     4e-34 
PYIR_25309                                                            116     5e-33 
PITG_22462                                                            107     6e-30 
PHYSO_525925                                                          102     9e-28 
PYVX_22081                                                            82.4    2e-20 
PHYKE_5219                                                            63.5    5e-13 
PHYKE_4826                                                            58.5    3e-11 
PHYSO_329877                                                          59.3    9e-11 
PITG_11840                                                            35.8    0.040 
CCA20300                                                              33.5    0.70  
PYIR_22407                                                            32.0    2.6   
PYVX_20689                                                            31.6    3.2   
SDRG_16426                                                            31.6    3.3   
CCA26166                                                              31.6    4.3   
H310_06144                                                            30.8    6.4   
PHYSO_288658                                                          29.3    8.8   
PITG_02800                                                            30.4    9.3   

>PHYRA_51797
Length=199

 Score = 377 bits (969),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/199 (100%), Positives = 199/199 (100%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP
Sbjct  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG
Sbjct  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTTLTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFAGVAKKLS
Sbjct  181  LDVAKVQGESFAGVAKKLS  199

>PHYSO_501475
Length=200

 Score = 361 bits (926),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 194/199 (97%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYSTYGHIA MAESVK GVE+V+GVTAEIYQV+ETLSEEILGKMHA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATMAESVKEGVESVEGVTAEIYQVQETLSEEILGKMHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKP GIFFSTGT GG
Sbjct  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPVGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT++TFLTHQGMTFVPLGYRSPLLFNM+EIHGGSPWGAGTLAGADGSRQPSKLE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFAGVAKKLS
Sbjct  181  LDVAKVQGESFAGVAKKLS  199

>PHYCA_508469
Length=200

 Score = 359 bits (922),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTNIAIIYYSTYGHIA MAESVK GVE+VDGVTAEIYQV+ETLSEEIL KMHAAPK+D+P
Sbjct  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPD+LKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTIGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT++TFLTHQGMTFVPLGYRSPLLFNM+EIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFATVAKKLS  199

>PPTG_09250
Length=200

 Score = 351 bits (900),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 190/199 (95%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGHIA MAESVK GVE+VDGVTAE+YQV+ETLSEEIL KMHA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHIATMAESVKKGVESVDGVTAEVYQVQETLSEEILTKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPD+LKNADGVLLG PTRFGSMPAQVKALFDACGGLWA GALVGKPAGIFFSTGT GG
Sbjct  61   VATPDILKNADGVLLGFPTRFGSMPAQVKALFDACGGLWAGGALVGKPAGIFFSTGTLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT++TFLTHQGMTFVPLGYRSPLLFN++EIHGGSPWGAGT+AG DGSRQPS+LE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNLEEIHGGSPWGAGTIAGGDGSRQPSQLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFAGVAKKLS
Sbjct  181  LDVAKVQGESFAGVAKKLS  199

>PITG_13737
Length=199

 Score = 349 bits (895),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 187/199 (94%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGHIA MAES+K GVE+VDGVTAEIYQV+ETLSEEIL KMHA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHIATMAESIKKGVESVDGVTAEIYQVQETLSEEILTKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPD +KNADGVL GIPTRFGS PAQVKALFDACGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATPDTIKNADGVLFGIPTRFGSFPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFLTHQGM+FVPLGYRSPLLFN+DEIHGGSPWGAGT+AG DGSRQPSKLE
Sbjct  121  GQETTAFTAVTFLTHQGMSFVPLGYRSPLLFNLDEIHGGSPWGAGTIAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAK QGESFAGVAKKLS
Sbjct  181  LDVAKAQGESFAGVAKKLS  199

>HYAP_08503
Length=280

 Score = 345 bits (886),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 187/199 (94%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGHIAKMAES+KAGVE+V G TA++YQV+ETLS+E+L KMHA  K+DHP
Sbjct  80   MTKIAIIYYSTYGHIAKMAESIKAGVESVAGATADVYQVQETLSDEVLSKMHAPSKQDHP  139

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLW AGALVGKPAGIFFSTGT GG
Sbjct  140  VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWTAGALVGKPAGIFFSTGTQGG  199

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTT+TFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAG LAG DGSRQPS+LE
Sbjct  200  GQETTAFTTVTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGNLAGTDGSRQPSQLE  259

Query  181  LDVAKVQGESFAGVAKKLS  199
             DVAKVQGESFA VAKKLS
Sbjct  260  KDVAKVQGESFAQVAKKLS  278

>PYAP_24850
Length=200

 Score = 338 bits (866),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGHI +MAE+VKAGVE V GVTAEIYQV ETL EE+L KMHAAPKKD+P
Sbjct  1    MTKIAIIYYSTYGHIVQMAEAVKAGVELVTGVTAEIYQVAETLPEEVLSKMHAAPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATP+ LK ADG+L G PTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATPETLKEADGILFGFPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFLTHQGMTFVPLGYR PLLFN+DE+HGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTAITFLTHQGMTFVPLGYRCPLLFNLDEVHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAK QGESFA VAKKLS
Sbjct  181  LDVAKAQGESFANVAKKLS  199

>PHYKE_5842
Length=550

 Score = 348 bits (892),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 185/199 (93%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTY HIAKMAES+K GVE+V G TAE+YQ++ETL EEIL KMHA PKKDHP
Sbjct  351  MTKIAIIYYSTYSHIAKMAESIKEGVESVSGTTAEVYQIQETLPEEILAKMHAPPKKDHP  410

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPD+LKNADGVL GIPTRFGSMPAQVKALFDACGGLWA+G LVGKPAGIFFSTGT GG
Sbjct  411  VATPDILKNADGVLFGIPTRFGSMPAQVKALFDACGGLWASGGLVGKPAGIFFSTGTMGG  470

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTT+TFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPS LE
Sbjct  471  GQETTAFTTITFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSTLE  530

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAK QGESFA VAKKLS
Sbjct  531  LDVAKKQGESFAEVAKKLS  549

>PYU1_G013641
Length=200

 Score = 331 bits (849),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 180/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYSTYGHIAKMAE VK GVE+V GVTA IYQV ETLS+EIL KMHAAPKKDHP
Sbjct  1    MTNVAIIYYSTYGHIAKMAEKVKEGVESVAGVTATIYQVPETLSDEILAKMHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLKNADG+L G PTRFG+ PAQVKALFDA GGLW+ GALVGKPAG FFSTGT GG
Sbjct  61   IATPDVLKNADGILFGFPTRFGTFPAQVKALFDATGGLWSTGALVGKPAGFFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFLTHQG+TFVPLGYRSPLLF+ DEIHGGSPWGAGT AG DGSRQPS LE
Sbjct  121  GQETTAFTAVTFLTHQGLTFVPLGYRSPLLFSFDEIHGGSPWGAGTYAGPDGSRQPSTLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFAQVAKKLS  199

>PYIR_21169
Length=200

 Score = 330 bits (845),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 181/199 (91%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGHIAKMAE++K GVE+VDGVTAEIYQ+ ETL EE+L KMHAAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHIAKMAEAIKEGVESVDGVTAEIYQIAETLPEEVLAKMHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLK ADG+L G PTRFGSMPAQVKALFD+ GGLW +G LVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSMPAQVKALFDSTGGLWQSGGLVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA+T LTFL HQG+TFVPLGYRSPLLF+ +EIHGGSPWGAG+ AG DGSRQPSKLE
Sbjct  121  GQETTAYTALTFLAHQGLTFVPLGYRSPLLFSFEEIHGGSPWGAGSYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFAQVAKKLS  199

>PYU1_G005988
Length=200

 Score = 329 bits (844),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 184/199 (92%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGHIAKMAESVK GVE+V+GVTAEIYQV+ETLSE++L K++AAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQVQETLSEDVLAKLYAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLK ADG+L G PTRFGS PAQVKALFD+ GGLW+ GALVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKALFDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTTLTFL HQG+T+VPLGYRSPLLFN +EIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFAQVAKKLS  199

>PYU1_G005989
Length=200

 Score = 329 bits (844),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 184/199 (92%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGHIAKMAESVK GVE+V+GVTAEIYQV+ETLSE++L K++AAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQVQETLSEDVLAKLYAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLK ADG+L G PTRFGS PAQVKALFD+ GGLW+ GALVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKALFDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTTLTFL HQG+T+VPLGYRSPLLFN +EIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFAQVAKKLS  199

>PYAP_25148
Length=200

 Score = 327 bits (838),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 180/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGHI ++AES+K GVE V GV A IYQV ETL EE+L KMHAAPKKD+P
Sbjct  1    MTKIAIVYYSTYGHIVQLAESIKEGVEKVAGVEATIYQVAETLPEEVLSKMHAAPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATP+ LK ADG+L G PTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATPETLKEADGILFGFPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTTLTFLTH GMTFVPLGYRSPLLFNM+E+HGGSPWG GTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLTHHGMTFVPLGYRSPLLFNMEEVHGGSPWGTGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFANVAKKLS  199

>PPTG_09275
Length=200

 Score = 325 bits (832),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 180/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGHIA++AE+ K GVE+VDGVTAEIYQV+ETLS+EILGKMHAAPKKDHP
Sbjct  1    MAKIAIIYYSTYGHIAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT D LK ADG+L G PTRFGS+PAQVKALFD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATVDTLKEADGILFGFPTRFGSLPAQVKALFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+TFVPLGYR+P LFNMDEIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA VAKKL+
Sbjct  181  LTVATTQGKSFAEVAKKLA  199

>PITG_13763
Length=200

 Score = 322 bits (826),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 179/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGHIA++AE+ K GVE+VDGVTAEIYQV+ETLS+EILGKMHAAPKKDHP
Sbjct  1    MATIAIIYYSTYGHIAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT D LK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATLDTLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+TFVPLGYR+P LFNMDE+HGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA VAKKL+
Sbjct  181  LTVATTQGKSFAEVAKKLA  199

>PITG_13761
Length=200

 Score = 322 bits (824),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 179/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGH+A++AE+ K GVE+VDGVTAEIYQV+ETLS+EILGKMHAAPKKDHP
Sbjct  1    MAKIAIIYYSTYGHVAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT D LK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATLDTLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFL HQG+TFVPLGYR+P LFNMDE+HGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTAVTFLAHQGLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA VAKKL+
Sbjct  181  LTVATTQGKSFAEVAKKLA  199

>PYU1_G005990
Length=200

 Score = 320 bits (820),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 179/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGHIAKMAESVK GVE+V+GVTAEIYQ+ ETL EE+L K+HAAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQIAETLPEEVLAKLHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLK ADG+L G PTRFGS PAQVK+  D+ GGLW+ GALVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKSFLDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTTLTFL HQG+T+VPLG RSPLLFN +EIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGCRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFAQVAKKLS  199

>PYU1_G005991
Length=200

 Score = 320 bits (820),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 179/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGHIAKMAE +K GVE V GV+AEIYQV ETLS+E+L KMHA PKKDHP
Sbjct  1    MTRIAIVYYSTYGHIAKMAEKIKEGVELVTGVSAEIYQVAETLSDEVLTKMHAVPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT DVLK ADG+L GIPTRFGSMPAQVKALFD+ GGLW  GAL+GKPAGIFFSTGT GG
Sbjct  61   IATADVLKEADGILFGIPTRFGSMPAQVKALFDSTGGLWGTGALIGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT++TFLTHQG+TFVPLGYR+PL+F+MDEIHGGSPWGAGT AG DGSRQP+ LE
Sbjct  121  GQETTAFTSITFLTHQGLTFVPLGYRTPLMFSMDEIHGGSPWGAGTYAGPDGSRQPTDLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            + VAKVQGESFA VAKKLS
Sbjct  181  MTVAKVQGESFAEVAKKLS  199

>PYIR_14437
Length=200

 Score = 319 bits (817),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 179/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYSTYGHIA +AE VK GVE+V+GVTA IYQV+ETL E +L  +HAAPKKDHP
Sbjct  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLK ADGVL G PTRFGS+P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG  G 
Sbjct  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT+LTFL HQGMT+VPLGYRSPLLFN +EIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA +AKKL+
Sbjct  181  LDVAKVQGESFAQIAKKLA  199

>PHYKE_4827
Length=200

 Score = 317 bits (811),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 175/199 (88%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYSTYGHIA +A SVKAGVE+V GV A +YQV+ETLSEEIL KMHA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATLANSVKAGVESVPGVKANVYQVQETLSEEILTKMHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VAT + LK AD +L G PTRFGS PAQVKALFD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATAETLKEADAILFGFPTRFGSFPAQVKALFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+T+VPLGYR+P LFNMDEIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTYVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA VAKKLS
Sbjct  181  LTVATTQGKSFAEVAKKLS  199

>PHYSO_503540
Length=200

 Score = 316 bits (810),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 175/199 (88%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGHIAK+AES K G E+V+GVTAEIYQ++ETL EE+L KMHA PKKDHP
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VAT DVLK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+TFVPLGYR+P LFNMDEIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA VAKKL+
Sbjct  181  LTVATTQGKSFAEVAKKLA  199

>PHYSO_285976
Length=200

 Score = 316 bits (809),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 175/199 (88%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGHIAK+AES K G E+V+GVTAEIYQ++ETL EE+L KMHA PKKDHP
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VAT DVLK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+TFVPLGYR+P LFNMDEIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  181  LTVATTQGKSFAEIAKKLA  199

>PHYSO_500108
Length=200

 Score = 316 bits (809),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 175/199 (88%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGHIAK+AES K G E+V+GVTAEIYQ++ETL EE+L KMHA PKKDHP
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VAT DVLK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+TFVPLGYR+P LFNMDEIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  181  LTVATTQGKSFAEIAKKLA  199

>PHYRA_96097
Length=200

 Score = 313 bits (803),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 176/199 (88%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGH+AK+AE+ K G+E+VDGVTAEIYQV ETL EE+L ++HAAPKKDHP
Sbjct  1    MAKIAIIYYSTYGHVAKLAEAAKEGIESVDGVTAEIYQVAETLPEELLTQIHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT DVLK ADG+L G PTRFGS+P+QVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATVDVLKEADGILFGFPTRFGSLPSQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+TFVPLGYR+P LFNMDEIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA VAKKL+
Sbjct  181  LTVATTQGKSFAEVAKKLA  199

>PYIW_16204
Length=200

 Score = 313 bits (802),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 173/199 (87%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  +AI+YYSTYGHIAKMAE VK GVE+V+GVTAEIYQ+ ETL EE+L  MHA PKKDHP
Sbjct  1    MAKVAIVYYSTYGHIAKMAEQVKEGVESVEGVTAEIYQISETLPEEVLAMMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPD LK ADG+L G PTRFGS PAQVKALFD+ GGLW  G LVGKPAG+FFSTGT GG
Sbjct  61   IATPDALKEADGILFGFPTRFGSFPAQVKALFDSTGGLWQTGGLVGKPAGVFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTTLTF  HQG+T+VPLGYRSPLLF+ DEIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFFAHQGLTYVPLGYRSPLLFSFDEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA V KKL+
Sbjct  181  LDVAKVQGESFAQVTKKLA  199

>PYAP_21524
Length=200

 Score = 312 bits (799),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 175/199 (88%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGHI ++AES+K GVE V+GV A IYQV ETL E+IL  +HA PKKD+P
Sbjct  1    MTKIAIIYYSTYGHIVQLAESIKEGVEKVEGVEATIYQVPETLPEDILSAIHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATP+ LK ADG+L G PTRFG+MP+Q+KA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGTMPSQIKAFFDSTGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL H GMT+VPLGYRSPLLFNM+E+HGGS WG GTLAGADGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHHGMTYVPLGYRSPLLFNMEEVHGGSAWGTGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFANVAKKLS  199

>PYU1_G005987
Length=200

 Score = 308 bits (790),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 174/199 (87%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGH+ ++A  +K GV +V+GVTAE+YQV ETL EE+L KMHA PKKDHP
Sbjct  1    MTKIAIVYYSTYGHVVQLANVIKEGVGSVEGVTAELYQVAETLPEEVLAKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLK ADG+L G+PTRFGS PAQ+KA FD+ GGLW  GALVGKPAG+FF+TG  GG
Sbjct  61   IATPDVLKEADGILFGLPTRFGSFPAQIKAFFDSTGGLWQVGALVGKPAGVFFTTGVQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA+T LTFL+  GMT+VPLGYRSPLLFN +EIHGGSPWGAGT AG+DGSRQPSKLE
Sbjct  121  GQETTAYTALTFLSQHGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGSDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFAQVAKKLS  199

>PHYCA_118176
Length=200

 Score = 307 bits (786),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 173/199 (87%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGH+AK+AE+ K G+E+V GVTAEIYQV ETL EE+L  +HAAPKKDHP
Sbjct  1    MAKIAIIYYSTYGHVAKLAEAAKEGIESVAGVTAEIYQVAETLPEELLTAIHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT DVLK ADG+L G PTRFGS+P+QVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATVDVLKEADGILFGFPTRFGSLPSQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+TFVPLGYR+P LFNMDEIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG++FA V KKL+
Sbjct  181  LTVATTQGKTFAEVTKKLA  199

>PHYSO_285972
Length=200

 Score = 305 bits (780),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 173/199 (87%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAI+YYS Y HI+ MAE+VK GVE+VDGVTAEIYQV ETL EE+L  +HAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGVESVDGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLK ADG+L G PTRFGS+P+Q+KA FD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQG+TFVPLGYR+P L NM+EIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  181  LTVATTQGKSFAEIAKKLA  199

>PPTG_20266
Length=213

 Score = 303 bits (776),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 176/199 (88%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAI+YYSTY H++ MAE++K G+E+V+GVTAEIYQV ETL EE+L ++HAAPKKD+P
Sbjct  14   MAKIAIVYYSTYNHVSTMAETIKKGIESVEGVTAEIYQVAETLPEELLAQIHAAPKKDYP  73

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPD LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWA GALVGKPAGIFFSTGT GG
Sbjct  74   IATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWATGALVGKPAGIFFSTGTQGG  133

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFTTLTFLTHQGMT+VPLGYR+  L NMDEIHGGSPWG+GTLAG DGSRQPSKLE
Sbjct  134  GQETTAFTTLTFLTHQGMTYVPLGYRASELSNMDEIHGGSPWGSGTLAGGDGSRQPSKLE  193

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  194  LAVATTQGKSFAEIAKKLA  212

>PHYRA_71949
Length=200

 Score = 300 bits (769),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 172/199 (86%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAI+YYS Y HI+ MAE+VKAGVE+V+GVTAEIYQV ETL EE+L  +HAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKAGVESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATP+ LK ADG+L G PTRFGS+PAQ+KA FD+CGGLWA GAL GKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPAQMKAFFDSCGGLWATGALTGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFLTHQGMT+VPLGYR+P L NM+EIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLTHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  181  LTVATTQGKSFAEIAKKLA  199

>PITG_13762
Length=200

 Score = 300 bits (769),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAI+YYSTY H++ +AE++K GVE+VDGVTAEIYQV ETL EE+L ++HAAPKKD+P
Sbjct  1    MAKIAIVYYSTYNHVSTLAETIKEGVESVDGVTAEIYQVAETLPEELLTQIHAAPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPD LK ADG+L G PTRFGS+P+Q+KA FD+CGGLW AGALVGKPAGIFFSTGT GG
Sbjct  61   IATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWGAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA TTLTFL HQG+T+VPLGYR+P L NM+EIHGGS WGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTALTTLTFLAHQGLTYVPLGYRAPELANMEEIHGGSAWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  181  LSVATTQGKSFAEIAKKLA  199

>PHYCA_512169
Length=200

 Score = 300 bits (767),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 172/199 (86%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAI+YYS Y HI+ MAE+VK G+E+V+GVTAEIYQV ETL EE+L  +HAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGIESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATP+ LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQGMT+VPLGYR+P L NM+EIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  181  LTVATTQGKSFAEIAKKLA  199

>PHYCA_508491
Length=200

 Score = 300 bits (767),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 172/199 (86%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAI+YYS Y HI+ MAE+VK G+E+V+GVTAEIYQV ETL EE+L  +HAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGIESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATP+ LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQGMT+VPLGYR+P L NM+EIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  181  LTVATTQGKSFAEIAKKLA  199

>PHYRA_71950
Length=200

 Score = 299 bits (765),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 171/199 (86%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAI+YYS Y HI+ MAE VKAGVE+V+GVTAEIYQV ETL EE+L  +HAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAEIVKAGVESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATP+ LK ADG+L G PTRFGS+PAQ+KA FD+CGGLWA GAL GKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPAQMKAFFDSCGGLWATGALTGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFLTHQGMT+VPLGYR+P L NM+EIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLTHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  181  LTVATTQGKSFAEIAKKLA  199

>PYAP_24529
Length=199

 Score = 295 bits (756),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 168/199 (84%), Gaps = 1/199 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IA+IY+STYGHI KMAE++K G+E  DG    +YQV ETL EE+L KMHA PKKDHP
Sbjct  1    MTKIAVIYFSTYGHIVKMAEAIKEGIEKADGTQVTLYQVAETLPEEVLTKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VA  D LK+AD +L G PTRFG+ P+QVKA FD+ G  WA GALVGKPAGIFFSTGT GG
Sbjct  61   VANLDTLKDADAILFGFPTRFGTFPSQVKAFFDSTGSFWATGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFLTH GMT+VPLGYRSPL+FN+ E+HGGSPWGAGTLAG DGSRQPS+LE
Sbjct  121  GQETTAFTALTFLTHHGMTYVPLGYRSPLVFNL-EVHGGSPWGAGTLAGKDGSRQPSELE  179

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  180  LDVAKVQGESFAMVAKKLS  198

>PHYRA_71996
Length=200

 Score = 293 bits (749),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYS YGH+AK+A S+KAGV +V GV A +YQV+ETLS+++   +HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVQASVYQVQETLSDDLRKVLHAPPKSDLP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPDVLKNADG+LLG PTRFG +PAQVK LFDACGGLWA GAL+GKP G+FFSTG+ GG
Sbjct  61   VATPDVLKNADGILLGFPTRFGMLPAQVKGLFDACGGLWANGALIGKPCGVFFSTGSLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA +   F+ H GMTFVPLGYRSPL+   +E+HGGSPWGAGTLA  DGSRQP++LE
Sbjct  121  GQETTAMSMTPFMAHHGMTFVPLGYRSPLIGTNEEVHGGSPWGAGTLANGDGSRQPTELE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L++AK+QG+SFA + KKLS
Sbjct  181  LEIAKIQGQSFAEITKKLS  199

>PHALS_11795
Length=183

 Score = 291 bits (746),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 166/182 (91%), Gaps = 0/182 (0%)

Query  18   MAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVATPDVLKNADGVLLGI  77
            MAESVK+GVE+VDGVTAEIYQVEETLS+E L KMHA  KKDHP+ATPDVLK A+G+L GI
Sbjct  1    MAESVKSGVESVDGVTAEIYQVEETLSDETLSKMHAPSKKDHPIATPDVLKEANGILFGI  60

Query  78   PTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQEttafttltfltHQG  137
            PTRFG +PAQVKALFDACGGLWAAGALVGKPAGIFFSTGT GGGQETTAFTTLTFLTHQG
Sbjct  61   PTRFGLVPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTMGGGQETTAFTTLTFLTHQG  120

Query  138  MTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGESFAGVAKK  197
            MTFVPLGYRS  L NMDEIHGGSPWGAGT AG  G+RQP++LELDVAK QGESFA VAKK
Sbjct  121  MTFVPLGYRSKHLLNMDEIHGGSPWGAGTFAGPSGARQPTQLELDVAKAQGESFAVVAKK  180

Query  198  LS  199
            LS
Sbjct  181  LS  182

>PHYKE_1631
Length=200

 Score = 292 bits (748),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 169/199 (85%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYS YGH+AK+A S+K GV +V GV A +YQ++ETL++++L  +HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKTGVTSVPGVKASVYQIQETLNDDLLKALHAPPKSDLP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLKNADG+LLG PTRFG +P+QVK LFDACGGLWA G L+GKP GIFFSTG+ GG
Sbjct  61   IATPDVLKNADGILLGFPTRFGMLPSQVKGLFDACGGLWANGGLIGKPCGIFFSTGSLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA +   F+ H GMTFVPLGYR+PL+ + +EIHGGSPWGAGTLA ADGSRQP+ LE
Sbjct  121  GQETTAMSMTPFIAHHGMTFVPLGYRTPLIGSNEEIHGGSPWGAGTLANADGSRQPTPLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L++AK+QG+SFA VAKKLS
Sbjct  181  LEIAKIQGQSFAEVAKKLS  199

>PHYCA_553014
Length=200

 Score = 292 bits (747),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 168/198 (85%), Gaps = 0/198 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M N+AIIYYS YGH+AK+A S+KAGV +V GV A +YQV+ETL++E+L K+HA PK D P
Sbjct  1    MANVAIIYYSMYGHVAKLASSIKAGVTSVPGVKASVYQVQETLNDELLQKLHAPPKPDLP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLKNADG+LLG PTRFG +PAQVK LFDACGGLWA G L+GKP G+FFSTG+ GG
Sbjct  61   IATPDVLKNADGILLGFPTRFGMLPAQVKGLFDACGGLWAKGDLIGKPCGVFFSTGSLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA +   F+ H GM FVPLGYRSPL+ + DE+HGGSPWGAGTLA  DGSRQP++LE
Sbjct  121  GQETTAMSMTPFIAHHGMNFVPLGYRSPLVGSNDEVHGGSPWGAGTLANGDGSRQPTELE  180

Query  181  LDVAKVQGESFAGVAKKL  198
            L++AK+QG+SFA +AKKL
Sbjct  181  LEIAKIQGQSFAEIAKKL  198

>CCA15845
Length=200

 Score = 291 bits (745),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 169/199 (85%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGH+A++AE+VK G E V GVTAEIYQV ETLS+++L KMHA PKK+HP
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVTAEIYQVAETLSDDVLAKMHAPPKKEHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +A+ DVLK+ADG+L G+PTRFG +PAQ+KA FD  G LW  G  +GKPAG+FFST TPGG
Sbjct  61   IASMDVLKDADGILFGMPTRFGLVPAQMKAYFDMAGQLWQNGCTIGKPAGVFFSTATPGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT L FLTH GM FVPLGYRSPLL N+DE+HGGS WGAGTLAGADGSRQ SKLE
Sbjct  121  GQETTAFTCLPFLTHLGMVFVPLGYRSPLLSNLDEVHGGSAWGAGTLAGADGSRQASKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L+VAKVQGESFA V +KL+
Sbjct  181  LEVAKVQGESFASVTRKLA  199

>CCA27411
Length=200

 Score = 291 bits (745),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 169/199 (85%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGH+A++AE+VK G E V GVTAEIYQV ETLS+++L KMHA PKK+HP
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVTAEIYQVAETLSDDVLAKMHAPPKKEHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +A+ DVLK+ADG+L G+PTRFG +PAQ+KA FD  G LW  G  +GKPAG+FFST TPGG
Sbjct  61   IASMDVLKDADGILFGMPTRFGLVPAQMKAYFDMAGQLWQNGCTIGKPAGVFFSTATPGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT L FLTH GM FVPLGYRSPLL N+DE+HGGS WGAGTLAGADGSRQ SKLE
Sbjct  121  GQETTAFTCLPFLTHLGMVFVPLGYRSPLLSNLDEVHGGSAWGAGTLAGADGSRQASKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L+VAKVQGESFA V +KL+
Sbjct  181  LEVAKVQGESFASVTRKLA  199

>PPTG_03020
Length=200

 Score = 291 bits (744),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYS YGH+AK+A S+KAGV +V GV A +YQ++ETL++++L K+HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVKASVYQIQETLNDDLLKKLHAPPKPDLP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPDVLKNADG+LLG PTRFG +P QVK LFDACGGLW  G L+GKP GIFFS+ + GG
Sbjct  61   VATPDVLKNADGILLGFPTRFGMLPTQVKGLFDACGGLWVNGGLIGKPCGIFFSSASLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA +   F+ HQGMTFVPLGYRSPL+   +EIHGGSPWGAGTLA +DGSRQP+ LE
Sbjct  121  GQETTAMSMTPFIAHQGMTFVPLGYRSPLVGTNEEIHGGSPWGAGTLANSDGSRQPTDLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L++AK+QG+SFA + KKLS
Sbjct  181  LEIAKIQGQSFAEITKKLS  199

>CCI42280
Length=200

 Score = 290 bits (741),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 170/199 (85%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAIIYYSTYGH+A++AE+VK G E V GV+A+IYQV ETL++++L KMHA PKK++P
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVSADIYQVAETLTDDVLSKMHAPPKKEYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT DVLK+ADG+L G PTRFG +PAQ+KA FD  G LW +G  +GKPAG+FFSTGTPGG
Sbjct  61   IATMDVLKDADGILFGFPTRFGLVPAQMKAYFDMAGQLWQSGCTIGKPAGLFFSTGTPGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT + FLTH GM FVPLGYRSPLL N+DE+HGGS WGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTCIPFLTHLGMVFVPLGYRSPLLGNLDEVHGGSAWGAGTLAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            LDVAKVQGESFA V +KL+
Sbjct  181  LDVAKVQGESFAAVTRKLA  199

>PHYSO_285975
Length=200

 Score = 288 bits (738),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYSTYGHIA +AESVKAGVE+V GV A +YQV ETLSEEIL KMHA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATLAESVKAGVESVSGVKATVYQVAETLSEEILTKMHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATP+ LK AD +L G PTRFG+ PAQVKALFD+CGGLWA GAL+GKPAGIFFSTGT GG
Sbjct  61   VATPETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGALIGKPAGIFFSTGTLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETT+FT +TFLTHQGMTFVPLG+R+P +FN++E+HGGSPWGAG +AG DGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLTHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
              +A  QG+SFA +AKKLS
Sbjct  181  KAIATTQGKSFAEIAKKLS  199

>PHYSO_285974
Length=200

 Score = 288 bits (738),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYSTYGHIA +AESVKAGVE+V GV A +YQV ETLSEEIL KMHA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATLAESVKAGVESVSGVKATVYQVAETLSEEILTKMHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATP+ LK AD +L G PTRFG+ PAQVKALFD+CGGLWA GAL+GKPAGIFFSTGT GG
Sbjct  61   VATPETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGALIGKPAGIFFSTGTLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETT+FT +TFLTHQGMTFVPLG+R+P +FN++E+HGGSPWGAG +AG DGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLTHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
              +A  QG+SFA +AKKLS
Sbjct  181  KAIATTQGKSFAEIAKKLS  199

>PYVX_14995
Length=200

 Score = 288 bits (737),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 164/199 (82%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYS YGH+A +AES+K GVE V+GVTA IYQV ETL E IL  +HAAPKKDHP
Sbjct  1    MTKIAIVYYSCYGHVATLAESIKEGVEKVEGVTATIYQVPETLPESILTAIHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT D LK ADG+L G PTRFGS P+Q+KA FD CGGLWA GAL+GK AGIFFSTGT GG
Sbjct  61   IATVDTLKEADGILFGFPTRFGSAPSQIKAFFDGCGGLWATGALIGKTAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQE TAF+TL F  HQG+T+VPLGYR+  L NM+EIHGGS WGAG+ AG+DGSR PSKLE
Sbjct  121  GQEVTAFSTLPFFAHQGLTYVPLGYRTQNLANMEEIHGGSAWGAGSFAGSDGSRLPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L++A VQGESFA V KKLS
Sbjct  181  LEIAVVQGESFAQVTKKLS  199

>PYAP_24530
Length=258

 Score = 290 bits (742),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 168/193 (87%), Gaps = 1/193 (1%)

Query  6    IIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVATPD  65
            I+YYSTYGHI  +AE+VK GV+ VD V A IYQV+ETL  ++L KMHA PKKD+P+ATP+
Sbjct  67   IVYYSTYGHIVHLAEAVKRGVDKVD-VEATIYQVQETLPADVLEKMHAPPKKDYPIATPE  125

Query  66   VLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQEtt  125
             L  AD +L GIPTRFGS P+Q+KALFD+ GGLWA GALVGKPAG+FFSTGTPGGGQETT
Sbjct  126  TLAEADAILFGIPTRFGSFPSQMKALFDSTGGLWAKGALVGKPAGLFFSTGTPGGGQETT  185

Query  126  afttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAK  185
            A+TT+TFL H G+ +VPLGYRSPLLFNM+E+HGGSPWG GT+AG DGSRQPSKLELDVA+
Sbjct  186  AYTTVTFLAHHGLIYVPLGYRSPLLFNMEEVHGGSPWGTGTIAGPDGSRQPSKLELDVAE  245

Query  186  VQGESFAGVAKKL  198
            VQGESFA VAKKL
Sbjct  246  VQGESFANVAKKL  258

>PPTG_17005
Length=200

 Score = 287 bits (735),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 165/199 (83%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGH+AK+A + K G+E+V GVTA IYQV+ETL EE+L KMHA PK DHP
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIESVGGVTATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT D LK ADG+L G P RFGSMPAQVKA FD+CG LWA GALVGK  G+FFSTGT GG
Sbjct  61   IATIDTLKEADGILFGFPCRFGSMPAQVKAFFDSCGSLWATGALVGKTGGLFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFL HQG+T+VPLGYR   L NMDE+HGGSPWGAGTLA +DGSRQPS+LE
Sbjct  121  GQETTAFTAVTFLAHQGLTYVPLGYRGKELLNMDEMHGGSPWGAGTLAKSDGSRQPSELE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LALATTQGKSFAEVTKKLA  199

>PPTG_17006
Length=200

 Score = 287 bits (734),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 165/199 (83%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGH+AK+A + K G+E+V GVTA IYQV+ETL EE+L KMHA PK DHP
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIESVGGVTATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT D LK ADG+L G P RFGSMPAQVKA FD+CG LWA GALVGK  G+FFSTGT GG
Sbjct  61   IATIDTLKEADGILFGFPCRFGSMPAQVKAFFDSCGSLWATGALVGKTGGLFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFL HQG+T++PLGYR   L NMDE+HGGSPWGAGTLA +DGSRQPS+LE
Sbjct  121  GQETTAFTAVTFLAHQGLTYIPLGYRGKELLNMDEMHGGSPWGAGTLAKSDGSRQPSELE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LALATTQGKSFAEVTKKLA  199

>PHYRA_81696
Length=200

 Score = 285 bits (729),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 172/199 (86%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYSTYGHI+ +AESVKAGVE+V GVTA +YQV ETLSEEIL KMHAAPKKD P
Sbjct  1    MTNVAIIYYSTYGHISTLAESVKAGVESVPGVTATVYQVAETLSEEILTKMHAAPKKDLP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VAT + LK AD +L G PTRFG+ PAQVKALFD+CGGLWA G LVGKPAGIFFSTGT GG
Sbjct  61   VATAETLKQADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGELVGKPAGIFFSTGTLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETT+FT +TFL HQGMTFVPLG+R+P +FN++E+HGGSPWGAG +AG DGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLAHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
              +A  QG+SFA +AKKLS
Sbjct  181  KAIATTQGKSFAEIAKKLS  199

>PYU1_G001466
Length=202

 Score = 284 bits (727),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 170/200 (85%), Gaps = 1/200 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPK-KDH  59
            MT IAI+YYS YGH+ K+A ++KAG + V GV A++YQV+ETL +E+L ++ AAPK +DH
Sbjct  1    MTKIAIVYYSMYGHVGKLASAIKAGAKKVPGVDAQLYQVQETLPQELLTRIGAAPKPQDH  60

Query  60   PVATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPG  119
             VATPD LK+ADG+LLG+PTRFG +P+Q+KAL DACGGLW  G L+GKP G+FFSTGT G
Sbjct  61   AVATPDTLKDADGILLGLPTRFGMLPSQMKALMDACGGLWVGGGLIGKPCGLFFSTGTLG  120

Query  120  GGQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKL  179
            GGQETTA  T  FLTH GMTFVPLGYR+PLL N+DEIHGGSPWGAGT+AGADGSRQPS L
Sbjct  121  GGQETTAMATTPFLTHHGMTFVPLGYRTPLLSNLDEIHGGSPWGAGTIAGADGSRQPSDL  180

Query  180  ELDVAKVQGESFAGVAKKLS  199
            EL++A+VQGESFA + KK++
Sbjct  181  ELEIARVQGESFAEITKKMT  200

>PHYCA_132728
Length=200

 Score = 283 bits (723),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 165/199 (83%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGH+AK+A++ K G+E+V GVTA IYQV+ETL EE+L KMHA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT + L+ ADG+L G P RFG+MPAQ+KA FD+CG LWA GAL GK  G+FFSTGT GG
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFL HQG+T+VPLGYRS  L NMDE+HGGSPWGAGT +  DGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LGLATTQGQSFAEVTKKLT  199

>PHYCA_124158
Length=200

 Score = 283 bits (723),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 165/199 (83%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGH+AK+A++ K G+E+V GVTA IYQV+ETL EE+L KMHA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT + L+ ADG+L G P RFG+MPAQ+KA FD+CG LWA GAL GK  G+FFSTGT GG
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFL HQG+T+VPLGYRS  L NMDE+HGGSPWGAGT +  DGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LGLATTQGQSFAEVTKKLT  199

>PHYCA_19840
Length=200

 Score = 283 bits (723),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 165/199 (83%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGH+AK+A++ K G+E+V GVTA IYQV+ETL EE+L KMHA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT + L+ ADG+L G P RFG+MPAQ+KA FD+CG LWA GAL GK  G+FFSTGT GG
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFL HQG+T+VPLGYRS  L NMDE+HGGSPWGAGT +  DGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LGLATTQGQSFAEVTKKLT  199

>PHYCA_118207
Length=200

 Score = 282 bits (721),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 171/199 (86%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYSTYGHIA + +S+KAGVE+V GVTA +YQV ETLSEEIL KMHA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATLVDSIKAGVESVPGVTATVYQVAETLSEEILSKMHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VAT + LK AD +L G PTRFG+ PAQVKALFD+CGGLWA G LVGKPAGIFFSTGT GG
Sbjct  61   VATAETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGELVGKPAGIFFSTGTLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETT+FT +TFL HQGMTFVPLG+R+P +FN++E+HGGSPWGAG +AG DGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLAHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
              +A  QG+SFA +AKKLS
Sbjct  181  KAIATTQGKSFAEIAKKLS  199

>PHYCA_132729
Length=200

 Score = 281 bits (719),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 164/199 (82%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAIIYYSTYGH+AK+A++ K G+E+V GVTA IYQV+ETL EE+L KMHA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT + L+ ADG+L G P RFG+MPAQ+K  FD+CG LWA GAL GK  G+FFSTGT GG
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKVFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT +TFL HQG+T+VPLGYRS  L NMDE+HGGSPWGAGT +  DGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LGLATTQGQSFAEVTKKLT  199

>PYIW_26610
Length=200

 Score = 281 bits (718),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  +AI+YYSTYGHIA MAE VK GV++V+GVT +IYQV ETL +++L KMH  PKKD+P
Sbjct  1    MVKVAIVYYSTYGHIAAMAEKVKEGVDSVEGVTGKIYQVAETLPQDVLSKMHTPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATP+VLK ADG+L G+PTRFGS PAQ+K LFDA GGLW  G LVGKP G+FFST    G
Sbjct  61   IATPEVLKEADGILFGMPTRFGSFPAQMKTLFDATGGLWQTGGLVGKPIGVFFSTAAQNG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTF  H G+T+VPLG+RS LL +  EIHGGSPWG GTLAG DGSRQPS+LE
Sbjct  121  GQETTAFTALTFFAHHGLTYVPLGFRSRLLLDFKEIHGGSPWGVGTLAGIDGSRQPSQLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
             DVAKVQGESFA +AKKL+
Sbjct  181  PDVAKVQGESFAQIAKKLA  199

>PYVX_13848
Length=200

 Score = 278 bits (710),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 164/199 (82%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYS YGH+AK+A S+KAGV +V GV A +YQV ETL E++L  +HA PK D P
Sbjct  1    MTKIAIVYYSMYGHVAKLAASIKAGVTSVPGVQASLYQVSETLPEDLLKALHAPPKPDMP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATP  LK+ADG+LLG PTRFG +P+QVK LFDACGGLWA GAL GK  GIFFST + GG
Sbjct  61   IATPQTLKDADGILLGFPTRFGMLPSQVKGLFDACGGLWANGALTGKTCGIFFSTASIGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA TT  F+ HQGMTFVPLGYRSPL+ + +E+HGGSPWGAGT+A +DGSRQP+ +E
Sbjct  121  GQETTAMTTTPFIAHQGMTFVPLGYRSPLIGSNEELHGGSPWGAGTIANSDGSRQPTDIE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L++A+VQG+SFA + KKLS
Sbjct  181  LEIARVQGQSFAEITKKLS  199

>PYAP_25149
Length=200

 Score = 277 bits (708),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 167/199 (84%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAII+YSTYGH+AK+AE++K GV+ V G +A IYQV ETL EE+L  +HA PK D+P
Sbjct  1    MTKIAIIHYSTYGHVAKLAEALKQGVKNVPGASATIYQVPETLPEEVLKMIHAPPKPDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
             AT D LK+ADG+L G PTRFGSMP+Q+K+  D+ GGLWA GALVGKPAGIFFSTGT GG
Sbjct  61   FATVDTLKDADGILFGFPTRFGSMPSQMKSYLDSTGGLWAKGALVGKPAGIFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAF+TL FL H GMT+VPLGYR+P   NM+EIHGGS WG GT AG+DG+RQPSKLE
Sbjct  121  GQETTAFSTLPFLAHHGMTYVPLGYRAPQQANMEEIHGGSAWGVGTFAGSDGARQPSKLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L++A+VQGESFA +AKKLS
Sbjct  181  LEIAEVQGESFAQIAKKLS  199

>PPTG_00540
Length=201

 Score = 263 bits (672),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 151/197 (77%), Gaps = 0/197 (0%)

Query  3    NIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVA  62
            N+AIIYYS YGH   +AE+VK GV++V GV A IYQV ETLSEEIL KMHA PK+D+PVA
Sbjct  4    NVAIIYYSIYGHAVTLAEAVKEGVDSVQGVKATIYQVPETLSEEILTKMHAPPKRDYPVA  63

Query  63   TPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQ  122
            TP  LK ADG+L G PTRFG  PAQ K LFDA G LWAAG L+GKP G F ST   G GQ
Sbjct  64   TPQTLKEADGILFGYPTRFGDFPAQAKNLFDATGQLWAAGDLIGKPGGCFVSTSLMGAGQ  123

Query  123  EttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELD  182
            ETT   T+ F+T  GMTFVPLGYR+  LFN+DE+HGGSPWGAGT+AG D SRQ SKLE D
Sbjct  124  ETTQLMTMAFMTSHGMTFVPLGYRAKQLFNVDEVHGGSPWGAGTIAGPDNSRQVSKLEKD  183

Query  183  VAKVQGESFAGVAKKLS  199
            +A  QG+SFA V KKLS
Sbjct  184  IAMEQGKSFAEVTKKLS  200

>PHYRA_71993
Length=201

 Score = 259 bits (661),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 154/197 (78%), Gaps = 0/197 (0%)

Query  3    NIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVA  62
            N+A+IYYS YGH A +AES+K GV++V GV A IYQV ETLS+EIL KMHA PK+D+P+A
Sbjct  4    NVAVIYYSIYGHAATLAESIKEGVDSVPGVKATIYQVPETLSDEILTKMHAPPKRDYPIA  63

Query  63   TPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQ  122
            +P+ LK ADG+LLG PTRFG  PAQ K+LFDA G LWAAGAL+GKP G F ST   G GQ
Sbjct  64   SPETLKEADGILLGYPTRFGDFPAQAKSLFDATGQLWAAGALIGKPGGAFVSTSLMGAGQ  123

Query  123  EttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELD  182
            ETT   T+ F+   GMTFVPLGYR+  LF++DE+HGGSPWGAG +AG D SRQ SKLE +
Sbjct  124  ETTQLMTMAFMVSHGMTFVPLGYRAKQLFDVDEVHGGSPWGAGAIAGPDNSRQVSKLEKE  183

Query  183  VAKVQGESFAGVAKKLS  199
            +A  QG+SFA V KKLS
Sbjct  184  IAMEQGKSFAEVTKKLS  200

>PYAR_19739
Length=204

 Score = 258 bits (660),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 155/199 (78%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGHI  +AE++K GV+ V GV A IYQ++ TL  +    + A PK ++P
Sbjct  1    MTKIAIVYYSTYGHIVPLAEAIKQGVDQVVGVDASIYQIQPTLRGDAHASIRAPPKTEYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
              TP +L  ADG+L G PTRFG+ PAQVKA FD+CG LW    L GKPAG FFSTGT GG
Sbjct  61   TITPAILAAADGILFGFPTRFGAFPAQVKAFFDSCGSLWPQRVLEGKPAGFFFSTGTLGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETT  T+LTFL HQGM FVPLGYR+P LFN+DE+HGGSPWG GT+AGA+G+RQP+ LE
Sbjct  121  GQETTPMTSLTFLAHQGMLFVPLGYRTPHLFNLDEVHGGSPWGTGTIAGANGARQPTDLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L++A+VQG SFA +AKKL+
Sbjct  181  LEIARVQGSSFAEIAKKLA  199

>PHYCA_553010
Length=200

 Score = 257 bits (657),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 157/199 (79%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI++YST+GH+ KMA +++AG+++V  V AE+YQV+ETL+E++L K+HA PK D P
Sbjct  1    MTKIAIVFYSTFGHVTKMAAAIQAGIQSVPNVEAELYQVKETLNEQVLAKLHAPPKLDFP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATPDVLKNADG++LG PT FG +PAQ+KALFD+CG LW  G L+GKP G+FFS G+ GG
Sbjct  61   VATPDVLKNADGIMLGFPTHFGMVPAQMKALFDSCGALWMKGELIGKPCGVFFSCGSRGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQE +A +T  ++ H GM FVPL  R  ++   DE+HG S WG+GT+AG+D SRQPS LE
Sbjct  121  GQEVSAMSTTPYIAHLGMLFVPLALRGNVIEATDELHGCSLWGSGTVAGSDRSRQPSDLE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA++QGE FA + KKLS
Sbjct  181  LKVAQMQGEKFAEITKKLS  199

>PYIR_25908
Length=199

 Score = 256 bits (654),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 160/199 (80%), Gaps = 1/199 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  +AI+YYS YGH+A +AE++KAG+E+V+GVTA IYQVEETL   +L KMHA PKKD+P
Sbjct  1    MAKVAIVYYSMYGHVATLAETIKAGIESVEGVTATIYQVEETLPAGVLEKMHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLK ADG+L G+PTRFG++PAQ+K LFDA GGLW +GAL+GKPAG+FFS  + GG
Sbjct  61   IATPDVLKEADGILFGMPTRFGTVPAQIKNLFDATGGLWQSGALIGKPAGVFFSCASQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            G ETTA  T+ FLTH GM ++PLG R+     +DE+ GG  WGAGT AG DGSRQPS+ E
Sbjct  121  GNETTALMTIPFLTHHGMLYIPLGTRAKKFGTLDEVVGGGKWGAGTYAG-DGSRQPSERE  179

Query  181  LDVAKVQGESFAGVAKKLS  199
            L +A+VQGESFA + KKL+
Sbjct  180  LGIARVQGESFAEITKKLA  198

>PYU1_G002524
Length=199

 Score = 253 bits (646),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 158/199 (79%), Gaps = 1/199 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  +AIIYYSTYGH+A +AE++K GVE+++GVTA IYQV ETL E +L KMHA PKK++P
Sbjct  1    MAKVAIIYYSTYGHVATLAETIKEGVESIEGVTATIYQVRETLPEGVLEKMHAPPKKEYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VAT DVLK ADG+L G+PTRFG++PAQ+KA FDA GGLW  GAL+GKPAG+FFS+ + GG
Sbjct  61   VATNDVLKEADGILFGMPTRFGAVPAQMKAFFDAAGGLWQEGALIGKPAGVFFSSASQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            G ETT   TL FLTH GM FVPLG R+     +DE+ GG  WGAGT AG DGSR+PS+ E
Sbjct  121  GNETTVLMTLPFLTHMGMLFVPLGTRAKKFGTLDEVVGGGKWGAGTYAG-DGSRKPSERE  179

Query  181  LDVAKVQGESFAGVAKKLS  199
            L +A+VQGESFA + KKL+
Sbjct  180  LGIARVQGESFAEITKKLA  198

>PHYSO_492858
Length=201

 Score = 251 bits (642),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 149/197 (76%), Gaps = 0/197 (0%)

Query  3    NIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVA  62
            N+AI+YYSTYGH A +AES+K GVEAV GVTA IYQ+ E LS+EIL KMHA   +D+PVA
Sbjct  4    NVAIVYYSTYGHTATLAESIKEGVEAVPGVTATIYQIAEALSDEILAKMHAPSNRDNPVA  63

Query  63   TPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQ  122
            TP  LK ADG+L+G PTRFG  P Q KAL DA G LW  GALVGKPAG FFST   G GQ
Sbjct  64   TPATLKEADGILVGFPTRFGVFPQQAKALIDATGQLWFGGALVGKPAGTFFSTSLLGAGQ  123

Query  123  EttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELD  182
            ETTA + +TF+   GMT+VPLGYR+  LFN++EIHGG PWGAG +AG    RQ SKLE D
Sbjct  124  ETTALSAVTFMVSHGMTYVPLGYRAKELFNVEEIHGGFPWGAGAIAGPQSDRQVSKLEKD  183

Query  183  VAKVQGESFAGVAKKLS  199
            +A  QG+SFA V KK+S
Sbjct  184  IAVTQGKSFAEVVKKMS  200

>PHYSO_491760
Length=201

 Score = 250 bits (639),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 149/197 (76%), Gaps = 0/197 (0%)

Query  3    NIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVA  62
            N+AI+YYSTYGH A +AES+K GVEAV GVTA IYQ+ E LS+EIL KMHA   +D+PVA
Sbjct  4    NVAIVYYSTYGHTATLAESIKEGVEAVPGVTATIYQIAEALSDEILAKMHAPSNRDNPVA  63

Query  63   TPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQ  122
            TP  LK ADG+L+G PTRFG  P Q KAL DA G LW  GALVGKPAG FFST   G GQ
Sbjct  64   TPATLKEADGILVGFPTRFGVFPQQAKALIDATGQLWFGGALVGKPAGTFFSTSLLGAGQ  123

Query  123  EttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELD  182
            ETTA + +TF+   GMT+VPLGYR+  LFN++EIHGG PWGAG +AG    RQ SKLE D
Sbjct  124  ETTALSAVTFMASHGMTYVPLGYRAKELFNVEEIHGGFPWGAGAIAGPQSDRQVSKLEKD  183

Query  183  VAKVQGESFAGVAKKLS  199
            +A  QG+SFA V KK++
Sbjct  184  IAVTQGKSFAEVVKKMT  200

>PHYKE_35
Length=160

 Score = 249 bits (635),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 0/159 (0%)

Query  41   ETLSEEILGKMHAAPKKDHPVATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWA  100
            ETLSEE+L  +HAAPKKDHP+ATPD LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWA
Sbjct  1    ETLSEELLTTIHAAPKKDHPIATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWA  60

Query  101  AGALVGKPAGIFFSTGTPGGGQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGS  160
            AGALVGKPAGIFFSTGT GGGQETTAFT LTFL HQG+T+VPLGYR+P L NMDEIHGGS
Sbjct  61   AGALVGKPAGIFFSTGTQGGGQETTAFTALTFLAHQGLTYVPLGYRAPELANMDEIHGGS  120

Query  161  PWGAGTLAGADGSRQPSKLELDVAKVQGESFAGVAKKLS  199
             WGAGTLAG DGSRQPSKLEL VA  QG+SFA VAKKL+
Sbjct  121  AWGAGTLAGGDGSRQPSKLELTVATTQGKSFAEVAKKLA  159

>PHYRA_72407
Length=199

 Score = 250 bits (638),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 153/198 (77%), Gaps = 1/198 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT +AII YS YGH+A +AE+VK+GVE+V+GV A I QV ETL + +L KMHA PKKD+P
Sbjct  1    MTKVAIIIYSMYGHVATLAETVKSGVESVEGVEATILQVPETLPDVVLEKMHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVL + DG+L G+PTRFG MPAQVKA FD CGGLWA GAL+GK  GIFFS G+ GG
Sbjct  61   IATPDVLTDFDGILWGMPTRFGMMPAQVKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            G ETTAF T  F  HQGMTFVPLG R+  L  +DE+ GG  WGAGT AGA G RQP++ E
Sbjct  121  GNETTAFNTAPFFAHQGMTFVPLGVRARHLHTLDEVVGGGKWGAGTYAGA-GDRQPTERE  179

Query  181  LDVAKVQGESFAGVAKKL  198
            L  AK+QGESFA + KKL
Sbjct  180  LGTAKIQGESFAEITKKL  197

>PYAP_21525
Length=191

 Score = 249 bits (636),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 155/190 (82%), Gaps = 0/190 (0%)

Query  10   STYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVATPDVLKN  69
            ST+GH+ ++A+++K GVE V G T  IYQV ETL E++L K+HAAPK+D P+ATP++L +
Sbjct  1    STHGHVVQLAKALKQGVEKVAGATGTIYQVPETLDEDVLAKVHAAPKEDFPIATPEILTD  60

Query  70   ADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQEttaftt  129
             DG+L G PTRFGS PAQ+K+ +DA GGLWA GAL GK AG+FFSTG  G GQE+TAFT 
Sbjct  61   FDGILFGFPTRFGSFPAQMKSFWDATGGLWARGALTGKTAGLFFSTGIQGDGQESTAFTA  120

Query  130  ltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGE  189
            LTFL + GMT+VPLGYRSP LFNM+EIHGGS WG GTLAGADG RQ +KLEL++A VQG+
Sbjct  121  LTFLANYGMTYVPLGYRSPHLFNMEEIHGGSCWGTGTLAGADGKRQATKLELEIADVQGQ  180

Query  190  SFAGVAKKLS  199
            SFA V KKL+
Sbjct  181  SFAEVTKKLA  190

>PHYCA_121985
Length=199

 Score = 248 bits (634),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 1/198 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT +AII YS YGH+A +AE+VK+GVE+V+GV A I QV+ETL E +L KMHA PK+D+P
Sbjct  1    MTKVAIIIYSMYGHVATLAETVKSGVESVEGVEATILQVQETLPELVLEKMHAPPKRDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPD+L   DG+L G+PTRFG MPAQ+KA FD CGGLWA GAL+GK  GIFFS G+ GG
Sbjct  61   IATPDMLTEYDGILWGMPTRFGMMPAQIKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            G ETTAF T  F  HQGMTFVPLG R+  L  +DE+ GG  WGAGT AG  G RQP++ E
Sbjct  121  GNETTAFNTAPFFAHQGMTFVPLGVRARHLHTLDEVIGGGKWGAGTYAGT-GDRQPTERE  179

Query  181  LDVAKVQGESFAGVAKKL  198
            L  AK+QGESFA + KKL
Sbjct  180  LGTAKIQGESFAEITKKL  197

>PHYKE_8238
Length=199

 Score = 248 bits (632),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 152/198 (77%), Gaps = 1/198 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT +AI+ YS YGH+A +AE++KAGVE+V+GVTA I QV+ETL E +L KMHA PKKD+P
Sbjct  1    MTKVAIVIYSMYGHVATLAETIKAGVESVEGVTATILQVQETLPELVLEKMHAPPKKDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            + TP+ L + DG+L G+PTRFG MPAQVKA FD CGGLWA GAL+GK  GIFFS G+ GG
Sbjct  61   IITPEQLTDFDGILWGMPTRFGMMPAQVKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            G E+TA  T TF  HQGMTFVPLG R+  L  +DE+ GG  WGAGT AG  G RQP++ E
Sbjct  121  GNESTAMNTATFFAHQGMTFVPLGVRARHLHTLDEVVGGGKWGAGTYAGT-GDRQPTERE  179

Query  181  LDVAKVQGESFAGVAKKL  198
            L  AK+QGESFA + KK+
Sbjct  180  LGTAKIQGESFAVITKKI  197

>PHYRA_82142
Length=200

 Score = 247 bits (631),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 155/199 (78%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT +AI++YST+GH+ K+A+S++AGV+AV GV AE+YQV+ETLSEE+L K+ A PK++  
Sbjct  1    MTKVAIVFYSTFGHVTKLAKSIQAGVQAVPGVEAELYQVKETLSEEVLAKLRAPPKQEFS  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            VATP VLK ADG++LG PT FG +PAQ+KALFD+CG LW  G L+GKP G+FFS G+ GG
Sbjct  61   VATPAVLKEADGIMLGFPTHFGMVPAQMKALFDSCGMLWMKGELIGKPCGVFFSCGSRGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQE +A +T  ++ H GM FVPL  R  ++   DE+HG S WG+GT+A +D SRQPS LE
Sbjct  121  GQEVSAMSTTPYIAHLGMMFVPLSLRGSVIEGNDELHGCSLWGSGTVANSDRSRQPSALE  180

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA++QG+ FA + KKLS
Sbjct  181  LSVAEMQGKKFAEITKKLS  199

>PYVX_22078
Length=1267

 Score = 269 bits (688),  Expect = 7e-83, Method: Composition-based stats.
 Identities = 153/270 (57%), Positives = 171/270 (63%), Gaps = 78/270 (29%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGH+AK+AESVK GVE+V+GVTA IYQV ETL EE+L ++HAAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHVAKLAESVKEGVESVEGVTATIYQVPETLPEELLAQIHAAPKKDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKP------------  108
            +AT D LK ADG+L G PTRFG+ PAQV+ALFDA GGLW +GALVGKP            
Sbjct  61   IATVDTLKEADGILFGFPTRFGAAPAQVRALFDATGGLWGSGALVGKPAGFFFSTGTLGG  120

Query  109  -------------------AGIFFSTGTPGGGQEttafttltfltHQGMTFVPLGYRSPL  149
                               AGIFFSTGT GGGQE TAF+TL F  HQG+TFVPLGYRSPL
Sbjct  121  GQETTALTTLTFLTHQGLTAGIFFSTGTQGGGQEVTAFSTLPFFAHQGLTFVPLGYRSPL  180

Query  150  LFNMDEIHGGSP-----------------------------------------------W  162
            LFNM+EIHGGSP                                               W
Sbjct  181  LFNMEEIHGGSPTGSQGGGQEVTAFTTLPFFAHQGLTYVPLGYRSQLLANMEEIHGGSAW  240

Query  163  GAGTLAGADGSRQPSKLELDVAKVQGESFA  192
            GAGT AG+DGSRQPS+LEL VAKVQGESFA
Sbjct  241  GAGTFAGSDGSRQPSELELGVAKVQGESFA  270

>PHYSO_327921
Length=209

 Score = 246 bits (628),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 148/199 (74%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            +TN+AIIYYS +GH A +A+++K GV++V GV   IYQV ETLSE+IL KMHA PK DHP
Sbjct  10   VTNVAIIYYSIHGHAATLAKAIKKGVDSVPGVKGTIYQVAETLSEDILAKMHAPPKLDHP  69

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATP  LK ADG+L G PTRFG  PAQ K LFD+ G LWAAG L+GK  G F ST   G 
Sbjct  70   IATPQTLKEADGILFGYPTRFGDFPAQAKTLFDSTGQLWAAGDLIGKLGGAFVSTSLLGA  129

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETT   T+ F+   GMTFVP GYR+  LFN+DE+HGGSPWGAGT+AG D SRQ S LE
Sbjct  130  GQETTQLMTMAFMVSHGMTFVPPGYRAKQLFNVDEVHGGSPWGAGTIAGPDNSRQVSALE  189

Query  181  LDVAKVQGESFAGVAKKLS  199
             +VA  QG+SFA V KKLS
Sbjct  190  KEVAVEQGKSFAEVTKKLS  208

>PYAR_24476
Length=213

 Score = 244 bits (623),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 135/148 (91%), Gaps = 0/148 (0%)

Query  51   MHAAPKKDHPVATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAG  110
            MHAAPKKDHP+ TP++L  ADGVL GIPTRFGSMPAQVKA FD+CGGLWA G LVGKPAG
Sbjct  1    MHAAPKKDHPIITPEILAAADGVLFGIPTRFGSMPAQVKAFFDSCGGLWAKGGLVGKPAG  60

Query  111  IFFSTGTPGGGQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGA  170
            +FFSTGT GGGQETT  ++LTFLTH GM+FVPLGYRSPLLFN++EIHGGSPWGAGTLAGA
Sbjct  61   MFFSTGTLGGGQETTVMSSLTFLTHHGMSFVPLGYRSPLLFNLEEIHGGSPWGAGTLAGA  120

Query  171  DGSRQPSKLELDVAKVQGESFAGVAKKL  198
            DGSRQPS LELDVAKVQGE+FA VA+KL
Sbjct  121  DGSRQPSTLELDVAKVQGETFAQVAQKL  148

>PPTG_03053
Length=225

 Score = 243 bits (619),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 151/199 (76%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT +AI++YST+GH+ KMA +++ G++ V GV A++YQV+ETL+EE+L K+HA PK D P
Sbjct  26   MTKVAIVFYSTFGHVTKMASAIQKGIQTVPGVQAQLYQVKETLNEEVLAKLHAPPKPDFP  85

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +ATPDVLKNADG++LG PT FG +PAQ+KALFDA   LW  G L+GKP GIFFS G+ GG
Sbjct  86   IATPDVLKNADGIMLGFPTHFGMVPAQMKALFDASVALWVKGELIGKPCGIFFSCGSRGG  145

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQE +A +T  ++ H GM FVPL      +   DE+HG S WG+GT+AG D SRQPS LE
Sbjct  146  GQEVSAMSTTPYIAHLGMLFVPLALNGKTIEGSDEMHGCSLWGSGTVAGHDRSRQPSALE  205

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA++QG+ FA + KKL+
Sbjct  206  LKVAEMQGKKFAEITKKLA  224

>PITG_12444
Length=200

 Score = 240 bits (612),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 136/164 (83%), Gaps = 0/164 (0%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYSTYGH+AK+A + K G+E V GV A IYQV+ETL EE+L KMHA PK DHP
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIEFVGGVAATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            +AT D LK ADG+L G P R GSMPAQVKA FD+CGGLWA+GALVGK AG+FFSTGT GG
Sbjct  61   IATIDTLKEADGILFGFPCRSGSMPAQVKAFFDSCGGLWASGALVGKTAGLFFSTGTQGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGA  164
            GQETTAFT +TFL HQGMT+VPLGYR   L NMDE+HGGSPWGA
Sbjct  121  GQETTAFTAVTFLAHQGMTYVPLGYRGKELLNMDEMHGGSPWGA  164

>PYAR_22252
Length=201

 Score = 226 bits (577),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 149/200 (75%), Gaps = 1/200 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  +AI+YYST+GH   +AE++  GVE V+GV   IYQV ETLS++ L +  AAPK+D+P
Sbjct  1    MAKVAIVYYSTFGHTTVLAEAMLEGVENVEGVEGAIYQVAETLSKDALEQRKAAPKQDYP  60

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
            + TP++L   DGVL G PT+FG+MP Q+ A FD+CG LWA GALVGKPAG+F S+G  GG
Sbjct  61   LITPEILAEYDGVLFGFPTQFGAMPPQMAAFFDSCGSLWAKGALVGKPAGVFVSSGIMGG  120

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAG-ADGSRQPSKL  179
            G E++ FTTL FL HQGM FVPLGYR+ L+    E+HGGS WGAGTL+G     RQP+ L
Sbjct  121  GVESSPFTTLPFLAHQGMLFVPLGYRTKLVSTKHEVHGGSSWGAGTLSGITPDMRQPTFL  180

Query  180  ELDVAKVQGESFAGVAKKLS  199
            EL+ A VQG+SFA + KKL+
Sbjct  181  ELECAMVQGQSFAEITKKLA  200

>PHYCA_508489
Length=156

 Score = 213 bits (541),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 133/199 (67%), Gaps = 44/199 (22%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            M  IAI+YYS Y HI+ MAE+                                       
Sbjct  1    MAKIAIVYYSCYNHISTMAETT--------------------------------------  22

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
                  LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  23   ------LKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  76

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTAFT LTFL HQGMT+VPLGYR+P L NM+EIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  77   GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  136

Query  181  LDVAKVQGESFAGVAKKLS  199
            L VA  QG+SFA +AKKL+
Sbjct  137  LTVATTQGKSFAEIAKKLA  155

>PYIW_26124
Length=139

 Score = 183 bits (464),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 111/139 (80%), Gaps = 1/139 (1%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKK-DH  59
            MT IA++YYS YGHI K+A ++KAG   V GV  +++QV+ETL + +L KMHAAPK  DH
Sbjct  1    MTKIAVVYYSMYGHIGKLASAIKAGTSRVAGVETQLFQVQETLPDALLTKMHAAPKAADH  60

Query  60   PVATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPG  119
            PVATP+ L++AD +LLG+PTRFG +P+QVK LFDACGGLWA G L+GKP GIFFSTG+ G
Sbjct  61   PVATPETLRDADAILLGLPTRFGMLPSQVKGLFDACGGLWATGGLIGKPCGIFFSTGSLG  120

Query  120  GGQEttafttltfltHQGM  138
            GGQETTA +T  FL H GM
Sbjct  121  GGQETTAMSTTPFLAHHGM  139

>PITG_19721
Length=147

 Score = 179 bits (453),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 122/199 (61%), Gaps = 53/199 (27%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MTN+AIIYYS YGH+AK+A S+KAGV +V GV A                          
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVKAS-------------------------  35

Query  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120
                    +ADG LLG PTRFG                     L+GKP GIFFS+ + GG
Sbjct  36   --------DADGTLLGFPTRFG--------------------GLIGKPCGIFFSSASLGG  67

Query  121  GQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180
            GQETTA +   F+ HQGMTFVPLGYRSPL+   +EIHGGSPWGAGTLA ADGSRQP+ +E
Sbjct  68   GQETTAMSMTPFIAHQGMTFVPLGYRSPLVGTNEEIHGGSPWGAGTLANADGSRQPTDVE  127

Query  181  LDVAKVQGESFAGVAKKLS  199
            L++AK+QG+SFA + KKLS
Sbjct  128  LEIAKIQGQSFAEITKKLS  146

>PYAR_17624
Length=215

 Score = 180 bits (456),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 133/219 (61%), Gaps = 27/219 (12%)

Query  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
            MT IAI+YYS YGH+ K+AE+VK G + V GV A++YQV ETL  +IL KM A PK D P
Sbjct  1    MTRIAIVYYSLYGHVGKLAEAVKVGAKRVPGVDAQLYQVAETLPSDILQKMGAPPKPDLP  60

Query  61   VATPDVLKNADGVLLG---------------------IPTRFGSMPAQVKALFDACGGLW  99
            VATPDVLKN+    +G                     +P  + S P          G  W
Sbjct  61   VATPDVLKNSXXXXIGGGQETTALTSTPILAHHGMMYVPLGYRS-PMLESNDHVHGGSDW  119

Query  100  AAGALVGKPAGIFFSTGTPGGGQEttafttltfltHQGMTFVPLGYRSPLLFNMDEIHGG  159
              G +              GGGQETTA T++ FL H GM +VPLGYR+PLL + D++HGG
Sbjct  120  GTGTITNGDXXXXI-----GGGQETTALTSMPFLAHHGMMYVPLGYRTPLLASNDQVHGG  174

Query  160  SPWGAGTLAGADGSRQPSKLELDVAKVQGESFAGVAKKL  198
            SPWG GT+A  DGSRQPS+L L++AKVQGESFA +AKKL
Sbjct  175  SPWGTGTIANGDGSRQPSELGLEIAKVQGESFAAIAKKL  213

>PYVX_24503
Length=113

 Score = 174 bits (440),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 104/112 (93%), Gaps = 0/112 (0%)

Query  88   VKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQEttafttltfltHQGMTFVPLGYRS  147
            V+ALFDA GGLW +GALVGKPAG FFSTGT GGGQETTA++TLTFLTH G+ +VPLGY++
Sbjct  1    VRALFDATGGLWGSGALVGKPAGFFFSTGTLGGGQETTAYSTLTFLTHHGLVYVPLGYQT  60

Query  148  PLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGESFAGVAKKLS  199
            PLLFN+DE+HGGSPWGAGTLAG DGSRQPSKLELDVA+VQGE FAG+AKKLS
Sbjct  61   PLLFNLDEVHGGSPWGAGTLAGPDGSRQPSKLELDVAEVQGEKFAGIAKKLS  112

>PPTG_20265
Length=89

 Score = 142 bits (359),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 79/89 (89%), Gaps = 0/89 (0%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
           M  IAI+YYSTYGHIA++AE+VK GVE++ GVTA+IYQV+ETL +EIL KM+AAPKKDHP
Sbjct  1   MAKIAIVYYSTYGHIAQLAEAVKKGVESIAGVTADIYQVQETLPDEILAKMYAAPKKDHP  60

Query  61  VATPDVLKNADGVLLGIPTRFGSMPAQVK  89
           +ATP+ LK ADG+L G PTRFGS+PAQ+K
Sbjct  61  IATPETLKEADGILFGFPTRFGSLPAQMK  89

>PYIW_24901
Length=123

 Score = 140 bits (354),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 1/123 (1%)

Query  77   IPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQEttafttltfltHQ  136
            +PTRFGS+PAQ+K  FDA G LW  GAL+GKPAG+FFS G+ GGG ETTA  T+ FLTHQ
Sbjct  1    MPTRFGSVPAQLKNFFDATGSLWQKGALIGKPAGVFFSCGSQGGGNETTALMTIPFLTHQ  60

Query  137  GMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGESFAGVAK  196
            GM FVPLG R+     +DE+ GG  WG GT AG DGSR+PS+ EL  AKVQG SFA + K
Sbjct  61   GMLFVPLGTRAKQFGTLDEVVGGGKWGTGTYAG-DGSRKPSERELSTAKVQGVSFAEITK  119

Query  197  KLS  199
            KL+
Sbjct  120  KLA  122

>PYVX_24541
Length=82

 Score = 137 bits (346),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 73/82 (89%), Gaps = 0/82 (0%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
           MT IAI+YYSTYGH+AK+AESVK GVE+V+GVTA IYQV ETL EE+L ++HAAPKKDHP
Sbjct  1   MTKIAIVYYSTYGHVAKLAESVKEGVESVEGVTATIYQVPETLPEELLAQIHAAPKKDHP  60

Query  61  VATPDVLKNADGVLLGIPTRFG  82
           +ATPDVLK ADG+L G PTRFG
Sbjct  61  IATPDVLKEADGILFGFPTRFG  82

>PYIW_26817
Length=80

 Score = 125 bits (313),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 69/97 (71%), Gaps = 17/97 (18%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
           MTNIAI                  GVE   GVTAEIYQ+ ETL EE+L KMHA PKKDHP
Sbjct  1   MTNIAI-----------------EGVEQATGVTAEIYQIAETLPEEVLAKMHAPPKKDHP  43

Query  61  VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGG  97
           +ATPDVLK ADG+L GIPTRFGSMPAQVKALFD+ GG
Sbjct  44  IATPDVLKAADGILFGIPTRFGSMPAQVKALFDSTGG  80

>PYIW_25666
Length=75

 Score = 124 bits (312),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 68/75 (91%), Gaps = 0/75 (0%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
           MTN+AI+YYSTYGHIA +AE +KAG+E+V+GVTA IYQ++ETL E++L KM+AAPKKDHP
Sbjct  1   MTNVAIVYYSTYGHIATLAEEIKAGIESVEGVTATIYQIQETLPEDVLAKMYAAPKKDHP  60

Query  61  VATPDVLKNADGVLL  75
           VATPDVLK ADG+L 
Sbjct  61  VATPDVLKEADGILF  75

>PYIR_16433
Length=102

 Score = 122 bits (305),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 71/88 (81%), Gaps = 1/88 (1%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPK-KDH  59
           MT IA++YYS YGHI K+A ++KAG   V GV  +++QV+ETL +++L +MHAAPK  DH
Sbjct  1   MTKIAVVYYSMYGHIGKLASAIKAGTSRVPGVETQLFQVQETLPDDLLQRMHAAPKATDH  60

Query  60  PVATPDVLKNADGVLLGIPTRFGSMPAQ  87
           P+ATPD LK ADG+LLG+PTRFG +P+Q
Sbjct  61  PIATPDTLKEADGILLGLPTRFGMLPSQ  88

>PYAR_17731
Length=63

 Score = 118 bits (296),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)

Query  138  MTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGESFAGVAKK  197
            MTFVPLGYRSPLLFN++EIHGGSPWGAGTLAG DGSRQPSKLELDVAK QGESF  VAKK
Sbjct  1    MTFVPLGYRSPLLFNLEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKAQGESFTQVAKK  60

Query  198  LS  199
            LS
Sbjct  61   LS  62

>PYIR_25309
Length=103

 Score = 116 bits (291),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)

Query  135  HQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGESFAGV  194
            H GMT+VPLGYRS L+F+ +EIHGGSPWGAG+ AG DGSRQPSKLELDVAKVQGESFA +
Sbjct  38   HHGMTYVPLGYRSKLVFSFEEIHGGSPWGAGSYAGPDGSRQPSKLELDVAKVQGESFAQI  97

Query  195  AKKLS  199
            AKKLS
Sbjct  98   AKKLS  102

 Score = 45.8 bits (107),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAG  25
           MT IAI+YYSTYGHI K+AE++KAG
Sbjct  1   MTKIAIVYYSTYGHIVKLAETIKAG  25

>PITG_22462
Length=64

 Score = 107 bits (268),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)

Query  137  GMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGESFAGVAK  196
            G+TFVPLGYR+P LFNMDE+HGGSPWGAGTLAG DGSRQPSK EL VA  QG+SFA VAK
Sbjct  1    GLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKPELTVATTQGKSFAEVAK  60

Query  197  KLS  199
            KL+
Sbjct  61   KLA  63

>PHYSO_525925
Length=73

 Score = 102 bits (254),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 62/74 (84%), Gaps = 1/74 (1%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60
           MTN+AI YYS YGH+AK+A S+KAGV +V GV A +YQV++TL++++L  +HA PK D P
Sbjct  1   MTNVAI-YYSMYGHVAKLANSLKAGVTSVPGVKASVYQVQKTLNDDLLKALHAPPKPDLP  59

Query  61  VATPDVLKNADGVL  74
           +ATPDVLKNADG+L
Sbjct  60  IATPDVLKNADGIL  73

>PYVX_22081
Length=45

 Score = 82.4 bits (202),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)

Query  156  IHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGESFAGVAKKLS  199
            +HGGSPWGAGTLAG DGSRQPSKLELDVA+VQGE FAG+AKKLS
Sbjct  1    VHGGSPWGAGTLAGPDGSRQPSKLELDVAEVQGEKFAGIAKKLS  44

>PHYKE_5219
Length=38

 Score = 63.5 bits (153),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQ  38
           M NIAI+YYS Y HIA MA+S+K G+E+VDGVTA IYQ
Sbjct  1   MVNIAIVYYSCYNHIATMADSIKEGIESVDGVTATIYQ  38

>PHYKE_4826
Length=38

 Score = 58.5 bits (140),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)

Query  1   MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQ  38
           MT IAI+YYSTYGHIAK+AE+ K G+E+  GVTA IYQ
Sbjct  1   MTKIAIVYYSTYGHIAKLAEAAKEGIESTPGVTATIYQ  38

>PHYSO_329877
Length=115

 Score = 59.3 bits (142),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 3/48 (6%)

Query  76   GIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQE  123
            G+PTR   MPAQ+   FD CGGLWA GAL+G    + FS G+ GGG E
Sbjct  48   GLPTRLDVMPAQITEFFDCCGGLWAKGALIGN---VIFSYGSQGGGNE  92

>PITG_11840
Length=106

 Score = 35.8 bits (81),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 2/26 (8%)

Query  74  LLGIPTRFGSMPAQVKALFDACGGLW  99
           +LG+ TR   MPAQ+KALFDA G +W
Sbjct  1   MLGLSTRM--MPAQMKALFDARGDMW  24

>CCA20300
Length=586

 Score = 33.5 bits (75),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  59   HPVATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGG  97
            HPV T D +KNADG+L  +     +  A+  ++ D+  G
Sbjct  75   HPVTTNDYIKNADGILEALRAVHLTREAESASILDSLSG  113

>PYIR_22407
Length=3775

 Score = 32.0 bits (71),  Expect = 2.6, Method: Composition-based stats.
 Identities = 22/89 (25%), Positives = 40/89 (45%), Gaps = 7/89 (8%)

Query  35   EIYQVEETLSEEILGKMHAAPKKDHPVATPDVLKNADGVLLGIPTRFGSMPAQVKALFDA  94
            E+ ++ E+L E ++      PK D   A  D+L   +G+L G      +   ++ +LF+ 
Sbjct  191  EVVELVESLFERLVKFTWKVPKGDVESALTDILSETEGLLEGRHASHRAARGRISSLFER  250

Query  95   CGGLWAAGAL-----VGKPAGIFFSTGTP  118
                W    +      G P  +F +TG+P
Sbjct  251  LEISWTVKTVEPSVATGNP--VFGATGSP  277

>PYVX_20689
Length=397

 Score = 31.6 bits (70),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 21/45 (47%), Gaps = 6/45 (13%)

Query  61   VATPDVLKNADGVLL------GIPTRFGSMPAQVKALFDACGGLW  99
            VA    L+   GVLL        P +FG  PA V A FDA   LW
Sbjct  310  VAVRQGLEKTTGVLLTNGADPNTPNKFGVTPAHVAAAFDASHELW  354

>SDRG_16426
Length=1628

 Score = 31.6 bits (70),  Expect = 3.3, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 2/57 (4%)

Query  14    HIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDH--PVATPDVLK  68
             HIA + + ++  V AV   TA   Q  E L    + K H A  +DH   + +PDV K
Sbjct  1329  HIAGLKQELREIVSAVAQPTASTAQKPELLRRRSVVKEHLAAAQDHLAQITSPDVEK  1385

>CCA26166
Length=1594

 Score = 31.6 bits (70),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 18/75 (24%)

Query  15   IAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVATPDVLKNADGVL  74
            I  MAE +KAG        +E+Y++ E+ S+EILGK      +  P+ TP+         
Sbjct  200  INGMAEVIKAGA----IYDSELYELLESRSDEILGK-----DRHTPLVTPN---------  241

Query  75   LGIPTRFGSMPAQVK  89
            L +  R   M  QVK
Sbjct  242  LKLLQRIVRMAVQVK  256

>H310_06144
Length=645

 Score = 30.8 bits (68),  Expect = 6.4, Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 24/41 (59%), Gaps = 1/41 (2%)

Query  56   KKDHPVATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACG  96
            +KD+PV     +KN D +   + T+FGSM A  +A FD  G
Sbjct  149  EKDNPVTKAMFVKNRDKIRDRVATKFGSMRAMFRA-FDNEG  188

>PHYSO_288658
Length=120

 Score = 29.3 bits (64),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 23/42 (55%), Gaps = 6/42 (14%)

Query  41   ETLSEEILGKMHAAPKKDHPVATPDVLKNADGVLLGIPTRFG  82
            E L++E L K H      HP   P + + ADG LL IP +FG
Sbjct  84   EKLAQE-LSKKHV-----HPFPPPRIKELADGKLLVIPRQFG  119

>PITG_02800
Length=806

 Score = 30.4 bits (67),  Expect = 9.3, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 21/40 (53%), Gaps = 3/40 (8%)

Query  48   LGKMHA---APKKDHPVATPDVLKNADGVLLGIPTRFGSM  84
            LG+ HA   AP+K  PV TP +L      L+G   R  ++
Sbjct  451  LGQQHALRQAPEKPSPVPTPQLLNPMAATLMGSTERLAAL  490

Lambda      K        H        a         alpha
   0.315    0.135    0.399    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8937626619

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40