Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_334598772872835420.0
PHYRA_96744986131754716450.0
PPTG_1024598766552013591e-178
PHALS_0878798768444611705e-150
PHYSO_47255998761347711184e-143
PITG_0111698746839310751e-138
PHYRA_864807304432231310183e-132
PHYCA_1228979874752508252e-101
PYVX_1462598615424398724e-100
PYU1_G0019669866724697461e-87
PYAR_159679866354506644e-76
PYAP_1658098612314326172e-66
PYIR_1703198613882535932e-63
PHYSO_4742549865671904754e-50
PPTG_102469868001864651e-47
PYIW_159549868365484642e-47
PITG_011159865451904322e-44
PHALS_087889867551903728e-36
PHYSO_47364798895973127e-33
SDRG_019079875832803422e-32
SPRG_062089874122553316e-32
H257_003859875882933341e-31
H310_014009875962963306e-31
CCA189029878232913202e-29
PITG_01117988101992774e-28
CCI451329875772903066e-28
CCI448281531404711822788e-25
CCI106579864911192601e-22
CCA221119865151162566e-22
CCA233971557905521162567e-22
CCA175481531404711822548e-22
PYAR_159709873911032252e-18
SPRG_136151294403451932171e-17
H257_09653986498901372e-07
H310_11183986489951311e-06
SDRG_07059986616791212e-05
SPRG_09070986621791212e-05
H310_014181251854901081104e-04
SPRG_06239125185470801020.003
SDRG_01871125185466801010.004
H257_0633035196897253910.082
H257_00365125185477112880.13
PHYRA_81814503154585850.39
PYAP_2089010480134379850.41
PYVX_2221514281264114801.5
HYAP_0331662632414105782.0
PYAR_215445011101963773.5
PHYCA_553527503155176764.4
PHYSO_3425795305216564725.2
PITG_049104202714101746.8
PITG_1296310527727125748.5
PYIR_206351199565966739.3
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_3345

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYKE_3345                                                            1368    0.0   
PHYRA_96744                                                           638     0.0   
PPTG_10245                                                            528     1e-178
PHALS_08787                                                           455     5e-150
PHYSO_472559                                                          435     4e-143
PITG_01116                                                            418     1e-138
PHYRA_86480                                                           396     3e-132
PHYCA_122897                                                          322     2e-101
PYVX_14625                                                            340     4e-100
PYU1_G001966                                                          291     1e-87 
PYAR_15967                                                            260     4e-76 
PYAP_16580                                                            242     2e-66 
PYIR_17031                                                            233     2e-63 
PHYSO_474254                                                          187     4e-50 
PPTG_10246                                                            183     1e-47 
PYIW_15954                                                            183     2e-47 
PITG_01115                                                            171     2e-44 
PHALS_08788                                                           147     8e-36 
PHYSO_473647                                                          124     7e-33 
SDRG_01907                                                            136     2e-32 
SPRG_06208                                                            132     6e-32 
H257_00385                                                            133     1e-31 
H310_01400                                                            131     6e-31 
CCA18902                                                              127     2e-29 
PITG_01117                                                            111     4e-28 
CCI45132                                                              122     6e-28 
CCI44828                                                              111     8e-25 
CCI10657                                                              104     1e-22 
CCA22111                                                              103     6e-22 
CCA23397                                                              103     7e-22 
CCA17548                                                              102     8e-22 
PYAR_15970                                                            91.3    2e-18 
SPRG_13615                                                            88.2    1e-17 
H257_09653                                                            57.4    2e-07 
H310_11183                                                            55.1    1e-06 
SDRG_07059                                                            51.2    2e-05 
SPRG_09070                                                            51.2    2e-05 
H310_01418                                                            47.0    4e-04 
SPRG_06239                                                            43.9    0.003 
SDRG_01871                                                            43.5    0.004 
H257_06330                                                            39.7    0.082 
H257_00365                                                            38.5    0.13  
PHYRA_81814                                                           37.4    0.39  
PYAP_20890                                                            37.4    0.41  
PYVX_22215                                                            35.4    1.5   
HYAP_03316                                                            34.7    2.0   
PYAR_21544                                                            34.3    3.5   
PHYCA_553527                                                          33.9    4.4   
PHYSO_342579                                                          32.3    5.2   
PITG_04910                                                            33.1    6.8   
PITG_12963                                                            33.1    8.5   
PYIR_20635                                                            32.7    9.3   

>PHYKE_3345
Length=728

 Score = 1368 bits (3542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 728/728 (100%), Positives = 728/728 (100%), Gaps = 0/728 (0%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP
Sbjct  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60

Query  61   LASYVEECCQTLIMEATHKVNDGERVPGASILENDMLGLLYLGGIDISTVGKYRGVKGDG  120
            LASYVEECCQTLIMEATHKVNDGERVPGASILENDMLGLLYLGGIDISTVGKYRGVKGDG
Sbjct  61   LASYVEECCQTLIMEATHKVNDGERVPGASILENDMLGLLYLGGIDISTVGKYRGVKGDG  120

Query  121  SRVEDGLYALDLPQWRLCWCRSKGMYFIPHFdddddsssdsdldEPPSKSVSLSTSMNKN  180
            SRVEDGLYALDLPQWRLCWCRSKGMYFIPHFDDDDDSSSDSDLDEPPSKSVSLSTSMNKN
Sbjct  121  SRVEDGLYALDLPQWRLCWCRSKGMYFIPHFDDDDDSSSDSDLDEPPSKSVSLSTSMNKN  180

Query  181  HYGSGSISnnndeddhdedeaadGVKSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTS  240
            HYGSGSISNNNDEDDHDEDEAADGVKSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTS
Sbjct  181  HYGSGSISNNNDEDDHDEDEAADGVKSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTS  240

Query  241  EARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLDKDSVEHMCEELKSKNVALQQELKK  300
            EARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLDKDSVEHMCEELKSKNVALQQELKK
Sbjct  241  EARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLDKDSVEHMCEELKSKNVALQQELKK  300

Query  301  TQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAKVKKLQTQLVPLKSGST  360
            TQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAKVKKLQTQLVPLKSGST
Sbjct  301  TQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAKVKKLQTQLVPLKSGST  360

Query  361  SAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRDDLEERLHRLTRKYDALK  420
            SAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRDDLEERLHRLTRKYDALK
Sbjct  361  SAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRDDLEERLHRLTRKYDALK  420

Query  421  ARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKGKLHEARRARTADGSTKG  480
            ARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKGKLHEARRARTADGSTKG
Sbjct  421  ARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKGKLHEARRARTADGSTKG  480

Query  481  SASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAMPQPSEASQYRAMAAEKERLA  540
            SASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAMPQPSEASQYRAMAAEKERLA
Sbjct  481  SASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAMPQPSEASQYRAMAAEKERLA  540

Query  541  EVIRGLKSQLEDKDKQLRVMHEQQGGTGLAPQASSQMAPSLSSLPPIGDESVSRIPRKPG  600
            EVIRGLKSQLEDKDKQLRVMHEQQGGTGLAPQASSQMAPSLSSLPPIGDESVSRIPRKPG
Sbjct  541  EVIRGLKSQLEDKDKQLRVMHEQQGGTGLAPQASSQMAPSLSSLPPIGDESVSRIPRKPG  600

Query  601  SNCppsgrrnsstsstsssvgppapsaMMMEQQNQQLKHEMEILRKTFRESMCEKDERIT  660
            SNCPPSGRRNSSTSSTSSSVGPPAPSAMMMEQQNQQLKHEMEILRKTFRESMCEKDERIT
Sbjct  601  SNCPPSGRRNSSTSSTSSSVGPPAPSAMMMEQQNQQLKHEMEILRKTFRESMCEKDERIT  660

Query  661  QLEHLHHATVHRASADLDINSNGMNQELLDLQEENDFLRQEFDRLKVRYEALVKSPAVTI  720
            QLEHLHHATVHRASADLDINSNGMNQELLDLQEENDFLRQEFDRLKVRYEALVKSPAVTI
Sbjct  661  QLEHLHHATVHRASADLDINSNGMNQELLDLQEENDFLRQEFDRLKVRYEALVKSPAVTI  720

Query  721  KKSSTRSK  728
            KKSSTRSK
Sbjct  721  KKSSTRSK  728

>PHYRA_96744
Length=1317

 Score = 638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/547 (66%), Positives = 402/547 (73%), Gaps = 76/547 (14%)

Query  206   KSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGL  265
             +S Q++P+  FQ ++QWDRVQELQELTNAN  LTSEARDLRQQ+K LQIQLEAQ PVPGL
Sbjct  790   QSRQDRPQHTFQGDVQWDRVQELQELTNANAALTSEARDLRQQLKTLQIQLEAQAPVPGL  849

Query  266   DIDAVQDMLLDKDSVEH---------------------------------------MCEE  286
             D+DAVQD+LL+KD++EH                                       +CEE
Sbjct  850   DVDAVQDILLEKDNIEHDVRDVKIVHQARMVRTLKLSLQREKQLAADAIRHGALKKLCEE  909

Query  287   LKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAKVK  346
             LKSKN ALQQELKK QRALVREVGDDVPLEDI+GNTDST SGASRRGRAQHI+MLKAKVK
Sbjct  910   LKSKNTALQQELKKIQRALVREVGDDVPLEDIVGNTDSTASGASRRGRAQHIIMLKAKVK  969

Query  347   KLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRDDLE  406
             KLQTQL           + DS    TV+DVDQRAQQ LSGQ MHRQK +DQLT QRD+L+
Sbjct  970   KLQTQL-----------ATDSGATTTVLDVDQRAQQGLSGQHMHRQKLLDQLTGQRDELQ  1018

Query  407   ERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKGKLH  466
             ER+HRLTRKYDALKARAQ LDREKQETRNKFQVLVEKSR DDALVDALQRQLETWK KL+
Sbjct  1019  ERVHRLTRKYDALKARAQTLDREKQETRNKFQVLVEKSRTDDALVDALQRQLETWKTKLN  1078

Query  467   EARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAMPQPSEA  526
             EARRARTADG  KGSASQEER ELERLRKIV+ HK   G DR   P+ +S G MPQ SEA
Sbjct  1079  EARRARTADG-MKGSASQEERAELERLRKIVAEHK-SRGSDRTVNPMGLSNGVMPQLSEA  1136

Query  527   SQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVMHEQQGGTGLAPQASSQMAPSLSSLPP  586
             SQYRA+AAEKERLAEV+RGLK+QLEDKD QLR MH+Q+    +APQ  +Q  PS  SLPP
Sbjct  1137  SQYRAIAAEKERLAEVVRGLKAQLEDKDNQLRSMHQQRDNAEVAPQTPTQAMPSSPSLPP  1196

Query  587   IGDESVSRIPRKPGSNCppsgrrnsstsstsssvgppapsaMMMEQQNQQLKHEMEILRK  646
             IGDESVSRIPR+PGS            S   SSV PPAPSA+MMEQQ QQLK EME LRK
Sbjct  1197  IGDESVSRIPRRPGSKL-------PLPSGRLSSVVPPAPSAVMMEQQQQQLKLEMETLRK  1249

Query  647   TFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMNQELLDLQEENDFLRQEFDRLK  706
             TFR+SM +KDERI +LE    +                  EL DLQEENDFLRQEFD+LK
Sbjct  1250  TFRDSMRDKDERIAELEQQQRSI-----------------ELQDLQEENDFLRQEFDKLK  1292

Query  707   VRYEALV  713
              RYEALV
Sbjct  1293  TRYEALV  1299

 Score = 191 bits (485),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 111/190 (58%), Gaps = 66/190 (35%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            MAKAQQELDALV KGAK+PSRVM+  + G+ +EWRYG PEYVLTDLAYVKGR REPD TP
Sbjct  468  MAKAQQELDALVTKGAKLPSRVMQATANGEAIEWRYGVPEYVLTDLAYVKGRMREPDATP  527

Query  61   LASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYLG  103
            LASYVEECCQT IMEATHK                 VNDGERVPGA ILENDMLGLLYLG
Sbjct  528  LASYVEECCQTFIMEATHKARYDQWHSVCQETFYLQVNDGERVPGARILENDMLGLLYLG  587

Query  104  GIDIST-------------------------------------------------VGKYR  114
             I+ ST                                                  GK+R
Sbjct  588  DIEASTGANHGDSDESQDLRAELAEAFPDGFPIEVLDVFTQPPRCYFSWRHWGSFTGKFR  647

Query  115  GVKGDGSRVE  124
            GV+GDGS++E
Sbjct  648  GVRGDGSKME  657

>PPTG_10245
Length=665

 Score = 528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 305/520 (59%), Positives = 367/520 (71%), Gaps = 41/520 (8%)

Query  217  QSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQ-------IPVPGLDIDA  269
            + ++  D  ++ Q L  AN  L  E   L+ +++  Q ++ A+       +  P L    
Sbjct  179  EKQLAMDATKQSQALQAANKQLEEEVDTLKLKLQRFQARVAAEKANNNGAVNQPQLPESP  238

Query  270  VQDMLLDKDSVEHMCEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGA  329
              D   D  S++ + +ELKSKN ALQQELKKTQRALVREVG+DVPLE+I+GNTD+  SGA
Sbjct  239  SSDTNSDGGSLKKLVDELKSKNTALQQELKKTQRALVREVGEDVPLEEIVGNTDNAASGA  298

Query  330  SRRGRAQHIVMLKAKVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQM  389
            SRRGRAQ I+MLK KVKKLQT+L  ++ G+TS    D  ++  V+DVDQRAQQDLSGQQM
Sbjct  299  SRRGRAQQIIMLKTKVKKLQTRLATMRPGTTSP---DPHDLGNVLDVDQRAQQDLSGQQM  355

Query  390  HRQKRVDQLTSQRDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDA  449
            HRQK +DQLT+QRD+L+ERLHRLTR YDALKARAQILDREK ETR+KFQVLV+KSR DDA
Sbjct  356  HRQKLLDQLTTQRDELQERLHRLTRNYDALKARAQILDREKHETRDKFQVLVDKSRTDDA  415

Query  450  LVDALQRQLETWKGKLHEARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDRV  509
            LVDALQRQLETWK KLH+ARRARTAD S     SQ+ER ELERLRKIV+ HK   GGDR 
Sbjct  416  LVDALQRQLETWKTKLHDARRARTADSS--KCTSQDERVELERLRKIVAEHK-SRGGDR-  471

Query  510  STPLTISGGAMPQPSEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVMHEQQGGTGL  569
                  S GAMPQPSE SQYRA+A EKERL EV+R LK+Q+EDKDKQLR + E    + L
Sbjct  472  ------STGAMPQPSEISQYRAIAVEKERLTEVVRSLKAQVEDKDKQLRSLQESHSSSDL  525

Query  570  APQASSQMAPSLSSLPPIGDESVSRIPRKPGSNCppsgrrnsstsstsssvgppapsaMM  629
                  Q  P   SLPPIGDESVSR+PR+P                   S GPP PSA++
Sbjct  526  L-----QATPPSPSLPPIGDESVSRLPRRPS-------------RIPLPSGGPPPPSAVI  567

Query  630  MEQQNQQLKHEMEILRKTFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMNQELL  689
            MEQQ QQLKHEME L KTFRE++ EKDERI +LE    +T   ++   D+  N M+Q+L 
Sbjct  568  MEQQQQQLKHEMETLCKTFRETVREKDERIAELEQHRQSTAQSSTTGTDV--NAMSQQLR  625

Query  690  DLQEENDFLRQEFDRLKVRYEALVKSPA-VTIKKSSTRSK  728
            +LQEENDFLRQEFD+LK RYEAL K PA V+ KKS ++ K
Sbjct  626  ELQEENDFLRQEFDKLKTRYEALTKPPASVSRKKSRSKEK  665

 Score = 128 bits (322),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 145/241 (60%), Gaps = 20/241 (8%)

Query  125  DGLYALDLPQWRLCWCRSKGMYFIPHFdddddsssdsdldEPPSKSVSLSTSMNKNHYGS  184
            DG   +D+   R      +    +P FDDDDDSSS  D  EP  +S+   +S++K  Y S
Sbjct  11   DGKKLIDVTLRRQGMPPQQAPLVVPQFDDDDDSSSSDD--EPAIESL-FQSSLSKKQYTS  67

Query  185  GSISnnndeddhdedeaadGVKSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTSEARD  244
            GS +NN++++             +  + + +FQ EIQWDRVQE+QELTNA+TTLTSE RD
Sbjct  68   GSSNNNDEDNHD----------ENTGEQQKLFQGEIQWDRVQEIQELTNADTTLTSEIRD  117

Query  245  LRQQVKALQIQLEAQIPVPGLDIDAVQDMLLDKDSVEHMCEELKSKNVALQQELKKTQRA  304
            LRQQVKALQIQLEAQ PVPGLD+DAVQD+LL+KD+++H   ++K  + A      KT R+
Sbjct  118  LRQQVKALQIQLEAQAPVPGLDVDAVQDILLEKDNLDHDVRDVKIVHQA------KTLRS  171

Query  305  LVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAKVKKLQTQLVPLKSGSTSAGS  364
            L R++  +  L  +     S    A+ +   + +  LK K+++ Q ++   K+ +  A +
Sbjct  172  LKRQLQREKQLA-MDATKQSQALQAANKQLEEEVDTLKLKLQRFQARVAAEKANNNGAVN  230

Query  365  Q  365
            Q
Sbjct  231  Q  231

>PHALS_08787
Length=684

 Score = 455 bits (1170),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 260/446 (58%), Positives = 328/446 (74%), Gaps = 10/446 (2%)

Query  269  AVQDMLLDKDSVEHMCEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSG  328
            +  D  ++ ++++  CE LK KN ALQQELK TQRAL+REVGDDVPLEDI+ NTDST S 
Sbjct  238  STNDTCINDENLKKNCEALKLKNTALQQELKTTQRALIREVGDDVPLEDIICNTDSTTSR  297

Query  329  ASRRGRAQHIVMLKAKVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQ  388
            ++RRGRAQHI++LK+KVK+LQTQL  LK GS  + +Q S N ATV+DVD+RAQQDLS QQ
Sbjct  298  SARRGRAQHIIILKSKVKRLQTQLANLKQGSIVSDAQSSENSATVLDVDKRAQQDLSDQQ  357

Query  389  MHRQKRVDQLTSQRDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDD  448
            +HRQK +DQL+SQRD+L++RLHRLTRKYDA+KAR QILDRE+QE R+KFQVL+EKS+ DD
Sbjct  358  LHRQKVIDQLSSQRDELQDRLHRLTRKYDAIKARVQILDRERQEMRDKFQVLIEKSKTDD  417

Query  449  ALVDALQRQLETWKGKLHEARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDR  508
            AL+DALQRQLETWK KLH+ARRARTADG    + +Q E+ ELERLR++V  HKG  G   
Sbjct  418  ALIDALQRQLETWKSKLHQARRARTADGV--KNTNQVEQAELERLRQLVGEHKGQSGERS  475

Query  509  VSTPLTISGGAMPQPSEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVMHEQQGGTG  568
             S  L+ S   MP+PSE +QYRA+A EKERL E++  LKSQ+E+KDKQL+ + E++G  G
Sbjct  476  ASCSLS-SDRTMPRPSEIAQYRAIAVEKERLTELVCSLKSQVENKDKQLQSLRERRGNFG  534

Query  569  LAPQASSQMAPSLSSLPPIGDESVSRIPRKPGSNCppsgrrnsstsstsssvgppapsaM  628
             A +  +++ P   S+P  GD SVSRIPR  GS               +S    PA   +
Sbjct  535  AASETLTRITPP-PSMPVPGDGSVSRIPRLRGSK-----TPPEGRPFGASMSSLPASLTV  588

Query  629  MMEQQNQQLKHEMEILRKTFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMNQEL  688
             MEQQ QQLK EME LRKTFRESM EKD+RI +LE  H       +A +   ++GM+Q+ 
Sbjct  589  KMEQQQQQLKQEMETLRKTFRESMREKDDRIAELEQQHKLLDQSGTAKM-YTADGMSQKF  647

Query  689  LDLQEENDFLRQEFDRLKVRYEALVK  714
             +L+EEN FLRQE++RLK RYEAL K
Sbjct  648  QELEEENAFLRQEYNRLKSRYEALAK  673

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 98/174 (56%), Gaps = 13/174 (7%)

Query  206  KSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGL  265
            K +Q++ +    S+++WD+V+E +E+TN N T  SE RDLRQQVKALQIQLEAQ PVPGL
Sbjct  79   KCNQDEIQQSLSSDVRWDQVREAEEVTNTNGTSCSEIRDLRQQVKALQIQLEAQAPVPGL  138

Query  266  DIDAVQDMLLDKDSVEHMCEELKSKNVALQQELKKTQRALVRE---VGDDVPLEDILGNT  322
            DI+A  ++LLDK+ ++H   ++K  + A  + L+  +R L RE     D V     L  T
Sbjct  139  DIEAFHEILLDKEELDHDIRDVKIVHQA--KSLRTLKRLLQREKQRTADSVKQCIALETT  196

Query  323  DSTVSGASRRGRAQHIVMLKAKVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDV  376
                     +   Q I  LK K+++L  +    K+ S S+ +   T   +  D 
Sbjct  197  S--------KHHEQEIDTLKLKLQRLHARAAGNKTNSLSSVTSSETPTVSTNDT  242

>PHYSO_472559
Length=613

 Score = 435 bits (1118),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 269/477 (56%), Positives = 306/477 (64%), Gaps = 81/477 (17%)

Query  125  DGLYALDLPQWRLCWCRSKGMYFIPHFdddddsssdsdldEPPSKSVSLSTSMNKNHYGS  184
            DG   +D+   R      +    +P FDD+DDSSS    DE P+  +  + S+NK HY  
Sbjct  13   DGKKLIDVTLRRQGVPSQQAPLVVPRFDDEDDSSSSDSDDEEPA--IKSTASLNKRHY--  68

Query  185  GSISnnndeddhdedeaadGVKSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTSEARD  244
             SI +NN+ +D          K  Q Q    FQ E+QWD VQELQELTNAN TLTSEARD
Sbjct  69   -SIPSNNNNEDDHGGATVSSGKLDQGQ---TFQGEVQWDHVQELQELTNANATLTSEARD  124

Query  245  LRQQVKALQIQLEAQIPVPGLDIDAVQDMLLDKDSVEH----------------------  282
            LRQQVKALQIQLEAQ PVPGLD DAVQD+LL+KD +EH                      
Sbjct  125  LRQQVKALQIQLEAQAPVPGLDADAVQDILLEKDILEHDVRDVKIVHQAKTLRTLKRSLQ  184

Query  283  -----------MCEELKSKNVALQQELK----KTQRALVREVGD----------------  311
                        C+  ++ N  L+ E+     K QR   R   D                
Sbjct  185  HEKQIAADAVKQCKTFEAANKKLEDEVDTLKLKLQRFQARAAADKKLCEELKSKSTSLQQ  244

Query  312  ---------------DVPLEDILGNTDSTVSGASRRGRAQHIVMLKAKVKKLQTQLVPLK  356
                           DVPLEDI+GNTD+T SGASRRGRAQHI+MLKAKVKKLQ QL  +K
Sbjct  245  ELKKTQRALVREVGDDVPLEDIIGNTDNTASGASRRGRAQHIIMLKAKVKKLQAQLASVK  304

Query  357  SGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRDDLEERLHRLTRKY  416
             G+TS  SQDS +  TV+DVDQRAQQDLSGQQ+HRQK +DQLTSQRD+L+ER+HRLTRKY
Sbjct  305  PGTTSVASQDSADTTTVLDVDQRAQQDLSGQQIHRQKLLDQLTSQRDELQERIHRLTRKY  364

Query  417  DALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKGKLHEARRARTADG  476
            DALKARAQILDREKQETRNKFQVLVEKSR DDALVDALQRQLE WK KLHEARRARTADG
Sbjct  365  DALKARAQILDREKQETRNKFQVLVEKSRTDDALVDALQRQLEAWKAKLHEARRARTADG  424

Query  477  STKGSASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAMPQPSEASQYRAMA  533
              K SA+ +ER ELERLRKIV+ HK   GGDR +     S   MPQPSEASQYRAMA
Sbjct  425  -MKASANADERAELERLRKIVAEHK-SRGGDRATVQ---SNTMMPQPSEASQYRAMA  476

>PITG_01116
Length=468

 Score = 418 bits (1075),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 233/393 (59%), Positives = 267/393 (68%), Gaps = 79/393 (20%)

Query  206  KSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGL  265
            +S   Q +  F  EIQWDRVQELQELTNAN TLT+EARDLRQQVKALQIQLEAQ PVPGL
Sbjct  84   RSHSQQQQKPFSGEIQWDRVQELQELTNANATLTAEARDLRQQVKALQIQLEAQAPVPGL  143

Query  266  DIDAVQDMLLDKDSVEH---------------------------------MCEELKSKNV  292
            D+DAVQD+LL+KDS++H                                  C+EL+  N 
Sbjct  144  DVDAVQDILLEKDSLDHDIRDVKIVHQAKTLRTLKRSLQREKQLAADGSRQCKELERANK  203

Query  293  ALQQE-----------------------------------LKKTQRALVREVGDDVPLED  317
              ++E                                   LKKTQRALVREVG+DVPLED
Sbjct  204  QFEEEVDTLKMKLQRFQARAAAEKKLCDELKSKNIALQQELKKTQRALVREVGEDVPLED  263

Query  318  ILGNTDSTVSGASRRGRAQHIVMLKAKVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVD  377
            I+GNTD+  SGASRRGRAQ I+MLK KVK+LQT+L  L+ G++S  + D+ +   V+DVD
Sbjct  264  IVGNTDTATSGASRRGRAQQIIMLKTKVKQLQTRLATLRPGTSSTDTHDNGH---VLDVD  320

Query  378  QRAQQDLSGQQMHRQKRVDQLTSQRDDLEERLHRLTRKYDALKARAQILDREKQETRNKF  437
            QRAQQDLSG QMHRQK +DQLTSQRD+L+ERLHRLTRKYDALKARAQILDREK ETR+KF
Sbjct  321  QRAQQDLSGLQMHRQKLLDQLTSQRDELQERLHRLTRKYDALKARAQILDREKNETRDKF  380

Query  438  QVLVEKSRNDDALVDALQRQLETWKGKLHEARRARTADGSTKGSASQEERTELERLRKIV  497
            QV V+KSR DDALVDALQRQLETWK KLHEARRARTAD       SQEER ELERLR+IV
Sbjct  381  QVFVDKSRTDDALVDALQRQLETWKTKLHEARRARTADAPKAAGTSQEERVELERLRRIV  440

Query  498  SAHKGGGGGDRVSTPLTISGGAMPQPSEASQYR  530
            + HK    GDR +T       AMPQPSE SQ+R
Sbjct  441  AEHK-SRAGDRSNT-------AMPQPSEISQWR  465

>PHYRA_86480
Length=322

 Score = 396 bits (1018),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 224/313 (72%), Positives = 247/313 (79%), Gaps = 9/313 (3%)

Query  401  QRDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLET  460
            QRD+L+ER+HRLTRKYDALKARAQ LDREKQETRNKFQVLVEKSR DDALVDALQRQLET
Sbjct  1    QRDELQERVHRLTRKYDALKARAQTLDREKQETRNKFQVLVEKSRTDDALVDALQRQLET  60

Query  461  WKGKLHEARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAM  520
            WK KL+EARRARTADG  KGSASQEER ELERLRKIV+ HK   G DR   P+ +S G M
Sbjct  61   WKTKLNEARRARTADG-MKGSASQEERAELERLRKIVAEHK-SRGSDRTVNPMGLSNGVM  118

Query  521  PQPSEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVMHEQQGGTGLAPQASSQMAPS  580
            PQ SEASQYRA+AAEKERLAEV+RGLK+QLEDKD QLR MH+Q+    +APQ  +Q  PS
Sbjct  119  PQLSEASQYRAIAAEKERLAEVVRGLKAQLEDKDNQLRSMHQQRDNAEVAPQTPTQAMPS  178

Query  581  LSSLPPIGDESVSRIPRKPGSNCppsgrrnsstsstsssvgppapsaMMMEQQNQQLKHE  640
              SLP IGDESVSRIPR+PGS            S   SSV PPAPSA+MMEQQ QQLK E
Sbjct  179  SPSLPRIGDESVSRIPRRPGSKL-------PLPSGRLSSVVPPAPSAVMMEQQQQQLKLE  231

Query  641  MEILRKTFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMNQELLDLQEENDFLRQ  700
            ME LRKTFR+SM +KDERI +LE    + V  AS   D++ N MNQEL DLQEENDFLRQ
Sbjct  232  METLRKTFRDSMRDKDERIAELEQQQRSIVQSASGTADVDMNAMNQELQDLQEENDFLRQ  291

Query  701  EFDRLKVRYEALV  713
            EFD+LK RYEALV
Sbjct  292  EFDKLKTRYEALV  304

>PHYCA_122897
Length=475

 Score = 322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/250 (69%), Positives = 199/250 (80%), Gaps = 10/250 (4%)

Query  284  CEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRR-GRAQHIVMLK  342
             +ELK K   LQQELKKTQRAL REVGDD+PL++I+G  D++ SGASRR GRAQ I++LK
Sbjct  229  VDELKLKTATLQQELKKTQRALAREVGDDIPLDEIVGEKDNSTSGASRRRGRAQQIIILK  288

Query  343  AKVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQR  402
            AKVKKLQ QL   K+G  +A   D+   AT +DVDQRAQQ+LS Q  HRQK +DQLT+QR
Sbjct  289  AKVKKLQAQL---KAGHATAEVHDT---ATTLDVDQRAQQELSSQHFHRQKLIDQLTNQR  342

Query  403  DDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWK  462
            D+LEER+HR TRKYDALKARAQILDREKQE RNKFQVLVEKSR DDALVDALQRQLETWK
Sbjct  343  DELEERVHRSTRKYDALKARAQILDREKQEIRNKFQVLVEKSRTDDALVDALQRQLETWK  402

Query  463  GKLHEARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAMPQ  522
             KLHEARRARTAD +     SQEER ELE+LRK+V+ HK   G D  ++P+  +GG MP 
Sbjct  403  TKLHEARRARTADSA--KFTSQEERAELEKLRKVVAEHK-SRGSDWAASPIGPAGGGMPL  459

Query  523  PSEASQYRAM  532
            PSEAS YRA+
Sbjct  460  PSEASLYRAI  469

 Score = 126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 100/156 (64%), Gaps = 12/156 (8%)

Query  210  NQPRDIFQSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDA  269
            N+ +  FQ  IQWDRVQELQELTNAN TLTSEARDLRQQVK LQIQLEAQ PVPGLD+DA
Sbjct  81   NRQQQTFQGGIQWDRVQELQELTNANATLTSEARDLRQQVKMLQIQLEAQTPVPGLDVDA  140

Query  270  VQDMLLDKDSVEH---MCEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTV  326
            VQD+LL+KD++EH    C+    K V   + ++  +R+L RE       + +  + D   
Sbjct  141  VQDILLEKDNIEHASIYCDVRDMKIVHQAKTIRALKRSLQRE-------KQLAADADKQC  193

Query  327  S--GASRRGRAQHIVMLKAKVKKLQTQLVPLKSGST  360
                A+ R   + + +LK K+++ Q + V  K+ + 
Sbjct  194  KTMDATNRKLEEQVDILKLKLQRFQARDVAEKNSNV  229

>PYVX_14625
Length=1542

 Score = 340 bits (872),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 206/439 (47%), Positives = 290/439 (66%), Gaps = 35/439 (8%)

Query  283   MCEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLK  342
             +C++LK+KN ALQQELK+TQRAL+REVGDDVPL++++    +      RRGRAQ I+MLK
Sbjct  1129  LCDDLKAKNSALQQELKRTQRALIREVGDDVPLDELIAGDGTN----GRRGRAQQIIMLK  1184

Query  343   AKVKKLQTQLVPLKSGS-TSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQ  401
             AK+KKL+ +     + S T+ G + S      +DVDQRAQQ+L+GQ  HRQK++DQL  +
Sbjct  1185  AKIKKLEGETTKATAASPTTKGGKQSG-----LDVDQRAQQELAGQSAHRQKQIDQLAEE  1239

Query  402   RDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETW  461
             RD L + L +++RK +AL++R+QIL++EKQ+T+ K QVLV+KS+NDDALVD LQ+QLE W
Sbjct  1240  RDALHDSLQQVSRKLEALRSRSQILEKEKQDTKAKLQVLVDKSKNDDALVDVLQKQLEIW  1299

Query  462   KGKLHEARRAR-TADGSTKG--SASQEERTELERLRKIVS-AHKGGGGGDRVSTPLTISG  517
             KGK  EA+R R T + +T+G  +++ E+R E+ERLR++VS   +      R  TP    G
Sbjct  1300  KGKFQEAKRMRLTENTNTRGDIASNSEDRAEIERLRQLVSDLQRQAPTSSRTETPPAHRG  1359

Query  518   -GAMPQPSEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVMHEQQGGTGLAPQASSQ  576
                MP P++ +Q+RA+  E ERL E+++ L++QL+DKDKQLR      G TG     SSQ
Sbjct  1360  NNPMPAPTDVAQFRAVTVETERLRELVKSLQAQLDDKDKQLR------GSTG---NQSSQ  1410

Query  577   MAPSLSSLPPIGDESVSRIPRKPGSNCppsgrrnsstsstsssvgppapsaMMMEQQNQQ  636
              +   S LP IG    SRIPRK G + P     ++  + T+ S           + +   
Sbjct  1411  PSALPSFLPSIGP---SRIPRKGGRSTPVLAGDDARNAPTTPSSNS--------QSRIDD  1459

Query  637   LKHEMEILRKTFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMNQELLDLQEEND  696
             L+HEME +RKTFR+S+ EKDERI +L+    A      +    +S  + QE+ DLQEEN 
Sbjct  1460  LEHEMETMRKTFRDSLREKDERIAELQQQTLAVRQEDPSSCRDDSLALAQEVEDLQEENQ  1519

Query  697   FLRQEFDRLKVRYEALVKS  715
             FLRQEFD+LKVRYEA+ ++
Sbjct  1520  FLRQEFDKLKVRYEAISRA  1538

 Score = 125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 20/137 (15%)

Query  1    MAKAQQELDALVAKG-AKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGT  59
            +AKA++EL+ALVA G AK PSR   +    K V+WR+G PEY L+DL Y KG+ RE + T
Sbjct  543  LAKAKKELEALVASGKAKRPSRGGHDTD--KNVKWRFGLPEYALSDLEYAKGKLREHEST  600

Query  60   PLASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYL  102
            PL SYVEECCQT +MEATHK                 VNDG  + G++I + DM G+LY+
Sbjct  601  PLESYVEECCQTFLMEATHKARFQEWQSVRHDQFYLQVNDGGAIAGSAIEDTDMFGMLYM  660

Query  103  GGIDISTVGKYRGVKGD  119
             G D++ + +  GV  +
Sbjct  661  TGFDLAELDERDGVSNE  677

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 63/94 (67%), Gaps = 2/94 (2%)

Query  215   IFQSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDML  274
             IF  E+QW  VQ++Q LTN+N  L+++  DL+ Q+K + IQLEA  PVPGL  +AVQD+L
Sbjct  966   IFTGEMQWSGVQDIQALTNSNAALSAQVADLKHQLKVMDIQLEALSPVPGLHPEAVQDLL  1025

Query  275   LDKDSVEHMCEELKSKNVALQQELKKTQRALVRE  308
             LDK+S++H      +K V   + ++  +RA  RE
Sbjct  1026  LDKNSMDHDVR--NTKIVHQAKTIRHLKRAAQRE  1057

>PYU1_G001966
Length=672

 Score = 291 bits (746),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 195/469 (42%), Positives = 276/469 (59%), Gaps = 67/469 (14%)

Query  280  VEHMCEELKSKNVALQQELKKTQRALVREVGDDVPLEDIL-GNTDSTVSGASRRGRAQHI  338
            ++   ++LK K+  LQ ++KK QRAL REVGDDV L++ L  N D+    A RRGRAQ I
Sbjct  245  IKKKFDDLKVKHDKLQHDVKKLQRALQREVGDDVALDEFLIENADA---NARRRGRAQQI  301

Query  339  VMLKAKVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQL  398
            V+LKAKVKKL+ +LV +K+ + + G           +VD+RAQQ+L+ Q + RQK++D++
Sbjct  302  VILKAKVKKLEAELVAVKTVTATNGEDLFQPAIMETNVDRRAQQELASQHVQRQKQLDKV  361

Query  399  TSQRDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQL  458
              +RD+L  R+ +LT+K+D +K+RAQIL++EK E++ KFQVLV+KS+NDDAL+DALQRQL
Sbjct  362  AQERDELLARVAQLTQKHDGVKSRAQILEKEKLESKAKFQVLVDKSKNDDALIDALQRQL  421

Query  459  ETWKGKLHEARRARTADGSTKGSASQEERTELERLRKIVSAHK----GGGGGDRVSTPL-  513
            ETWKGK+   +R RTA+ ++  S + +ER ELE+LR+ V+ H+    GG   +  S  + 
Sbjct  422  ETWKGKVQHVKRVRTAESASSNSITMDERLELEQLRQRVADHQKRQHGGASANSASDQIP  481

Query  514  -------------TISGGAMPQPSEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVM  560
                          ++G  MP PSEASQYR MA EKERL+E ++ L++QLE K++QLR  
Sbjct  482  RRPPSASSSSTLSLVTG--MPVPSEASQYRTMATEKERLSETVKALQAQLESKERQLR--  537

Query  561  HEQQGGTGLAPQASSQMAPSLSSLPPIGDESVSRIPRKPGSNCppsgrrnsstsstsssv  620
                           Q  P + S+ P      +RIP+K     P S R  +  S  +S  
Sbjct  538  ------------QPKQQQPPMPSMLPSDIPGATRIPQKIAIPTPSSTRPYAGGSDATSKQ  585

Query  621  gppapsaMMMEQQNQQLKHEMEILRKTFRESMCEKDE-------RITQLEHLHHATVHRA  673
                               E+E+LR+TFRE++  K++       R+  LE   H    R 
Sbjct  586  TA-----------------EIEVLRRTFRETIKTKEDQIAALRIRLQDLEASQHQQSTRR  628

Query  674  SADLDINSNGMNQELLDLQEENDFLRQEFDRLKVRYEALVKSPAVTIKK  722
             AD     N +  E+ DLQEEN FLRQEFD+LK RYE+LV   A    K
Sbjct  629  DAD-----NDLVLEVQDLQEENQFLRQEFDKLKSRYESLVSKSATNKAK  672

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 62/94 (66%), Gaps = 3/94 (3%)

Query  216  FQSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLL  275
            FQ E QWD V  +Q+LTN+N  L ++  + ++Q+K LQIQLEA  PVPG + DAVQ++LL
Sbjct  73   FQGEFQWDNVHNVQQLTNSNAQLVAQMTECKRQIKTLQIQLEAMTPVPGFNADAVQEILL  132

Query  276  DKD-SVEHMCEELKSKNVALQQELKKTQRALVRE  308
            ++D   +H   +  +K V   + L++ +R L RE
Sbjct  133  ERDGGADHDIRD--AKIVHQAKTLRRLKRTLQRE  164

>PYAR_15967
Length=635

 Score = 260 bits (664),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 183/450 (41%), Positives = 247/450 (55%), Gaps = 118/450 (26%)

Query  284  CEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKA  343
             E+++ K+  L  +LKKTQRAL+REVGDDV L++IL  + S V  A RRGRAQ I+MLKA
Sbjct  280  FEDMRIKHDKLLADLKKTQRALLREVGDDVSLDEILDGSSSGVENA-RRGRAQQIIMLKA  338

Query  344  KVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRD  403
            KVKKL+   +       S  S   T VA+  DVDQRA QDLS Q   +Q+ VD+LTS+RD
Sbjct  339  KVKKLEQDAM----AKVSTSSDTPTTVAS--DVDQRAIQDLSLQHAQKQRVVDKLTSERD  392

Query  404  DLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKG  463
            +L  R  +LT+K+DALK+R QIL++EK + + K QVLV+KSRNDDALVDALQRQ+E+WKG
Sbjct  393  ELLGRHQQLTKKFDALKSRTQILEKEKHDHKAKLQVLVDKSRNDDALVDALQRQIESWKG  452

Query  464  KLHEARRARTADGST-----KGSAS--QEERTELERLRKIVSAHKGGGGGDRVSTPLTIS  516
            KL+EA+RARTA+  +      GSA   ++ER EL+RL                       
Sbjct  453  KLNEAKRARTAESGSLASGGNGSAGLHKDERLELDRL----------------------P  490

Query  517  GGAMPQPSEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVMHEQQG-----------  565
             G M Q           AEKERLAE ++ L++QLED+D+Q+R  H   G           
Sbjct  491  DGLMVQ-----------AEKERLAEQVKVLQAQLEDRDRQMRATHSTGGTATSGSRIARL  539

Query  566  GTGLAPQASSQMAPSLSSLPPIGDESVSRIPRKPGSNCppsgrrnsstsstsssvgppap  625
            G+G  P +S    P + + PP            P +                        
Sbjct  540  GSGSLPHSS----PYILTPPP------------PAA------------------------  559

Query  626  saMMMEQQNQQLKHEMEILRKTFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMN  685
                       +  + E  +K FR++M  K++ I  L+         +S+D         
Sbjct  560  -----------IATDTEAQKKQFRDAMATKEQEIESLKQQLQRAAQPSSSD---------  599

Query  686  QELLDLQEENDFLRQEFDRLKVRYEALVKS  715
            QE+LDLQEEN++LRQEFDRLK RYEA++K+
Sbjct  600  QEILDLQEENEYLRQEFDRLKTRYEAVLKN  629

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 60/93 (65%), Gaps = 2/93 (2%)

Query  216  FQSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLL  275
            FQ + QW  VQ++Q LT+ N  L     +L+ Q+K+LQIQLEA  PVPGL+  AVQD+LL
Sbjct  112  FQGDFQWTGVQDIQALTHTNAALNGHVAELKSQLKSLQIQLEALAPVPGLNASAVQDILL  171

Query  276  DKDSVEHMCEELKSKNVALQQELKKTQRALVRE  308
            +KD  EH   +  +K V   + L+  +R++ RE
Sbjct  172  EKDGTEHDIRD--TKIVHQAKTLRHLKRSMQRE  202

>PYAP_16580
Length=1231

 Score = 242 bits (617),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 175/432 (41%), Positives = 260/432 (60%), Gaps = 77/432 (18%)

Query  285   EELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAK  344
             E+++ K+  L  +LKKTQRAL RE G+DV +E+++    +  +  ++RGRAQ IVMLKAK
Sbjct  873   EDMRIKHDKLLSDLKKTQRALQRECGEDVNIEELVDGCAANEN--AKRGRAQQIVMLKAK  930

Query  345   VKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRDD  404
             VKKL+ +L  +     +AG       A V DVDQRAQQD++ QQ  RQ+ +D+L  ++D+
Sbjct  931   VKKLEAELAKI---GGNAG-------AMVSDVDQRAQQDIAAQQAQRQRVIDKLNLEKDE  980

Query  405   LEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKGK  464
             L+E++H+LT+K+DA+K+RAQIL++EKQE + K Q+LV+KSRNDDALVDALQ+QLETWKGK
Sbjct  981   LQEKVHQLTKKFDAVKSRAQILEKEKQEHKAKIQLLVDKSRNDDALVDALQKQLETWKGK  1040

Query  465   LHEARRARTADGSTKGSAS----QEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAM  520
             L E +RARTA+ S+ GS      ++ER EL+RLR +V+ +K     ++      ++   M
Sbjct  1041  LQEVKRARTAESSSVGSGGTGLPKDERLELDRLRALVADYKRQAKQNQC-----VNNTMM  1095

Query  521   PQPSEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVMHEQQGGTGLAPQASSQMAPS  580
             PQPSE +QYRA+AAEKERL+E++  L SQL++K+     +H   G +      +++  P+
Sbjct  1096  PQPSEPAQYRALAAEKERLSELVASLHSQLDEKE-----LHADFGRSFQRIGGNNRAIPT  1150

Query  581   LSSLPPIGDESVSRIPRKPGSNCppsgrrnsstsstsssvgppapsaMMMEQQNQQLKHE  640
             +    P G + V   P  P +                                       
Sbjct  1151  I----PTGSQFV---PVPPPA---------------------------------------  1164

Query  641   MEILRKTFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMNQELLDLQEENDFLRQ  700
               +     R++M  K++ I  L+      +HR   + ++ S+   +E+ DLQ+EN +LRQ
Sbjct  1165  --VTDTRLRDAMAAKEQEIENLKQQLQDALHR---EQNVLSDDAQREIQDLQDENQYLRQ  1219

Query  701   EFDRLKVRYEAL  712
             EFDRLK RYEAL
Sbjct  1220  EFDRLKTRYEAL  1231

 Score = 132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 81/125 (65%), Gaps = 21/125 (17%)

Query  1    MAKAQQELDALVAKGAKVPSRV-MENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGT  59
            +AKA++EL+ LVA GAK P R  MEN    K   WRYG PEY+L+DL Y+KG++R+ D T
Sbjct  308  LAKAKKELEELVAAGAKPPMRGGMEN---AKTTNWRYGLPEYILSDLEYMKGKTRDHDST  364

Query  60   PLASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYL  102
            PL SY E CCQT IMEATHK                 VNDGE++PG ++ END+ GLLYL
Sbjct  365  PLESYAETCCQTFIMEATHKALYREWTSVRQEYFYIQVNDGEKIPGNALKENDLFGLLYL  424

Query  103  GGIDI  107
               D+
Sbjct  425  NNHDV  429

 Score = 42.4 bits (98),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 54/113 (48%), Gaps = 18/113 (16%)

Query  253  QIQLEAQIPVPGLDIDAVQDMLLDKDSVEHMCEELKSKNVALQQELKKTQRALVREVGDD  312
            +IQLEA  PVPGL+   VQD+LLDK+  +H   + K  + A      KT R L R     
Sbjct  745  RIQLEALAPVPGLNAAVVQDILLDKEGSDHDIRDAKIVHQA------KTIRHLKRS----  794

Query  313  VPLEDILGNTDSTVSGASRRGRAQHI--VMLKAKVKKLQTQLVPLKSGSTSAG  363
                  L +     + A RR +A       L+ K + LQ +L   ++ +T+ G
Sbjct  795  ------LQHEKHVATDAVRRCKAMETEKAQLEKKNETLQLKLARFEARATAGG  841

>PYIR_17031
Length=1388

 Score = 233 bits (593),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 182/253 (72%), Gaps = 9/253 (4%)

Query  285   EELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAK  344
             ++LK KN  LQ + KK QRAL REVGDDV +++IL + D  V    +RGRAQ IVMLKAK
Sbjct  1035  DDLKVKNDKLQSDFKKLQRALQREVGDDVSIDEILESVDGMVG---KRGRAQQIVMLKAK  1091

Query  345   VKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRDD  404
             VKKL+ +L    + ST++ S  + + A   +VD RAQQ+L+GQQ  +QK VD+LT +RD+
Sbjct  1092  VKKLEAEL----ANSTNSSSGSAMHGAPSNNVDLRAQQELAGQQTQKQKLVDKLTLERDE  1147

Query  405   LEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKGK  464
             ++E+L +LT+KYD LK+R Q L++EKQE+++KFQ+LV+KS NDDALVDALQRQL TWK K
Sbjct  1148  MQEKLAQLTKKYDGLKSRTQTLEKEKQESKSKFQLLVDKSNNDDALVDALQRQLATWKTK  1207

Query  465   LHEARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAMPQPS  524
             + E +R RTA+  +    + +++ ELERLR +V+ +K    G   S P+ +  G MP PS
Sbjct  1208  VQEVKRVRTAESISSQLPAAQQKEELERLRNMVAEYK-RQQGTLSSQPMALLSG-MPVPS  1265

Query  525   EASQYRAMAAEKE  537
             EASQYR MA++ +
Sbjct  1266  EASQYRTMASQNQ  1278

 Score = 136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 97/195 (50%), Gaps = 71/195 (36%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKP-------VEWRYGAPEYVLTDLAYVKGRS  53
            MA A++++  LVAKGAK P+R   + +   P       + WRYG PEY+L+DL Y+K + 
Sbjct  394  MALAKKQVAELVAKGAKRPTRGGMDTTNHHPANQSVTTISWRYGTPEYILSDLEYMKNKL  453

Query  54   REPDGTPLASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDM  96
            RE D TPL SYVEECCQT +MEATHK                 VNDGER+PG +I ENDM
Sbjct  454  REHDSTPLESYVEECCQTFLMEATHKAKYSDWISVRQEYFYLQVNDGERIPGHAIQENDM  513

Query  97   LGLLYLGGIDISTV----------------------------------------------  110
             GLL++   +++ V                                              
Sbjct  514  FGLLFVNDFEVTDVDMKEGEEKDPRAILSEAFTEGFPMEILEVYTQPPQCYFSWRHWGPF  573

Query  111  -GKYRGVKGDGSRVE  124
             G+Y+GVKGDGSRVE
Sbjct  574  TGRYKGVKGDGSRVE  588

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 61/95 (64%), Gaps = 4/95 (4%)

Query  216  FQSEIQWDR--VQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDM  273
            FQ + +WD   V  +Q+LTN N  L ++A + ++Q+K+LQIQLEA  PVPGL+ + VQD+
Sbjct  858  FQGDFKWDNLGVNGIQQLTNTNAQLVAQATEFKRQIKSLQIQLEALAPVPGLNPEMVQDI  917

Query  274  LLDKDSVEHMCEELKSKNVALQQELKKTQRALVRE  308
            L +++  EH   +  +K V   + L+  +R L RE
Sbjct  918  LREREGAEHDIRD--AKIVHQAKTLRHLKRTLQRE  950

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 14/102 (14%)

Query  640   EMEILRKTFRESMCEKDERITQLEH-LH------------HATVHRASADLDINSNGMNQ  686
             E+E LR+TFRES+  K+++I  L + LH            H    RA    D +   + Q
Sbjct  1288  EVEALRRTFRESLRAKEDQIAALSNRLHGLEISQQQLSNRHTGGSRAEGG-DGDDEDLAQ  1346

Query  687   ELLDLQEENDFLRQEFDRLKVRYEALVKSPAVTIKKSSTRSK  728
             E+ DLQ EN FLRQEFD+LK RYE LV++   ++   + ++K
Sbjct  1347  EVQDLQVENQFLRQEFDKLKTRYETLVRNAKSSVNGHNNKAK  1388

>PHYSO_474254
Length=567

 Score = 187 bits (475),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 112/190 (59%), Gaps = 66/190 (35%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            MAKAQQELDALVAKGAK+PSR+ + P+ G+ +EWRYGAPEYVL DLAYVKGR REPD TP
Sbjct  279  MAKAQQELDALVAKGAKLPSRIKKEPANGEAIEWRYGAPEYVLMDLAYVKGRMREPDATP  338

Query  61   LASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYLG  103
            LASYVEECCQT IMEATHK                 VNDG R+PG+SILENDMLG+LYLG
Sbjct  339  LASYVEECCQTFIMEATHKARYDQWHSVRHDTFYMQVNDGARIPGSSILENDMLGMLYLG  398

Query  104  GI----------------------------------DIST---------------VGKYR  114
             I                                  D+ T                GK+R
Sbjct  399  DIERSPGADQGDSDESQDPRAELAEAFPDGFPMEVLDVFTQPPQCYFSWRHWGPFTGKFR  458

Query  115  GVKGDGSRVE  124
            GVKGDGS+VE
Sbjct  459  GVKGDGSKVE  468

>PPTG_10246
Length=800

 Score = 183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 109/186 (59%), Gaps = 62/186 (33%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            MAKAQQELDALVAKGAK+PSRVM++P  G+ +EWRYG PEYVLTDLAYV+GR REPD TP
Sbjct  513  MAKAQQELDALVAKGAKLPSRVMQSPRNGEAIEWRYGIPEYVLTDLAYVRGRMREPDTTP  572

Query  61   LASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYLG  103
            LASYVEECCQT IMEA HK                 VNDG +V G+SILENDMLGLLYLG
Sbjct  573  LASYVEECCQTFIMEAKHKARYDQWRSVVQESFYLQVNDGIQVLGSSILENDMLGLLYLG  632

Query  104  GIDIS---------------------------------------------TVGKYRGVKG  118
              D +                                               GKYRGVKG
Sbjct  633  DADATHGDSDESQDPRAELAEAFPDGFPMEVLDVFTQPPQCYFSWRHWGPFTGKYRGVKG  692

Query  119  DGSRVE  124
            DGS+VE
Sbjct  693  DGSKVE  698

>PYIW_15954
Length=836

 Score = 183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 179/548 (33%), Positives = 258/548 (47%), Gaps = 126/548 (23%)

Query  217  QSEIQWD--RVQELQELTNANTTLTSEARDLRQQVKA--------------LQIQLEAQI  260
            QSE +W+     ++Q+LTNAN  L  +A D ++Q+K+              LQIQLEA  
Sbjct  370  QSEFKWNVSSANDIQQLTNANAQLVLQATDFKRQIKSYEAIHKFALVCAVILQIQLEALA  429

Query  261  PVPGLDIDAVQDMLLDKDS-VEHMCEELKSKNVALQQELKKTQRALVRE--VGDDVPLED  317
            PVPGL  D V D+L +++   EH   +  +K V   + L+  +R+L RE  +  D  L+ 
Sbjct  430  PVPGLHADLVNDILQEREGRPEHDIRD--AKIVHQAKILRHLKRSLQREKQLAVDAQLKK  487

Query  318  ILGNTDSTVSGASRRGRAQHIVMLKAKVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVD  377
             L +                   LK K  KLQ     L          D       + +D
Sbjct  488  KLED-------------------LKTKHDKLQLDFKKLHRALQREVGDD-------VPLD  521

Query  378  QRAQQDLSGQQMHRQKRVDQLTSQRDDLEERLHRLTRKYDALKARAQILDREKQETRNKF  437
            +  +    G    ++ R  Q+          L    +K +A  A+ Q L+++K E++ +F
Sbjct  522  EILEGPPDGANGGKRGRAQQIVM--------LKAKIKKLEAEFAKTQTLEKDKHESKARF  573

Query  438  QVLVEKSRNDDALVDALQRQLETWKGKLHEARRARTADGSTKGSASQEERTELERLRKIV  497
            Q+LV+KS+NDDAL             K+ E +R RTA+  + GS   +   ELERLR +V
Sbjct  574  QLLVDKSKNDDALT------------KVQEVKRVRTAE--SVGSQKDDRLAELERLRGVV  619

Query  498  SAHKGGGG-------GDRVSTPLTISGGAMPQPSEASQYRAMAAEKERLAEVIRGLKSQL  550
            + +K  GG           S+ L+I+  +MP  SEASQ+RAMAAEKERL EV+R L+ QL
Sbjct  620  AEYKRHGGVLPAASSQASQSSTLSIAT-SMPVTSEASQFRAMAAEKERLQEVVRALQIQL  678

Query  551  EDKDKQLRVMHEQQGGTGLAPQASSQMAPSLSSLPPIGDES-VSRIPRKPGSNCppsgrr  609
            ++ ++QL              QA  Q  P +    P  D S VSRIPRKPG         
Sbjct  679  DENERQLH-------------QARQQQPPKM----PTEDASLVSRIPRKPGVPALGGRSG  721

Query  610  nsstsstsssvgppapsaMMMEQQNQQLKH--EMEILRKTFRESMCEKDERITQL-----  662
             +S+                + Q      H  E+E LR+TFRES+  K++ I  L     
Sbjct  722  FTSSG---------------INQSTGDSMHGAEVEALRRTFRESLRAKEDEIAALMSRLH  766

Query  663  ----EHLHHATVHRASADLD-----INSNGMNQELLDLQEENDFLRQEFDRLKVRYEALV  713
                   H    H  S+  D       S+ + QE+ DLQEEN FLRQEF++LK RYEA+V
Sbjct  767  DLQETQQHQQRSHEISSTADDSGSSAASDDLAQEVQDLQEENQFLRQEFEKLKTRYEAIV  826

Query  714  KSPAVTIK  721
            +S   + K
Sbjct  827  RSANASSK  834

 Score = 124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 96/189 (51%), Gaps = 67/189 (35%)

Query  1    MAKAQQELDALVAKGAKVPSRV-MENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGT  59
            +A A++++  L+A+GAK P+R  ME PS     +WRYG PEYVL DL Y+K + RE + T
Sbjct  16   LALAKKQIQELLAQGAKRPTRGGMEQPSNQS--QWRYGTPEYVLADLEYMKHKQREHEST  73

Query  60   PLASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYL  102
            PL SYVEECCQT +MEATH+                 VNDG+R+PG +I E+D+ GLL +
Sbjct  74   PLESYVEECCQTFLMEATHRAHYSDWSSVRQEYFYLQVNDGDRIPGHAICESDLFGLLLV  133

Query  103  GGIDISTV-----------------------------------------------GKYRG  115
               +++ V                                               G+Y+G
Sbjct  134  NDHEVTDVDSKEGEEKDPRAILSEAFTEGFPMEVLEVYTQPPQCYFSWRHWGPFSGRYKG  193

Query  116  VKGDGSRVE  124
            +KGDGSRVE
Sbjct  194  IKGDGSRVE  202

>PITG_01115
Length=545

 Score = 171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 110/190 (58%), Gaps = 66/190 (35%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            +AKAQQELDALVAKGAK+PSRVM +   G+ +EWRYGAP+YVLTDLAYV+GR REPD TP
Sbjct  254  LAKAQQELDALVAKGAKLPSRVMLSLRNGEVIEWRYGAPKYVLTDLAYVRGRIREPDTTP  313

Query  61   LASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYLG  103
            LASYVEECC T I+EATHK                 VNDG +V G+SILENDMLGLLYLG
Sbjct  314  LASYVEECCHTFIVEATHKARYDQWRSVVQESFYLQVNDGIQVLGSSILENDMLGLLYLG  373

Query  104  G----------------------------------IDIST---------------VGKYR  114
                                               +D+ T                GKYR
Sbjct  374  DAEATMGADRGGSDESHDPRVELAEAFPDGFPMEVLDVFTQPPQCYFSWRHWGPFTGKYR  433

Query  115  GVKGDGSRVE  124
            G+KGDGS+VE
Sbjct  434  GIKGDGSKVE  443

>PHALS_08788
Length=755

 Score = 147 bits (372),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 100/190 (53%), Gaps = 66/190 (35%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            +AKA+QELDALVA GA++PSR+M     G+ +EWRYG PEYVLTDLAY KG  R  +   
Sbjct  464  LAKAKQELDALVANGARLPSRLMHGTVSGETIEWRYGYPEYVLTDLAYAKGCLRRSETAS  523

Query  61   LASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYLG  103
            LA+YVEE CQT +MEATHK                 +NDG +VPG+SILENDM GLLYLG
Sbjct  524  LAAYVEEGCQTFVMEATHKSRYDQWNSVDQASFYLQINDGLQVPGSSILENDMFGLLYLG  583

Query  104  G----------------------------------IDIST---------------VGKYR  114
                                               +D+ T                GKY+
Sbjct  584  DAVPCTDTACEECEEHQDPRVVLTEAFPDGFPMEVLDVFTQPPQCYFSWRHWGPFTGKYK  643

Query  115  GVKGDGSRVE  124
            G+KGDG +VE
Sbjct  644  GIKGDGRKVE  653

>PHYSO_473647
Length=95

 Score = 124 bits (312),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 4/97 (4%)

Query  629  MMEQQNQQLKHEMEILRKTFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMNQEL  688
            M+EQQ QQLKHEME LR+TFRESM EKDERI +LE L H++   A + +D ++N M QEL
Sbjct  1    MIEQQQQQLKHEMETLRRTFRESMREKDERIAELERLQHSS---AQSVMDDSTNAMTQEL  57

Query  689  LDLQEENDFLRQEFDRLKVRYEALVK-SPAVTIKKSS  724
            LDLQEENDFLRQEFD+LK RYEALVK S A + KK S
Sbjct  58   LDLQEENDFLRQEFDKLKTRYEALVKPSSAGSRKKQS  94

>SDRG_01907
Length=583

 Score = 136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 106/280 (38%), Positives = 150/280 (54%), Gaps = 41/280 (15%)

Query  285  EELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAK  344
            EELK K  A   ELK+TQRAL REVGDDV L DIL  +DS      +RGRAQ IVMLKAK
Sbjct  209  EELKLKCEAQAVELKRTQRALQREVGDDVALSDILDASDS-----GKRGRAQQIVMLKAK  263

Query  345  VKKLQ-TQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRD  403
            +KKL+  Q  P               V    DVD++A+ DL+  ++ R+K+ ++L    +
Sbjct  264  IKKLERAQPSP---------------VDVPRDVDRKAEDDLAASKLERRKQSEKLLEDGN  308

Query  404  DLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKG  463
             L E   +L +KY+A KAR  + ++E  +++ K  VL+EKS+NDD L+D LQ +LET K 
Sbjct  309  ALREGHEKLHKKYEATKARLHVFEKESSKSKVKISVLLEKSKNDDLLIDRLQSELETKKP  368

Query  464  KLHEARRARTADGSTKGSASQEERTELERLRKIVSAHK------------GGGGGDRVST  511
                + RARTAD         +    L + +K   AH+                 D   T
Sbjct  369  --GPSSRARTADSKAPDGDELDALKLLCKDQKRQLAHQASLLESFQRDLHAAQSTDLKHT  426

Query  512  PLTISGGAMPQPSEASQYRAMAAEKERLAEVIRGLKSQLE  551
              ++S        +   Y+A+A EKERL E+++ L+ QL+
Sbjct  427  KASVSK------EQFGNYQALAIEKERLVELVKSLQQQLQ  460

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 5/88 (6%)

Query  217  QSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLD  276
            QS+ +WD + ++Q L + N  L +  +  +QQ+  LQ+ LEA  P+PGLD+DA +D+L  
Sbjct  59   QSDFKWDGISDIQSLKHQNAELVAAIKSHKQQINELQLLLEALEPIPGLDVDAFKDILQG  118

Query  277  KDSVEHMCEELKSKNVALQQELKKTQRA  304
             + V+H       +NV +  + KK ++A
Sbjct  119  SEIVDHDI-----RNVKIVHQAKKLRQA  141

>SPRG_06208
Length=412

 Score = 132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/255 (38%), Positives = 143/255 (56%), Gaps = 35/255 (14%)

Query  224  RVQELQELTNANTTLTSEARDLRQQVKAL-QIQLEAQIPVPGLDIDAVQDMLLDKDSVEH  282
            ++ EL+    A  TL  +A    Q+++ L + +   ++P P  +I A + +         
Sbjct  158  KMAELERAVEAAQTLQGKAERALQRLQQLPRPEAAKKVPSPEKEIAASKKL---------  208

Query  283  MCEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLK  342
              EELK K  A   ELK+TQRAL REVGDD+ L +IL  +DS      +RGRAQ IVMLK
Sbjct  209  --EELKLKCEAQAVELKRTQRALQREVGDDIALSEILDASDS-----GKRGRAQQIVMLK  261

Query  343  AKVKKLQ-TQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQ  401
            AK+KKL+     PL +                 DVD++A+ DL+  ++ RQK++D+L   
Sbjct  262  AKIKKLERANPSPLDAPR---------------DVDRKAEDDLAATKLERQKQIDKLLDD  306

Query  402  RDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETW  461
             + L E   +L +KYD+ KAR  + +++  +++ K  VL+EKS+NDD L+D LQ +LE  
Sbjct  307  SNALRESHEKLQKKYDSTKARLHVFEKDASKSKVKISVLLEKSKNDDLLIDRLQSELEAK  366

Query  462  KGKLHEARRARTADG  476
            K     + RARTAD 
Sbjct  367  KP--GPSSRARTADS  379

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 5/88 (6%)

Query  217  QSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLD  276
            QS+ +WD + ++Q L + N  L +  +  +QQ+  LQ+ LEA  PVPGLD+D+ +D+L  
Sbjct  59   QSDFKWDGISDIQMLKHQNAELVAAIKSQKQQINELQLLLEAMEPVPGLDVDSFKDILQG  118

Query  277  KDSVEHMCEELKSKNVALQQELKKTQRA  304
             + V+H       +NV +  + KK ++A
Sbjct  119  SEIVDHDI-----RNVKIVHQAKKLRQA  141

>H257_00385
Length=588

 Score = 133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/293 (37%), Positives = 161/293 (55%), Gaps = 55/293 (19%)

Query  284  CEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKA  343
             E+L+ K  A+  +LKKTQRAL REVGDDVPL +IL        G  +RGRAQ IVMLKA
Sbjct  218  FEDLRVKYEAMAIDLKKTQRALQREVGDDVPLAEILDG-----EGGGKRGRAQQIVMLKA  272

Query  344  KVKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRD  403
            KVKKL+ +L               T  A    VD +A+ +L   +  +Q+++D + +  D
Sbjct  273  KVKKLEKEL--------------QTRTAPDTGVDAKAEVELLALKADKQRQLDHVVADLD  318

Query  404  DLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQ-------R  456
             L++   +L+RKYDA KAR   L+++  + + K  +L++KS NDD+L+DALQ       R
Sbjct  319  ALKDANDKLSRKYDAQKARMHTLEKDAGKHKTKLAILLDKSHNDDSLIDALQHEMDDLRR  378

Query  457  QLET-----WKGKLHEARRARTADGSTKGSAS---QEERTE-LERLRKIVSAHKGGG---  504
            Q+ T      K +LH   RARTAD      A+   +  RT+ LE+ R++  AH+      
Sbjct  379  QISTNASALAKDQLH---RARTADSGNIIDATNTVEALRTKCLEQKRQL--AHQASTIES  433

Query  505  -------GGDRVSTPLTISGGAMPQPSEASQYRAMAAEKERLAEVIRGLKSQL  550
                        ST + ++G      ++ + ++A+A EKERL E+++ L+ QL
Sbjct  434  FRRDLQQAQKLESTKIGVNGM-----TDTANHQALAIEKERLVELVKSLQHQL  481

>H310_01400
Length=596

 Score = 131 bits (330),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 150/296 (51%), Gaps = 67/296 (23%)

Query  285  EELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLKAK  344
            E+L+ K  A   ELKKTQRAL REVGDDVPL D+L           +RGRAQ IVMLKAK
Sbjct  233  EDLRVKYEAATIELKKTQRALQREVGDDVPLADVLDGE------GGKRGRAQQIVMLKAK  286

Query  345  VKKLQTQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQRDD  404
            VKKL+ +L       T               VD +A+ +L   ++ +QK +DQ  +  D 
Sbjct  287  VKKLEKELQSRSEPDTG--------------VDAKAEVELLALKVDKQKLLDQAVADLDA  332

Query  405  LEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWKGK  464
             ++   +L+RKYDA KAR   L+++  + + K  VL++KS+NDD+L+DALQ +++  + +
Sbjct  333  FKDANDKLSRKYDAQKARLHTLEKDATKNKAKISVLLDKSKNDDSLIDALQNEMDGLRRQ  392

Query  465  LHEA-------RRARTADGS--TKGSASQEERT---------------------ELERLR  494
            +  +        RARTAD S  T  +A    RT                     +L++  
Sbjct  393  VTSSGVSKEQWHRARTADSSILTDAAAMDALRTTCAEQKRQLAHQAATIESFRRDLQQAE  452

Query  495  KIVSAHKGGGGGDRVSTPLTISGGAMPQPSEASQYRAMAAEKERLAEVIRGLKSQL  550
            K+ S   GG  GD                  A+   ++A EKERL E+++ L+ QL
Sbjct  453  KLQSHRVGGNHGD-----------------AATGNHSLAIEKERLVELVKSLQQQL  491

 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 55/104 (53%), Gaps = 17/104 (16%)

Query  220  IQWDRVQELQELTNANTTLTSEARDLRQQVKA---------------LQIQLEAQIPVPG  264
              WD V ++Q L   N+ L +  +D + QV                 LQ+ LEA  P+PG
Sbjct  74   FNWDGVGDIQALQLKNSELVATIKDYKHQVTEYGLCLISFCGLCVCRLQLMLEAMEPIPG  133

Query  265  LDIDAVQDMLLDKDSVEHMCEELKSKNVALQQELKKTQRALVRE  308
            LD+++++D+L   + V+H   ++K  + A  ++L++ + AL +E
Sbjct  134  LDVNSLRDVLQGAEVVDHDIRDVKIVHQA--KKLRQAKIALNKE  175

>CCA18902
Length=823

 Score = 127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 98/291 (34%), Positives = 155/291 (53%), Gaps = 30/291 (10%)

Query  285  EELKSKNVALQQELKKTQRALVREVGDD--VPLEDILG------NTDSTVSGASRRGRAQ  336
            ++LK +N  L  ++KK  RAL +E+G D   PL D+L       +T S +    +R R+Q
Sbjct  231  DDLKIRNDKLLCDMKKLHRALTQEMGVDASTPLVDLLKVYGPNQSTGSVIGDGGKRTRSQ  290

Query  337  HIVMLKAKVKKLQTQLVPLKSGSTSAGSQ-DSTNVA--TVIDVDQRAQQDLSGQQMHRQK  393
             I++LKAKVK+L+ +    +  ++S  S  +STN++  ++  +D +   ++  QQ H+QK
Sbjct  291  QIIVLKAKVKELKLKCALERRRASSISSHPESTNLSEESLASMDAKVVSEIYKQQEHKQK  350

Query  394  RVDQLTSQRDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDA  453
            ++DQL    +    R+  LT K  A ++R  IL++E++E + K Q LVEKS  DD L+DA
Sbjct  351  QLDQLIIDNEQYRIRVEHLTGKIKASQSRTHILEQERKENKAKIQALVEKSDTDDKLIDA  410

Query  454  LQRQLETWKGKLHEARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDRVSTPL  513
            L  Q+  WK +  +A+RA  +DG+             E +   + + +  G   R S  L
Sbjct  411  LHAQVLLWKQRTEKAKRAHASDGNNVSVT--------ETIFPSLRSSQSSGVDRRKSIKL  462

Query  514  TISGG----------AMPQPSEASQYRAMAAEKERLAEVIRGLKSQLEDKD  554
              SG           A+P  SE ++YR +  E ERL  VIR LK Q+   D
Sbjct  463  HESGKSEISSKQVELAIP-VSETARYRQLHVENERLLCVIRELKKQVIQND  512

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 47/72 (65%), Gaps = 5/72 (7%)

Query  237  TLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLDKDSVEHMCEELKSKNVA---  293
            +L+ +   L++++K  ++QLEA  PVPGLD +AV+ +LL+ D V+H   ++K  + A   
Sbjct  76   SLSLQVIKLKEEIKKCKVQLEALAPVPGLDRNAVEAVLLEADGVDHDLRDVKIVHQAKQL  135

Query  294  --LQQELKKTQR  303
              L+Q ++K QR
Sbjct  136  RQLKQAIQKEQR  147

>PITG_01117
Length=101

 Score = 111 bits (277),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 0/99 (0%)

Query  630  MEQQNQQLKHEMEILRKTFRESMCEKDERITQLEHLHHATVHRASADLDINSNGMNQELL  689
            MEQQ QQLKHEM+ LRKTFR+++ EKD+ I +LE    +     S   D + N M+QEL 
Sbjct  1    MEQQQQQLKHEMDALRKTFRDAIREKDDHIAELEQQQLSMTQSGSTISDADVNAMSQELR  60

Query  690  DLQEENDFLRQEFDRLKVRYEALVKSPAVTIKKSSTRSK  728
            +LQEENDFLRQEFD+LK RYEAL   P  T+ +  +RSK
Sbjct  61   ELQEENDFLRQEFDKLKTRYEALTTKPPATVSRKKSRSK  99

>CCI45132
Length=577

 Score = 122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 95/290 (33%), Positives = 153/290 (53%), Gaps = 33/290 (11%)

Query  285  EELKSKNVALQQELKKTQRALVREVGDD--VPLEDIL------GNTDSTVSGASRRGRAQ  336
            ++LK  N  LQ ++KK  RAL +E+G D  +PL ++L       +T S +    +R R+Q
Sbjct  234  DDLKIHNDKLQSDMKKLHRALTQELGVDASMPLMELLEMYGPNQSTGSVIGEGGKRTRSQ  293

Query  337  HIVMLKAKVKKLQTQLVPLKSGSTSAGSQ-DSTNVATVI--DVDQRAQQDLSGQQMHRQK  393
             I++LKAKVK+L+ +L   +  ++S  S  ++TN+       +D +   +L  Q  H+QK
Sbjct  294  QIIVLKAKVKELKRRLALERRRTSSISSNLEATNLYEKPGGSIDAKVGSELVKQHEHKQK  353

Query  394  RVDQLTSQRDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDA  453
            ++DQL S  +    R+ +L  K  A ++R  IL++E++E + K QVL EKS  DD L+DA
Sbjct  354  QLDQLLSDNEQYRIRVEQLIGKLKASQSRTHILEQERKENKAKIQVLAEKSGTDDKLIDA  413

Query  454  LQRQLETWKGKLHEARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDR-----  508
            LQ Q+  WK K  +A+R  T   +  G+++         L  + ++H     G +     
Sbjct  414  LQAQVSLWKEKTQKAKRVHTDGNNITGTSTI--------LPSLSTSHSTSPRGHKSQNHS  465

Query  509  -----VSTPLTISGGAMPQP----SEASQYRAMAAEKERLAEVIRGLKSQ  549
                  +  ++I    M  P    SE ++YR +  E ERL  VIR LK Q
Sbjct  466  RSHHSSTAEVSIKQVEMAIPAIPVSETARYRQLHVENERLLCVIRELKKQ  515

 Score = 43.5 bits (101),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 47/74 (64%), Gaps = 5/74 (7%)

Query  236  TTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLDKDSVEHMCEELKSKNVA--  293
            +TL+S+   L++++K  +I LEA  PVPGLD + ++ +LL+ D++ H   ++K  + A  
Sbjct  78   STLSSQVIKLKEEIKKHKILLEALAPVPGLDRNILEAVLLEGDAMNHDLRDVKIVHQAKQ  137

Query  294  ---LQQELKKTQRA  304
               L+Q ++K QR 
Sbjct  138  LRQLKQLIQKEQRV  151

>CCI44828
Length=471

 Score = 111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 88/182 (48%), Gaps = 58/182 (32%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            +A+A+ +LD LVAKG   P R    P+E + V WRYG P +++ DLAY+KG++R    TP
Sbjct  249  LAEAKSQLDQLVAKGHHRPIRRGLEPNEIRNVAWRYGVPNFIIHDLAYLKGKTRCEQNTP  308

Query  61   LASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLL---  100
            L SY+E  CQT IM+AT K                 VNDGE++ GASI END  G +   
Sbjct  309  LESYIENYCQTYIMDATCKSNYRDWTSVHQNQFFVQVNDGEQIAGASIQENDTFGFICLR  368

Query  101  --YLGGIDI------------------------------------STVGKYRGVKGDGSR  122
              +LGGI                                      S  G+Y+GVKGDG  
Sbjct  369  SNFLGGIIANAQSAFSQAFTEGFPMEVLEVFTQPPRCHFSWRHWGSFSGRYKGVKGDGRM  428

Query  123  VE  124
            ++
Sbjct  429  IQ  430

>CCI10657
Length=491

 Score = 104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 71/119 (60%), Gaps = 17/119 (14%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            +  A+ EL  L+  G + PSR   +  E + V+WRYG P+++L D+ Y++G++R    TP
Sbjct  260  LCTARAELGKLLKSGKQRPSRRGLSADEVQQVQWRYGVPDFILYDITYIRGKTRNDQCTP  319

Query  61   LASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYL  102
            L SY+E CC + IM++T+K                 VNDGE++ G+ I ENDM GLLYL
Sbjct  320  LESYIESCCHSFIMDSTYKCKYQDWVSVQQNQFYITVNDGEKIDGSLIQENDMFGLLYL  378

>CCA22111
Length=515

 Score = 103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 71/116 (61%), Gaps = 17/116 (15%)

Query  4    AQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTPLAS  63
            A+ EL+ L+  G + PSR   +  + + ++WRYG P+++L D+ Y++G++R    TPL S
Sbjct  287  ARAELENLLKNGKQRPSRRGLSADDVQHLQWRYGVPDFILYDITYIRGKTRNDQNTPLES  346

Query  64   YVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYL  102
            Y+E CC + IM++T+K                 VNDGE++ G+ I ENDM GLLYL
Sbjct  347  YIESCCHSFIMDSTYKCKYQDWVSVQQQEFYITVNDGEKIDGSLIQENDMFGLLYL  402

>CCA23397
Length=552

 Score = 103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 71/116 (61%), Gaps = 17/116 (15%)

Query  4    AQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTPLAS  63
            A+ EL+ L+  G + PSR   +  + + ++WRYG P+++L D+ Y++G++R    TPL S
Sbjct  324  ARAELENLLKNGKQRPSRRGLSADDVQHLQWRYGVPDFILYDITYIRGKTRNDQNTPLES  383

Query  64   YVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLLYL  102
            Y+E CC + IM++T+K                 VNDGE++ G+ I ENDM GLLYL
Sbjct  384  YIESCCHSFIMDSTYKCKYQDWVSVQQQEFYITVNDGEKIDGSLIQENDMFGLLYL  439

>CCA17548
Length=471

 Score = 102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 88/182 (48%), Gaps = 58/182 (32%)

Query  1    MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP  60
            +A+A+ +L+ LVA+G + P+R     +E + V WRYG P +++ DLAY+KG++R    +P
Sbjct  249  LAEAKAQLEKLVAEGHRRPTRRGLESNEIRNVAWRYGVPNFIIHDLAYLKGKTRCEKSSP  308

Query  61   LASYVEECCQTLIMEATHK-----------------VNDGERVPGASILENDMLGLL---  100
            L SY+E  CQT IM+AT K                 VNDG+ + G+SI END  G +   
Sbjct  309  LESYIENYCQTYIMDATCKSNYSDWTSVHQDQFFVQVNDGDEIAGSSIQENDTFGFICLK  368

Query  101  --YLGGIDI------------------------------------STVGKYRGVKGDGSR  122
              +LGGI                                      S  G+Y+GVKGDG  
Sbjct  369  SNFLGGIIANAQSAFSQAFTKGFPMEVLEVFTQPPRCHFSWRHWGSFSGRYKGVKGDGRM  428

Query  123  VE  124
            ++
Sbjct  429  IQ  430

>PYAR_15970
Length=391

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 11/103 (11%)

Query  1    MAKAQQELDALVAKGAKVPSRV-MENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGT  59
            + +A++E+D LVA GAK P R  MEN    K  +WRYG PEYVL+DL Y+KG++R+ + T
Sbjct  201  LLEAKKEMDVLVAAGAKRPLRGGMEN---AKETQWRYGPPEYVLSDLEYIKGKTRDDETT  257

Query  60   PLASYVEECCQTLIMEATHKVNDGERVPGASILENDMLGLLYL  102
            PL S  +E           +VNDGER+ G  + END+ G+LYL
Sbjct  258  PLESVRQEYFYI-------QVNDGERISGHVLKENDLFGMLYL  293

>SPRG_13615
Length=345

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 103/193 (53%), Gaps = 33/193 (17%)

Query  224  RVQELQELTNANTTLTSEARDLRQQVKAL-QIQLEAQIPVPGLDIDAVQDMLLDKDSVEH  282
            ++ EL+    A  TL S+A    Q+++ L + +   ++P P  +I A + +         
Sbjct  158  KMAELERAVEAAQTLQSKAERALQRLQQLPRPEAAKKVPSPEKEIAASKKL---------  208

Query  283  MCEELKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGASRRGRAQHIVMLK  342
              EELK K  A   ELK+TQRAL REVGDDV L DIL  +DS      +RGRAQ IVMLK
Sbjct  209  --EELKLKCEAQAVELKRTQRALQREVGDDVALSDILDASDS-----GKRGRAQQIVMLK  261

Query  343  AKVKKLQ-TQLVPLKSGSTSAGSQDSTNVATVIDVDQRAQQDLSGQQMHRQKRVDQLTSQ  401
            AK+KKL+     PL +                 DVD++A+ DL+  ++ RQK++D+L   
Sbjct  262  AKIKKLERANPSPLDAPR---------------DVDRKAEDDLAATKLERQKQIDKLLDD  306

Query  402  RDDLEERLHRLTR  414
             + L E   +L +
Sbjct  307  SNALRESHEKLQK  319

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 5/88 (6%)

Query  217  QSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLD  276
            QS+ +WD + ++Q L + N  L +  +  +QQ+  LQ+ LEA  PVPGLD+D+ +D+L  
Sbjct  59   QSDFKWDGISDIQMLKHQNAELVAAIKSQKQQINELQLLLEAMEPVPGLDVDSFKDILQG  118

Query  277  KDSVEHMCEELKSKNVALQQELKKTQRA  304
             + V+H       +NV +  + KK ++A
Sbjct  119  SEIVDHDI-----RNVKIVHQAKKLRQA  141

>H257_09653
Length=498

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 11/90 (12%)

Query  1    MAKAQQELDALVAKGAKV-PSR-VMENPSEGK-----PV----EWRYGAPEYVLTDLAYV  49
            +A+A+ ELD L+A+   V P R ++E+ S        P+    EW +G P+Y LTDLAY+
Sbjct  272  LARAKYELDQLLAEPGTVRPYRGLVEDDSTCSVHPLLPIDDSTEWLHGRPDYTLTDLAYL  331

Query  50   KGRSREPDGTPLASYVEECCQTLIMEATHK  79
            KGRSR  D   +A+ +E   +  +M+  HK
Sbjct  332  KGRSRFHDPHSVATTLETALRIFVMDVAHK  361

>H310_11183
Length=489

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 50/95 (53%), Gaps = 14/95 (15%)

Query  1    MAKAQQELDALVAK-GAKVPSRVMENPSEGKP-------------VEWRYGAPEYVLTDL  46
            +A+A+ EL+ L+A+ G   P R +    +  P             +EW  G P+Y LTDL
Sbjct  261  LARAKYELEQLLAEPGTYRPFRGLVETHQNSPAECVRSLAPNTNTIEWLQGRPDYTLTDL  320

Query  47   AYVKGRSREPDGTPLASYVEECCQTLIMEATHKVN  81
            AY+KGR+R  + T + + +E   +  +M+  HK N
Sbjct  321  AYLKGRTRFHEPTSVEAILETALRIFVMDVAHKPN  355

>SDRG_07059
Length=616

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 2/79 (3%)

Query  3    KAQQELDALVA-KGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTPL  61
            +A+ +L AL A  G   P R +++  + +   W +G P+Y LTD+A+++GR+R    T  
Sbjct  345  QARSDLAALCALPGNYQPERGLDSFMDSR-TFWLHGPPDYALTDVAFLRGRTRAHGVTSF  403

Query  62   ASYVEECCQTLIMEATHKV  80
            A  +E   +T  ME THK 
Sbjct  404  AYEIETALRTFSMEVTHKA  422

>SPRG_09070
Length=621

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 2/79 (3%)

Query  3    KAQQELDALVA-KGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTPL  61
            +A+ +L AL A  G   P R +++  + +   W +G P+Y LTD+A+++GR+R    T  
Sbjct  350  QARSDLAALCALPGNYQPERGLDSFMDSR-TFWLHGPPDYALTDVAFLRGRTRAHGVTSF  408

Query  62   ASYVEECCQTLIMEATHKV  80
            A  +E   +T  ME THK 
Sbjct  409  AYEIETALRTFSMEVTHKA  427

>H310_01418
Length=490

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 54/108 (50%), Gaps = 14/108 (13%)

Query  15   GAKVPSR-VMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTPLASYVEECCQTLI  73
            G  VP R  +++PS    ++WR G P+Y L DLA+++G++       L   V+   +   
Sbjct  203  GQIVPFRGNLDDPS----IQWRIGKPDYALLDLAFLQGKTHNHPQQSLEWMVQNLMKKWE  258

Query  74   MEATHKVNDGERVPGASILENDMLGL-LYLG----GIDISTVGKYRGV  116
            ME +HK N  +     S + +DM  L + +G      D+   GKY G+
Sbjct  259  MEVSHKANLDQW----STMHSDMFTLQVNMGPPVTAADLHRSGKYNGL  302

>SPRG_06239
Length=470

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 6/80 (8%)

Query  4    AQQELDALVAK-GAKVPSR-VMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTPL  61
            A+ E+  L A  G  VP R  +++PS    VEWR G P+Y L +L +++G++       L
Sbjct  169  ARAEITKLQATLGDHVPMRSTLDDPS----VEWRVGKPDYTLVNLLFLQGKTYNHKPGSL  224

Query  62   ASYVEECCQTLIMEATHKVN  81
               V+   +T  ME +HK N
Sbjct  225  EWMVQNLIKTWEMEVSHKTN  244

>SDRG_01871
Length=466

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 6/80 (8%)

Query  4    AQQELDALVAK-GAKVPSR-VMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTPL  61
            A+ E+  L A  G  VP R  +++PS    VEWR G P+Y L +L +++G++       L
Sbjct  168  ARAEITKLQATLGDHVPMRSTLDDPS----VEWRVGKPDYTLVNLLFLQGKTYNHKPGSL  223

Query  62   ASYVEECCQTLIMEATHKVN  81
               V+   +T  ME  HK N
Sbjct  224  EWMVQNLIKTWEMEVCHKTN  243

>H257_06330
Length=6897

 Score = 39.7 bits (91),  Expect = 0.082, Method: Composition-based stats.
 Identities = 57/253 (23%), Positives = 103/253 (41%), Gaps = 22/253 (9%)

Query  349   QTQLVPLKSGSTSAGSQDS-TNVATVIDVDQRAQQDL--SGQQMHRQKRVDQLTSQRDDL  405
             + +L  L++ S    ++D  T +  + +V+ +  Q    S QQ    K  D++  +R+  
Sbjct  5764  KAELQALQAASEKKMAEDEWTRLKDIHEVELKQLQSTLDSEQQRQESKLKDRIRLRREQK  5823

Query  406   EERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRN-DDALVDALQRQLETWKGK  464
             E  L     + + +KARA +   E+QE   K ++  + ++  D+A+ D L RQ E     
Sbjct  5824  ERELALCKDQEEVVKARAAL---EEQERAEKVKLAAQLAKQADEAMHDELLRQEEAKNAA  5880

Query  465   LHEARRARTADGSTKGSASQEERTELERLRKIVSAHKGGGGGDRVSTPLTISGGAMPQPS  524
               +  +A     +   +      +EL+R+    S        D  +           Q  
Sbjct  5881  ELKLNQAAIESAAAAAAMDAFRASELDRVSMEYSNKMNQLHQDTANEA---------QTQ  5931

Query  525   EASQYRAMAAEKERLAEVIRGLKSQLEDKDKQLRVMHEQQGGTGLAPQASSQMAPSLSSL  584
             +A     MAA+K + A  ++        KDK+   + E+Q     A QA    A  L+ +
Sbjct  5932  KAKLEARMAAKKNKKAMELQA------KKDKEKEALLEKQRAEANALQARLADAERLAQV  5985

Query  585   PPIGDESVSRIPR  597
               I  E   + PR
Sbjct  5986  DAILHEQAKQTPR  5998

>H257_00365
Length=477

 Score = 38.5 bits (88),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 51/112 (46%), Gaps = 10/112 (9%)

Query  15   GAKVPSR-VMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTPLASYVEECCQTLI  73
            G  VP R  +++PS    + WR   PEY L DL++++G++       L   V+   +   
Sbjct  194  GQIVPHRGNVDDPS----IHWRISKPEYALLDLSFLQGKTYNHVPQSLEWMVQNLMKKWE  249

Query  74   MEATHKVNDGERV---PGASILENDMLGLLYLGGIDISTVGKYRGVKGDGSR  122
            ME +HK +  +     P    L+ +M     +   D+ T GKY G+     R
Sbjct  250  MEVSHKADIDQWTTVDPATFSLKVNMGPP--VTASDLHTSGKYNGLLSHCPR  299

>PHYRA_81814
Length=545

 Score = 37.4 bits (85),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 8/85 (9%)

Query  204  GVKSSQNQPRDI----FQSEIQWDRVQ-ELQELTNANTTLTSEARDLRQQVKALQ---IQ  255
              ++S+ Q +D+    +Q E+Q D +Q + Q+L+   +TLT E  +LR Q K L     Q
Sbjct  301  AAEASEAQVQDLSKLKYQHEMQIDHLQAQSQDLSQGRSTLTEEVDELRTQNKQLDQKVFQ  360

Query  256  LEAQIPVPGLDIDAVQDMLLDKDSV  280
             E QI    +  DA+Q  L DK+ V
Sbjct  361  QEKQINALQVRADALQQQLADKEDV  385

>PYAP_20890
Length=1343

 Score = 37.4 bits (85),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 45/79 (57%), Gaps = 4/79 (5%)

Query  394  RVDQLTSQRDDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDA  453
            R D+  ++  ++EE+L  +    D +K + + L+REK+E  +K    V +    ++ V  
Sbjct  182  RSDEHQAKEKEMEEKLAEV----DGMKGQVKTLEREKREAESKMIAQVTQKAKIESTVKE  237

Query  454  LQRQLETWKGKLHEARRAR  472
            L+ ++ET K +LH+ + AR
Sbjct  238  LKAEVETLKKQLHDVQEAR  256

>PYVX_22215
Length=1264

 Score = 35.4 bits (80),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 51/114 (45%), Gaps = 10/114 (9%)

Query  227   ELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLLDKD----SVEH  282
             E+  L   N    ++   +R ++  L+ + E       + I   +DML DKD    +VEH
Sbjct  968   EMSRLRKENEDQRAQMSKMRNEMDRLRSEKEVMAANHHVKIRQFEDMLRDKDKKLAAVEH  1027

Query  283   MCEELKSKN----VALQQELKKTQRALVREVGDDVPLEDIL--GNTDSTVSGAS  330
              C  L+       +  Q+ L + +R+L R +G    L   L   N  STV GAS
Sbjct  1028  ECVRLRENAGVPPLTRQKSLGRDKRSLFRTIGSKKNLSSDLPESNRASTVMGAS  1081

>HYAP_03316
Length=414

 Score = 34.7 bits (78),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 47/105 (45%), Gaps = 9/105 (9%)

Query  398  LTSQRDDLEERLHRLT---RKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDAL  454
            L+   DD+   +  L    R   A+   AQ+   +  E       +V  S + D ++DA+
Sbjct  251  LSVNPDDVPLHMRLLAQNQRDPTAIAVNAQLKKDDNGEIVPNVCEVVVVSLDRDNILDAI  310

Query  455  QRQLETWKGKLHEARRARTADGS------TKGSASQEERTELERL  493
             R L T KG + +A    TADG+       KGS   +ER E  RL
Sbjct  311  ARALTTMKGNILDADVMTTADGTLLDRFVVKGSFMSDERQEELRL  355

>PYAR_21544
Length=1019

 Score = 34.3 bits (77),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 39/63 (62%), Gaps = 6/63 (10%)

Query  401  QRDDLEERLHRLTRKYDALKARAQILDREKQETRNKF-----QVLVEKSRNDDALVDALQ  455
            Q D LE +L  +T++Y+A+ ++  +L+R+KQ+ R +      +V V K +N + ++  L+
Sbjct  815  QLDTLETKLDAMTKRYEAMASKVGVLERDKQDLRKQLAATETEVYVYK-KNMEEMIPKLR  873

Query  456  RQL  458
             +L
Sbjct  874  DEL  876

>PHYCA_553527
Length=551

 Score = 33.9 bits (76),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 4/76 (5%)

Query  209  QNQPRDIFQSEIQWDRVQ-ELQELTNANTTLTSEARDLRQQVKALQ---IQLEAQIPVPG  264
            Q   R+ +Q+E+Q D ++ + Q+L+   + L+ E  +LR Q K L     Q E QI    
Sbjct  305  QELSREKYQNEMQIDHLRAQSQDLSQGRSALSGEVEELRTQNKELDQKVFQQEKQINALQ  364

Query  265  LDIDAVQDMLLDKDSV  280
            +  DA+Q  L DK+ V
Sbjct  365  VRADALQQQLADKEDV  380

>PHYSO_342579
Length=165

 Score = 32.3 bits (72),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (52%), Gaps = 7/64 (11%)

Query  40   EYVLTDLAYVKGRSREPDGTPLASYVEECCQTLIMEATHKVNDGERVPGASILENDMLGL  99
            EY+  D  +VKGRSR   G P+A + +E    L   A  +V+ G R+   ++     LG+
Sbjct  82   EYIAGDGTFVKGRSR---GNPMADFSDEEDLLLYRLAKEQVDAGRRINWRTVW----LGM  134

Query  100  LYLG  103
             Y G
Sbjct  135  PYCG  138

>PITG_04910
Length=714

 Score = 33.1 bits (74),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 45/101 (45%), Gaps = 9/101 (9%)

Query  398  LTSQRDDLEERLHRLT---RKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDAL  454
            L+   DD+   +  L    R   A+   AQ+   +  E       +V  S + + ++DA+
Sbjct  277  LSVNPDDVPMHMRLLAQNQRDPTAIAVNAQLKKDDNGEIVPNVCEVVVVSLDRENILDAI  336

Query  455  QRQLETWKGKLHEARRARTADGS------TKGSASQEERTE  489
             R L T KG + +A    TADG+       KGS   EER E
Sbjct  337  TRALTTMKGNILDADVMTTADGTLLDRFVVKGSFMSEERQE  377

>PITG_12963
Length=727

 Score = 33.1 bits (74),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 14/125 (11%)

Query  216  FQSEIQWDRVQELQELTNANTTLTSEARDLRQQVKALQIQLEAQIPVPGLDIDAVQDMLL  275
            F S+ + + +Q LQE    N  LTSE   LR+++K    QLEA   V  L  D   + +L
Sbjct  266  FASKFKKNSMQILQE---ENAALTSENVKLREEIK----QLEALNAV--LQSDNSNNGML  316

Query  276  DK--DSVEHMCEE---LKSKNVALQQELKKTQRALVREVGDDVPLEDILGNTDSTVSGAS  330
            D   DSVE   +    L+++N+ LQ++++  Q A+      +  L   L N  S +    
Sbjct  317  DAHLDSVEFAQKRMRLLQAQNMQLQRQVRLLQEAMQAHDNAETNLMCALNNWRSVIEAGK  376

Query  331  RRGRA  335
               RA
Sbjct  377  EEARA  381

>PYIR_20635
Length=659

 Score = 32.7 bits (73),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (47%), Gaps = 17/66 (26%)

Query  657  ERITQLEHL--------HHATVHRASADLDINSNGMNQELLDLQEENDFLRQEFDRLKVR  708
            ERI +LE L         H  + R S DL +NS          Q++ + +  E DR+K  
Sbjct  573  ERIAKLEELLKDESKTKQHVEIERESIDLKLNSE---------QKKREEIHSELDRMKQE  623

Query  709  YEALVK  714
            YE L+K
Sbjct  624  YEKLIK  629

Lambda      K        H        a         alpha
   0.312    0.128    0.356    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 58239912390

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40