Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_508469111452002009742e-135
PHYSO_501475111452002009301e-128
PPTG_09250111452002009264e-128
PITG_13737111451991999031e-124
PYAP_24850945452002008622e-118
PHYRA_51797111451991998562e-117
HYAP_08503111452802008633e-117
PHYKE_5842111455502008771e-115
PYU1_G013641836652002008344e-114
PYIR_14437111452002008274e-113
PYIR_21169836652002008266e-113
PPTG_09275111662002008206e-112
PHYKE_4827111662002008153e-111
PITG_13761111662002008154e-111
PITG_13763111682002008137e-111
PYU1_G005991945452002008051e-109
PHYSO_503540111662002008024e-109
PHYSO_285972111672002008015e-109
PHYSO_285976836652002008015e-109
PHYSO_5001081001312002008015e-109
PYAP_251481017342002007972e-108
PYAP_21524945412002007921e-107
PHYRA_96097111662002007912e-107
PHYCA_512169111672002007884e-107
PHYCA_5084911001312002007884e-107
PYU1_G0059881001312002007842e-106
PYU1_G005989111452002007842e-106
PYU1_G005987945412002007832e-106
PHYRA_71949111672002007824e-106
PHYRA_71950111682002007782e-105
PHYCA_118176111662002007739e-105
PYU1_G005990111662002007572e-102
PYAP_245291013341992007442e-100
PITG_13762111672002007417e-100
PHYSO_285975473762001997382e-99
PHYSO_285974111682001997382e-99
PPTG_20266111672132007359e-99
PYIW_16204836652002007331e-98
PYIW_266101658952002007321e-98
PHYRA_71996693812002007303e-98
PPTG_17005435872002007294e-98
PPTG_17006435862002007286e-98
PPTG_03020748182002007278e-98
PYAP_245301013352581937321e-97
PHYCA_553014693812002007252e-97
PHYRA_81696473762002007242e-97
PHYKE_1631748182002007234e-97
CCI42280111452002007182e-96
PYVX_14995111672002007163e-96
PHYCA_118207473762002007155e-96
CCA15845111452002007103e-95
CCA274111579022002007103e-95
PHYCA_132728435862001997103e-95
PHYCA_124158426492001997103e-95
PHYCA_19840376012001997103e-95
PHYCA_132729435872001997052e-94
PYAP_251491017352002006973e-93
PYU1_G001466748182022006922e-92
PPTG_00540180062011986895e-92
PYVX_13848748182002006861e-91
PHALS_11795111451831836814e-91
PHYRA_71993508412011986827e-91
PYIR_25908860551992006522e-86
PHYSO_492858180062011986523e-86
PHYSO_491760576692011986496e-86
PYU1_G002524860551992006489e-86
PYAR_19739945412042006472e-85
PYAP_215251001311911916409e-85
PHYCA_121985511031991986304e-83
PHYSO_327921508412092006315e-83
PHYKE_35111671601606257e-83
PHYRA_72407511031991986202e-81
PHYKE_8238771941991986141e-80
PHYCA_553010452482002006132e-80
PYVX_220781116512672716597e-79
PYAR_24476111452131486048e-79
PITG_12444101492001646011e-78
PYAR_22252111672012015838e-76
PPTG_03053452482252005822e-75
PHYRA_82142748182002005776e-75
PHYCA_508489836651562005432e-70
PYAR_176241031272152184805e-60
PYIW_26124748181391394292e-53
PYVX_245031013351131134221e-52
PITG_19721748181471994242e-52
PPTG_202651116889893628e-44
PYIR_2530985567103783437e-41
PYVX_245418124382823374e-40
PYIW_24901860551231243404e-40
PYAR_177319454563633121e-36
PYIW_2566616517675753095e-36
PYIW_2681716610580973096e-36
PYIR_1643374818102882933e-33
PITG_224621723764642764e-31
PHYSO_5259257481873742522e-27
PYVX_220818366545452005e-20
PHYKE_521910013138381605e-14
PHYKE_48268124338381404e-11
PHYSO_32987751103115321202e-07
PITG_11840970410626810.033
PYVX_206896824397101760.48
CCA203001381958648712.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_508469

Length=200
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHYCA_508469                                                          379     2e-135
PHYSO_501475                                                          362     1e-128
PPTG_09250                                                            361     4e-128
PITG_13737                                                            352     1e-124
PYAP_24850                                                            336     2e-118
PHYRA_51797                                                           334     2e-117
HYAP_08503                                                            337     3e-117
PHYKE_5842                                                            342     1e-115
PYU1_G013641                                                          325     4e-114
PYIR_14437                                                            323     4e-113
PYIR_21169                                                            322     6e-113
PPTG_09275                                                            320     6e-112
PHYKE_4827                                                            318     3e-111
PITG_13761                                                            318     4e-111
PITG_13763                                                            317     7e-111
PYU1_G005991                                                          314     1e-109
PHYSO_503540                                                          313     4e-109
PHYSO_285972                                                          313     5e-109
PHYSO_285976                                                          313     5e-109
PHYSO_500108                                                          313     5e-109
PYAP_25148                                                            311     2e-108
PYAP_21524                                                            309     1e-107
PHYRA_96097                                                           309     2e-107
PHYCA_512169                                                          308     4e-107
PHYCA_508491                                                          308     4e-107
PYU1_G005988                                                          306     2e-106
PYU1_G005989                                                          306     2e-106
PYU1_G005987                                                          306     2e-106
PHYRA_71949                                                           305     4e-106
PHYRA_71950                                                           304     2e-105
PHYCA_118176                                                          302     9e-105
PYU1_G005990                                                          296     2e-102
PYAP_24529                                                            291     2e-100
PITG_13762                                                            290     7e-100
PHYSO_285975                                                          288     2e-99 
PHYSO_285974                                                          288     2e-99 
PPTG_20266                                                            287     9e-99 
PYIW_16204                                                            286     1e-98 
PYIW_26610                                                            286     1e-98 
PHYRA_71996                                                           285     3e-98 
PPTG_17005                                                            285     4e-98 
PPTG_17006                                                            285     6e-98 
PPTG_03020                                                            284     8e-98 
PYAP_24530                                                            286     1e-97 
PHYCA_553014                                                          283     2e-97 
PHYRA_81696                                                           283     2e-97 
PHYKE_1631                                                            283     4e-97 
CCI42280                                                              281     2e-96 
PYVX_14995                                                            280     3e-96 
PHYCA_118207                                                          280     5e-96 
CCA15845                                                              278     3e-95 
CCA27411                                                              278     3e-95 
PHYCA_132728                                                          278     3e-95 
PHYCA_124158                                                          278     3e-95 
PHYCA_19840                                                           278     3e-95 
PHYCA_132729                                                          276     2e-94 
PYAP_25149                                                            273     3e-93 
PYU1_G001466                                                          271     2e-92 
PPTG_00540                                                            270     5e-92 
PYVX_13848                                                            268     1e-91 
PHALS_11795                                                           266     4e-91 
PHYRA_71993                                                           267     7e-91 
PYIR_25908                                                            255     2e-86 
PHYSO_492858                                                          255     3e-86 
PHYSO_491760                                                          254     6e-86 
PYU1_G002524                                                          254     9e-86 
PYAR_19739                                                            253     2e-85 
PYAP_21525                                                            251     9e-85 
PHYCA_121985                                                          247     4e-83 
PHYSO_327921                                                          247     5e-83 
PHYKE_35                                                              245     7e-83 
PHYRA_72407                                                           243     2e-81 
PHYKE_8238                                                            241     1e-80 
PHYCA_553010                                                          240     2e-80 
PYVX_22078                                                            258     7e-79 
PYAR_24476                                                            237     8e-79 
PITG_12444                                                            236     1e-78 
PYAR_22252                                                            229     8e-76 
PPTG_03053                                                            228     2e-75 
PHYRA_82142                                                           226     6e-75 
PHYCA_508489                                                          213     2e-70 
PYAR_17624                                                            189     5e-60 
PYIW_26124                                                            169     2e-53 
PYVX_24503                                                            167     1e-52 
PITG_19721                                                            167     2e-52 
PPTG_20265                                                            144     8e-44 
PYIR_25309                                                            136     7e-41 
PYVX_24541                                                            134     4e-40 
PYIW_24901                                                            135     4e-40 
PYAR_17731                                                            124     1e-36 
PYIW_25666                                                            123     5e-36 
PYIW_26817                                                            123     6e-36 
PYIR_16433                                                            117     3e-33 
PITG_22462                                                            110     4e-31 
PHYSO_525925                                                          101     2e-27 
PYVX_22081                                                            81.6    5e-20 
PHYKE_5219                                                            66.2    5e-14 
PHYKE_4826                                                            58.5    4e-11 
PHYSO_329877                                                          50.8    2e-07 
PITG_11840                                                            35.8    0.033 
PYVX_20689                                                            33.9    0.48  
CCA20300                                                              32.0    2.6   

>PHYCA_508469
Length=200

 Score = 379 bits (974),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP
Sbjct  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTIGG
Sbjct  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTIGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFATVAKKLSA
Sbjct  181  LDVAKVQGESFATVAKKLSA  200

>PHYSO_501475
Length=200

 Score = 362 bits (930),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 194/200 (97%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYSTYGHIATMAESVK+GVESV+GVTAEIYQVQETLSEEIL KMHA PK+DYP
Sbjct  1    MTNVAIIYYSTYGHIATMAESVKEGVESVEGVTAEIYQVQETLSEEILGKMHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPD+LKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKP GIFFSTGT GG
Sbjct  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPVGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFAGVAKKLSA  200

>PPTG_09250
Length=200

 Score = 361 bits (926),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 195/200 (98%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGHIATMAESVKKGVESVDGVTAE+YQVQETLSEEILTKMHA PK+D+P
Sbjct  1    MTKIAIIYYSTYGHIATMAESVKKGVESVDGVTAEVYQVQETLSEEILTKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPDILKNADGVLLG PTRFGSMPAQVKALFDACGGLWA GALVGKPAGIFFSTGT+GG
Sbjct  61   VATPDILKNADGVLLGFPTRFGSMPAQVKALFDACGGLWAGGALVGKPAGIFFSTGTLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFN+EEIHGGSPWGAGT+AGGDGSRQPS+LE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNLEEIHGGSPWGAGTIAGGDGSRQPSQLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFAGVAKKLSA  200

>PITG_13737
Length=199

 Score = 352 bits (903),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 192/199 (96%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGHIATMAES+KKGVESVDGVTAEIYQVQETLSEEILTKMHA PK+D+P
Sbjct  1    MTKIAIIYYSTYGHIATMAESIKKGVESVDGVTAEIYQVQETLSEEILTKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPD +KNADGVL GIPTRFGS PAQVKALFDACGGLWAAGALVGKPAGIFFSTGT+GG
Sbjct  61   VATPDTIKNADGVLFGIPTRFGSFPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFLTHQGM+FVPLGYRSPLLFN++EIHGGSPWGAGT+AGGDGSRQPSKLE
Sbjct  121  GQETTAFTAVTFLTHQGMSFVPLGYRSPLLFNLDEIHGGSPWGAGTIAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLS  199
            LDVAK QGESFA VAKKLS
Sbjct  181  LDVAKAQGESFAGVAKKLS  199

>PYAP_24850
Length=200

 Score = 336 bits (862),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 184/200 (92%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGHI  MAE+VK GVE V GVTAEIYQV ETL EE+L+KMHAAPK+DYP
Sbjct  1    MTKIAIIYYSTYGHIVQMAEAVKAGVELVTGVTAEIYQVAETLPEEVLSKMHAAPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATP+ LK ADG+L G PTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATPETLKEADGILFGFPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFLTHQGMTFVPLGYR PLLFN++E+HGGSPWGAGTLAGGDGSRQPSKLE
Sbjct  121  GQETTAFTAITFLTHQGMTFVPLGYRCPLLFNLDEVHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAK QGESFA VAKKLSA
Sbjct  181  LDVAKAQGESFANVAKKLSA  200

>PHYRA_51797
Length=199

 Score = 334 bits (856),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTNIAIIYYSTYGHIA MAESVK GVE+VDGVTAEIYQV+ETLSEEIL KMHAAPK+D+P
Sbjct  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPD+LKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFLTHQGMTFVPLGYRSPLLFNM+EIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLS  199
            LDVAKVQGESFA VAKKLS
Sbjct  181  LDVAKVQGESFAGVAKKLS  199

>HYAP_08503
Length=280

 Score = 337 bits (863),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 187/200 (94%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGHIA MAES+K GVESV G TA++YQVQETLS+E+L+KMHA  K+D+P
Sbjct  80   MTKIAIIYYSTYGHIAKMAESIKAGVESVAGATADVYQVQETLSDEVLSKMHAPSKQDHP  139

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPD+LKNADGVLLGIPTRFGSMPAQVKALFDACGGLW AGALVGKPAGIFFSTGT GG
Sbjct  140  VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWTAGALVGKPAGIFFSTGTQGG  199

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFLTHQGMTFVPLGYRSPLLFNM+EIHGGSPWGAG LAG DGSRQPS+LE
Sbjct  200  GQETTAFTTVTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGNLAGTDGSRQPSQLE  259

Query  181  LDVAKVQGESFATVAKKLSA  200
             DVAKVQGESFA VAKKLS+
Sbjct  260  KDVAKVQGESFAQVAKKLSS  279

>PHYKE_5842
Length=550

 Score = 342 bits (877),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 186/200 (93%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTY HIA MAES+K+GVESV G TAE+YQ+QETL EEIL KMHA PK+D+P
Sbjct  351  MTKIAIIYYSTYSHIAKMAESIKEGVESVSGTTAEVYQIQETLPEEILAKMHAPPKKDHP  410

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPDILKNADGVL GIPTRFGSMPAQVKALFDACGGLWA+G LVGKPAGIFFSTGT+GG
Sbjct  411  VATPDILKNADGVLFGIPTRFGSMPAQVKALFDACGGLWASGGLVGKPAGIFFSTGTMGG  470

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFLTHQGMTFVPLGYRSPLLFNM+EIHGGSPWGAGTLAG DGSRQPS LE
Sbjct  471  GQETTAFTTITFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSTLE  530

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAK QGESFA VAKKLSA
Sbjct  531  LDVAKKQGESFAEVAKKLSA  550

>PYU1_G013641
Length=200

 Score = 325 bits (834),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 182/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYSTYGHIA MAE VK+GVESV GVTA IYQV ETLS+EIL KMHAAPK+D+P
Sbjct  1    MTNVAIIYYSTYGHIAKMAEKVKEGVESVAGVTATIYQVPETLSDEILAKMHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LKNADG+L G PTRFG+ PAQVKALFDA GGLW+ GALVGKPAG FFSTGT GG
Sbjct  61   IATPDVLKNADGILFGFPTRFGTFPAQVKALFDATGGLWSTGALVGKPAGFFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFLTHQG+TFVPLGYRSPLLF+ +EIHGGSPWGAGT AG DGSRQPS LE
Sbjct  121  GQETTAFTAVTFLTHQGLTFVPLGYRSPLLFSFDEIHGGSPWGAGTYAGPDGSRQPSTLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PYIR_14437
Length=200

 Score = 323 bits (827),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 182/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYSTYGHIAT+AE VK+GVESV+GVTA IYQVQETL E +L  +HAAPK+D+P
Sbjct  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LK ADGVL G PTRFGS+P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG  G 
Sbjct  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFTS+TFL HQGMT+VPLGYRSPLLFN EEIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA +AKKL+A
Sbjct  181  LDVAKVQGESFAQIAKKLAA  200

>PYIR_21169
Length=200

 Score = 322 bits (826),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 183/200 (92%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGHIA MAE++K+GVESVDGVTAEIYQ+ ETL EE+L KMHAAPK+D+P
Sbjct  1    MTKIAIVYYSTYGHIAKMAEAIKEGVESVDGVTAEIYQIAETLPEEVLAKMHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LK ADG+L G PTRFGSMPAQVKALFD+ GGLW +G LVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSMPAQVKALFDSTGGLWQSGGLVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA+T++TFL HQG+TFVPLGYRSPLLF+ EEIHGGSPWGAG+ AG DGSRQPSKLE
Sbjct  121  GQETTAYTALTFLAHQGLTFVPLGYRSPLLFSFEEIHGGSPWGAGSYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PPTG_09275
Length=200

 Score = 320 bits (820),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 182/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGHIA +AE+ KKGVESVDGVTAEIYQVQETLS+EIL KMHAAPK+D+P
Sbjct  1    MAKIAIIYYSTYGHIAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D LK ADG+L G PTRFGS+PAQVKALFD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATVDTLKEADGILFGFPTRFGSLPAQVKALFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+TFVPLGYR+P LFNM+EIHGGSPWGAGTLAGGDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA VAKKL+A
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PHYKE_4827
Length=200

 Score = 318 bits (815),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYSTYGHIAT+A SVK GVESV GV A +YQVQETLSEEILTKMHA PK+DYP
Sbjct  1    MTNVAIIYYSTYGHIATLANSVKAGVESVPGVKANVYQVQETLSEEILTKMHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VAT + LK AD +L G PTRFGS PAQVKALFD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATAETLKEADAILFGFPTRFGSFPAQVKALFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+T+VPLGYR+P LFNM+EIHGGSPWGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTYVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA VAKKLSA
Sbjct  181  LTVATTQGKSFAEVAKKLSA  200

>PITG_13761
Length=200

 Score = 318 bits (815),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 181/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGH+A +AE+ KKGVESVDGVTAEIYQVQETLS+EIL KMHAAPK+D+P
Sbjct  1    MAKIAIIYYSTYGHVAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D LK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATLDTLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFL HQG+TFVPLGYR+P LFNM+E+HGGSPWGAGTLAGGDGSRQPSKLE
Sbjct  121  GQETTAFTAVTFLAHQGLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA VAKKL+A
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PITG_13763
Length=200

 Score = 317 bits (813),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 181/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGHIA +AE+ KKGVESVDGVTAEIYQVQETLS+EIL KMHAAPK+D+P
Sbjct  1    MATIAIIYYSTYGHIAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D LK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATLDTLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+TFVPLGYR+P LFNM+E+HGGSPWGAGTLAGGDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA VAKKL+A
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PYU1_G005991
Length=200

 Score = 314 bits (805),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 181/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGHIA MAE +K+GVE V GV+AEIYQV ETLS+E+LTKMHA PK+D+P
Sbjct  1    MTRIAIVYYSTYGHIAKMAEKIKEGVELVTGVSAEIYQVAETLSDEVLTKMHAVPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D+LK ADG+L GIPTRFGSMPAQVKALFD+ GGLW  GAL+GKPAGIFFSTGT GG
Sbjct  61   IATADVLKEADGILFGIPTRFGSMPAQVKALFDSTGGLWGTGALIGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFTS+TFLTHQG+TFVPLGYR+PL+F+M+EIHGGSPWGAGT AG DGSRQP+ LE
Sbjct  121  GQETTAFTSITFLTHQGLTFVPLGYRTPLMFSMDEIHGGSPWGAGTYAGPDGSRQPTDLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            + VAKVQGESFA VAKKLSA
Sbjct  181  MTVAKVQGESFAEVAKKLSA  200

>PHYSO_503540
Length=200

 Score = 313 bits (802),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGHIA +AES K+G ESV+GVTAEIYQ+QETL EE+LTKMHA PK+D+P
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VAT D+LK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+TFVPLGYR+P LFNM+EIHGGSPWGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA VAKKL+A
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PHYSO_285972
Length=200

 Score = 313 bits (801),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAI+YYS Y HI+TMAE+VKKGVESVDGVTAEIYQV ETL EE+LT +HAAPK+DYP
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGVESVDGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+TFVPLGYR+P L NMEEIHGGS WGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYSO_285976
Length=200

 Score = 313 bits (801),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGHIA +AES K+G ESV+GVTAEIYQ+QETL EE+LTKMHA PK+D+P
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VAT D+LK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+TFVPLGYR+P LFNM+EIHGGSPWGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYSO_500108
Length=200

 Score = 313 bits (801),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGHIA +AES K+G ESV+GVTAEIYQ+QETL EE+LTKMHA PK+D+P
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VAT D+LK ADG+L G PTRFGS+PAQVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+TFVPLGYR+P LFNM+EIHGGSPWGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PYAP_25148
Length=200

 Score = 311 bits (797),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 183/200 (92%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGHI  +AES+K+GVE V GV A IYQV ETL EE+L+KMHAAPK+DYP
Sbjct  1    MTKIAIVYYSTYGHIVQLAESIKEGVEKVAGVEATIYQVAETLPEEVLSKMHAAPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATP+ LK ADG+L G PTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   VATPETLKEADGILFGFPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFLTH GMTFVPLGYRSPLLFNMEE+HGGSPWG GTLAGGDGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLTHHGMTFVPLGYRSPLLFNMEEVHGGSPWGTGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFANVAKKLSA  200

>PYAP_21524
Length=200

 Score = 309 bits (792),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 177/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGHI  +AES+K+GVE V+GV A IYQV ETL E+IL+ +HA PK+DYP
Sbjct  1    MTKIAIIYYSTYGHIVQLAESIKEGVEKVEGVEATIYQVPETLPEDILSAIHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATP+ LK ADG+L G PTRFG+MP+Q+KA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGTMPSQIKAFFDSTGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL H GMT+VPLGYRSPLLFNMEE+HGGS WG GTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHHGMTYVPLGYRSPLLFNMEEVHGGSAWGTGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFANVAKKLSA  200

>PHYRA_96097
Length=200

 Score = 309 bits (791),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGH+A +AE+ K+G+ESVDGVTAEIYQV ETL EE+LT++HAAPK+D+P
Sbjct  1    MAKIAIIYYSTYGHVAKLAEAAKEGIESVDGVTAEIYQVAETLPEELLTQIHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D+LK ADG+L G PTRFGS+P+QVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATVDVLKEADGILFGFPTRFGSLPSQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+TFVPLGYR+P LFNM+EIHGGSPWGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA VAKKL+A
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PHYCA_512169
Length=200

 Score = 308 bits (788),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAI+YYS Y HI+TMAE+VKKG+ESV+GVTAEIYQV ETL EE+LT +HAAPK+DYP
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGIESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATP+ LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQGMT+VPLGYR+P L NMEEIHGGS WGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYCA_508491
Length=200

 Score = 308 bits (788),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAI+YYS Y HI+TMAE+VKKG+ESV+GVTAEIYQV ETL EE+LT +HAAPK+DYP
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGIESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATP+ LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQGMT+VPLGYR+P L NMEEIHGGS WGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PYU1_G005988
Length=200

 Score = 306 bits (784),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGHIA MAESVK+GVESV+GVTAEIYQVQETLSE++L K++AAPK+D+P
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQVQETLSEDVLAKLYAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LK ADG+L G PTRFGS PAQVKALFD+ GGLW+ GALVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKALFDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+T+VPLGYRSPLLFN EEIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PYU1_G005989
Length=200

 Score = 306 bits (784),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGHIA MAESVK+GVESV+GVTAEIYQVQETLSE++L K++AAPK+D+P
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQVQETLSEDVLAKLYAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LK ADG+L G PTRFGS PAQVKALFD+ GGLW+ GALVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKALFDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+T+VPLGYRSPLLFN EEIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PYU1_G005987
Length=200

 Score = 306 bits (783),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 175/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGH+  +A  +K+GV SV+GVTAE+YQV ETL EE+L KMHA PK+D+P
Sbjct  1    MTKIAIVYYSTYGHVVQLANVIKEGVGSVEGVTAELYQVAETLPEEVLAKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LK ADG+L G+PTRFGS PAQ+KA FD+ GGLW  GALVGKPAG+FF+TG  GG
Sbjct  61   IATPDVLKEADGILFGLPTRFGSFPAQIKAFFDSTGGLWQVGALVGKPAGVFFTTGVQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA+T++TFL+  GMT+VPLGYRSPLLFN EEIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAYTALTFLSQHGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGSDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PHYRA_71949
Length=200

 Score = 305 bits (782),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 176/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAI+YYS Y HI+TMAE+VK GVESV+GVTAEIYQV ETL EE+LT +HAAPK+DYP
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKAGVESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATP+ LK ADG+L G PTRFGS+PAQ+KA FD+CGGLWA GAL GKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPAQMKAFFDSCGGLWATGALTGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFLTHQGMT+VPLGYR+P L NMEEIHGGS WGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLTHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYRA_71950
Length=200

 Score = 304 bits (778),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 175/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAI+YYS Y HI+TMAE VK GVESV+GVTAEIYQV ETL EE+LT +HAAPK+DYP
Sbjct  1    MAKIAIVYYSCYNHISTMAEIVKAGVESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATP+ LK ADG+L G PTRFGS+PAQ+KA FD+CGGLWA GAL GKPAGIFFSTGT GG
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPAQMKAFFDSCGGLWATGALTGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFLTHQGMT+VPLGYR+P L NMEEIHGGS WGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLTHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYCA_118176
Length=200

 Score = 302 bits (773),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGH+A +AE+ K+G+ESV GVTAEIYQV ETL EE+LT +HAAPK+D+P
Sbjct  1    MAKIAIIYYSTYGHVAKLAEAAKEGIESVAGVTAEIYQVAETLPEELLTAIHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D+LK ADG+L G PTRFGS+P+QVKA FD+ GGLWAAGALVGKPAGIFFSTGT GG
Sbjct  61   IATVDVLKEADGILFGFPTRFGSLPSQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+TFVPLGYR+P LFNM+EIHGGSPWGAGTLA GDGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG++FA V KKL+A
Sbjct  181  LTVATTQGKTFAEVTKKLAA  200

>PYU1_G005990
Length=200

 Score = 296 bits (757),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 180/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGHIA MAESVK+GVESV+GVTAEIYQ+ ETL EE+L K+HAAPK+D+P
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQIAETLPEEVLAKLHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LK ADG+L G PTRFGS PAQVK+  D+ GGLW+ GALVGKPAGIFFSTGT GG
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKSFLDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQG+T+VPLG RSPLLFN EEIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGCRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PYAP_24529
Length=199

 Score = 291 bits (744),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 171/200 (86%), Gaps = 1/200 (1%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IA+IY+STYGHI  MAE++K+G+E  DG    +YQV ETL EE+LTKMHA PK+D+P
Sbjct  1    MTKIAVIYFSTYGHIVKMAEAIKEGIEKADGTQVTLYQVAETLPEEVLTKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VA  D LK+AD +L G PTRFG+ P+QVKA FD+ G  WA GALVGKPAGIFFSTGT GG
Sbjct  61   VANLDTLKDADAILFGFPTRFGTFPSQVKAFFDSTGSFWATGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFLTH GMT+VPLGYRSPL+FN+ E+HGGSPWGAGTLAG DGSRQPS+LE
Sbjct  121  GQETTAFTALTFLTHHGMTYVPLGYRSPLVFNL-EVHGGSPWGAGTLAGKDGSRQPSELE  179

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA VAKKLSA
Sbjct  180  LDVAKVQGESFAMVAKKLSA  199

>PITG_13762
Length=200

 Score = 290 bits (741),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAI+YYSTY H++T+AE++K+GVESVDGVTAEIYQV ETL EE+LT++HAAPK+DYP
Sbjct  1    MAKIAIVYYSTYNHVSTLAETIKEGVESVDGVTAEIYQVAETLPEELLTQIHAAPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD LK ADG+L G PTRFGS+P+Q+KA FD+CGGLW AGALVGKPAGIFFSTGT GG
Sbjct  61   IATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWGAGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA T++TFL HQG+T+VPLGYR+P L NMEEIHGGS WGAGTLAGGDGSRQPSKLE
Sbjct  121  GQETTALTTLTFLAHQGLTYVPLGYRAPELANMEEIHGGSAWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  181  LSVATTQGKSFAEIAKKLAA  200

>PHYSO_285975
Length=200

 Score = 288 bits (738),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 178/199 (89%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYSTYGHIAT+AESVK GVESV GV A +YQV ETLSEEILTKMHA PK+DYP
Sbjct  1    MTNVAIIYYSTYGHIATLAESVKAGVESVSGVKATVYQVAETLSEEILTKMHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATP+ LK AD +L G PTRFG+ PAQVKALFD+CGGLWA GAL+GKPAGIFFSTGT+GG
Sbjct  61   VATPETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGALIGKPAGIFFSTGTLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETT+FT+VTFLTHQGMTFVPLG+R+P +FN+EE+HGGSPWGAG +AGGDGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLTHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFATVAKKLS  199
              +A  QG+SFA +AKKLS
Sbjct  181  KAIATTQGKSFAEIAKKLS  199

>PHYSO_285974
Length=200

 Score = 288 bits (738),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 178/199 (89%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYSTYGHIAT+AESVK GVESV GV A +YQV ETLSEEILTKMHA PK+DYP
Sbjct  1    MTNVAIIYYSTYGHIATLAESVKAGVESVSGVKATVYQVAETLSEEILTKMHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATP+ LK AD +L G PTRFG+ PAQVKALFD+CGGLWA GAL+GKPAGIFFSTGT+GG
Sbjct  61   VATPETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGALIGKPAGIFFSTGTLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETT+FT+VTFLTHQGMTFVPLG+R+P +FN+EE+HGGSPWGAG +AGGDGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLTHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFATVAKKLS  199
              +A  QG+SFA +AKKLS
Sbjct  181  KAIATTQGKSFAEIAKKLS  199

>PPTG_20266
Length=213

 Score = 287 bits (735),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 180/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAI+YYSTY H++TMAE++KKG+ESV+GVTAEIYQV ETL EE+L ++HAAPK+DYP
Sbjct  14   MAKIAIVYYSTYNHVSTMAETIKKGIESVEGVTAEIYQVAETLPEELLAQIHAAPKKDYP  73

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWA GALVGKPAGIFFSTGT GG
Sbjct  74   IATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWATGALVGKPAGIFFSTGTQGG  133

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFLTHQGMT+VPLGYR+  L NM+EIHGGSPWG+GTLAGGDGSRQPSKLE
Sbjct  134  GQETTAFTTLTFLTHQGMTYVPLGYRASELSNMDEIHGGSPWGSGTLAGGDGSRQPSKLE  193

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  194  LAVATTQGKSFAEIAKKLAA  213

>PYIW_16204
Length=200

 Score = 286 bits (733),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 174/200 (87%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  +AI+YYSTYGHIA MAE VK+GVESV+GVTAEIYQ+ ETL EE+L  MHA PK+D+P
Sbjct  1    MAKVAIVYYSTYGHIAKMAEQVKEGVESVEGVTAEIYQISETLPEEVLAMMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD LK ADG+L G PTRFGS PAQVKALFD+ GGLW  G LVGKPAG+FFSTGT GG
Sbjct  61   IATPDALKEADGILFGFPTRFGSFPAQVKALFDSTGGLWQTGGLVGKPAGVFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TF  HQG+T+VPLGYRSPLLF+ +EIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFFAHQGLTYVPLGYRSPLLFSFDEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA V KKL+A
Sbjct  181  LDVAKVQGESFAQVTKKLAA  200

>PYIW_26610
Length=200

 Score = 286 bits (732),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 168/200 (84%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  +AI+YYSTYGHIA MAE VK+GV+SV+GVT +IYQV ETL +++L+KMH  PK+DYP
Sbjct  1    MVKVAIVYYSTYGHIAAMAEKVKEGVDSVEGVTGKIYQVAETLPQDVLSKMHTPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATP++LK ADG+L G+PTRFGS PAQ+K LFDA GGLW  G LVGKP G+FFST    G
Sbjct  61   IATPEVLKEADGILFGMPTRFGSFPAQMKTLFDATGGLWQTGGLVGKPIGVFFSTAAQNG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TF  H G+T+VPLG+RS LL + +EIHGGSPWG GTLAG DGSRQPS+LE
Sbjct  121  GQETTAFTALTFFAHHGLTYVPLGFRSRLLLDFKEIHGGSPWGVGTLAGIDGSRQPSQLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
             DVAKVQGESFA +AKKL+A
Sbjct  181  PDVAKVQGESFAQIAKKLAA  200

>PHYRA_71996
Length=200

 Score = 285 bits (730),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 169/200 (85%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYS YGH+A +A S+K GV SV GV A +YQVQETLS+++   +HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVQASVYQVQETLSDDLRKVLHAPPKSDLP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPD+LKNADG+LLG PTRFG +PAQVK LFDACGGLWA GAL+GKP G+FFSTG++GG
Sbjct  61   VATPDVLKNADGILLGFPTRFGMLPAQVKGLFDACGGLWANGALIGKPCGVFFSTGSLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA +   F+ H GMTFVPLGYRSPL+   EE+HGGSPWGAGTLA GDGSRQP++LE
Sbjct  121  GQETTAMSMTPFMAHHGMTFVPLGYRSPLIGTNEEVHGGSPWGAGTLANGDGSRQPTELE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L++AK+QG+SFA + KKLS+
Sbjct  181  LEIAKIQGQSFAEITKKLSS  200

>PPTG_17005
Length=200

 Score = 285 bits (729),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 167/200 (84%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGH+A +A + KKG+ESV GVTA IYQVQETL EE+LTKMHA PK D+P
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIESVGGVTATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D LK ADG+L G P RFGSMPAQVKA FD+CG LWA GALVGK  G+FFSTGT GG
Sbjct  61   IATIDTLKEADGILFGFPCRFGSMPAQVKAFFDSCGSLWATGALVGKTGGLFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFL HQG+T+VPLGYR   L NM+E+HGGSPWGAGTLA  DGSRQPS+LE
Sbjct  121  GQETTAFTAVTFLAHQGLTYVPLGYRGKELLNMDEMHGGSPWGAGTLAKSDGSRQPSELE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L +A  QG+SFA V KKL+A
Sbjct  181  LALATTQGKSFAEVTKKLAA  200

>PPTG_17006
Length=200

 Score = 285 bits (728),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 167/200 (84%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGH+A +A + KKG+ESV GVTA IYQVQETL EE+LTKMHA PK D+P
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIESVGGVTATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D LK ADG+L G P RFGSMPAQVKA FD+CG LWA GALVGK  G+FFSTGT GG
Sbjct  61   IATIDTLKEADGILFGFPCRFGSMPAQVKAFFDSCGSLWATGALVGKTGGLFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFL HQG+T++PLGYR   L NM+E+HGGSPWGAGTLA  DGSRQPS+LE
Sbjct  121  GQETTAFTAVTFLAHQGLTYIPLGYRGKELLNMDEMHGGSPWGAGTLAKSDGSRQPSELE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L +A  QG+SFA V KKL+A
Sbjct  181  LALATTQGKSFAEVTKKLAA  200

>PPTG_03020
Length=200

 Score = 284 bits (727),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 166/200 (83%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYS YGH+A +A S+K GV SV GV A +YQ+QETL++++L K+HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVKASVYQIQETLNDDLLKKLHAPPKPDLP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPD+LKNADG+LLG PTRFG +P QVK LFDACGGLW  G L+GKP GIFFS+ ++GG
Sbjct  61   VATPDVLKNADGILLGFPTRFGMLPTQVKGLFDACGGLWVNGGLIGKPCGIFFSSASLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA +   F+ HQGMTFVPLGYRSPL+   EEIHGGSPWGAGTLA  DGSRQP+ LE
Sbjct  121  GQETTAMSMTPFIAHQGMTFVPLGYRSPLVGTNEEIHGGSPWGAGTLANSDGSRQPTDLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L++AK+QG+SFA + KKLSA
Sbjct  181  LEIAKIQGQSFAEITKKLSA  200

>PYAP_24530
Length=258

 Score = 286 bits (732),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 168/193 (87%), Gaps = 1/193 (1%)

Query  6    IIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVATPD  65
            I+YYSTYGHI  +AE+VK+GV+ VD V A IYQVQETL  ++L KMHA PK+DYP+ATP+
Sbjct  67   IVYYSTYGHIVHLAEAVKRGVDKVD-VEATIYQVQETLPADVLEKMHAPPKKDYPIATPE  125

Query  66   ILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigggQETT  125
             L  AD +L GIPTRFGS P+Q+KALFD+ GGLWA GALVGKPAG+FFSTGT GGGQETT
Sbjct  126  TLAEADAILFGIPTRFGSFPSQMKALFDSTGGLWAKGALVGKPAGLFFSTGTPGGGQETT  185

Query  126  AFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAK  185
            A+T+VTFL H G+ +VPLGYRSPLLFNMEE+HGGSPWG GT+AG DGSRQPSKLELDVA+
Sbjct  186  AYTTVTFLAHHGLIYVPLGYRSPLLFNMEEVHGGSPWGTGTIAGPDGSRQPSKLELDVAE  245

Query  186  VQGESFATVAKKL  198
            VQGESFA VAKKL
Sbjct  246  VQGESFANVAKKL  258

>PHYCA_553014
Length=200

 Score = 283 bits (725),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 169/200 (85%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M N+AIIYYS YGH+A +A S+K GV SV GV A +YQVQETL++E+L K+HA PK D P
Sbjct  1    MANVAIIYYSMYGHVAKLASSIKAGVTSVPGVKASVYQVQETLNDELLQKLHAPPKPDLP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LKNADG+LLG PTRFG +PAQVK LFDACGGLWA G L+GKP G+FFSTG++GG
Sbjct  61   IATPDVLKNADGILLGFPTRFGMLPAQVKGLFDACGGLWAKGDLIGKPCGVFFSTGSLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA +   F+ H GM FVPLGYRSPL+ + +E+HGGSPWGAGTLA GDGSRQP++LE
Sbjct  121  GQETTAMSMTPFIAHHGMNFVPLGYRSPLVGSNDEVHGGSPWGAGTLANGDGSRQPTELE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L++AK+QG+SFA +AKKL A
Sbjct  181  LEIAKIQGQSFAEIAKKLKA  200

>PHYRA_81696
Length=200

 Score = 283 bits (724),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYSTYGHI+T+AESVK GVESV GVTA +YQV ETLSEEILTKMHAAPK+D P
Sbjct  1    MTNVAIIYYSTYGHISTLAESVKAGVESVPGVTATVYQVAETLSEEILTKMHAAPKKDLP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VAT + LK AD +L G PTRFG+ PAQVKALFD+CGGLWA G LVGKPAGIFFSTGT+GG
Sbjct  61   VATAETLKQADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGELVGKPAGIFFSTGTLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETT+FT+VTFL HQGMTFVPLG+R+P +FN+EE+HGGSPWGAG +AGGDGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLAHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
              +A  QG+SFA +AKKLSA
Sbjct  181  KAIATTQGKSFAEIAKKLSA  200

>PHYKE_1631
Length=200

 Score = 283 bits (723),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 169/200 (85%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYS YGH+A +A S+K GV SV GV A +YQ+QETL++++L  +HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKTGVTSVPGVKASVYQIQETLNDDLLKALHAPPKSDLP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LKNADG+LLG PTRFG +P+QVK LFDACGGLWA G L+GKP GIFFSTG++GG
Sbjct  61   IATPDVLKNADGILLGFPTRFGMLPSQVKGLFDACGGLWANGGLIGKPCGIFFSTGSLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA +   F+ H GMTFVPLGYR+PL+ + EEIHGGSPWGAGTLA  DGSRQP+ LE
Sbjct  121  GQETTAMSMTPFIAHHGMTFVPLGYRTPLIGSNEEIHGGSPWGAGTLANADGSRQPTPLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L++AK+QG+SFA VAKKLS+
Sbjct  181  LEIAKIQGQSFAEVAKKLSS  200

>CCI42280
Length=200

 Score = 281 bits (718),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 171/200 (86%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGH+A +AE+VK+G E V GV+A+IYQV ETL++++L+KMHA PK++YP
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVSADIYQVAETLTDDVLSKMHAPPKKEYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D+LK+ADG+L G PTRFG +PAQ+KA FD  G LW +G  +GKPAG+FFSTGT GG
Sbjct  61   IATMDVLKDADGILFGFPTRFGLVPAQMKAYFDMAGQLWQSGCTIGKPAGLFFSTGTPGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT + FLTH GM FVPLGYRSPLL N++E+HGGS WGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTCIPFLTHLGMVFVPLGYRSPLLGNLDEVHGGSAWGAGTLAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            LDVAKVQGESFA V +KL+A
Sbjct  181  LDVAKVQGESFAAVTRKLAA  200

>PYVX_14995
Length=200

 Score = 280 bits (716),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 167/200 (84%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYS YGH+AT+AES+K+GVE V+GVTA IYQV ETL E ILT +HAAPK+D+P
Sbjct  1    MTKIAIVYYSCYGHVATLAESIKEGVEKVEGVTATIYQVPETLPESILTAIHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D LK ADG+L G PTRFGS P+Q+KA FD CGGLWA GAL+GK AGIFFSTGT GG
Sbjct  61   IATVDTLKEADGILFGFPTRFGSAPSQIKAFFDGCGGLWATGALIGKTAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQE TAF+++ F  HQG+T+VPLGYR+  L NMEEIHGGS WGAG+ AG DGSR PSKLE
Sbjct  121  GQEVTAFSTLPFFAHQGLTYVPLGYRTQNLANMEEIHGGSAWGAGSFAGSDGSRLPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L++A VQGESFA V KKLSA
Sbjct  181  LEIAVVQGESFAQVTKKLSA  200

>PHYCA_118207
Length=200

 Score = 280 bits (715),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 176/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYSTYGHIAT+ +S+K GVESV GVTA +YQV ETLSEEIL+KMHA PK+DYP
Sbjct  1    MTNVAIIYYSTYGHIATLVDSIKAGVESVPGVTATVYQVAETLSEEILSKMHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VAT + LK AD +L G PTRFG+ PAQVKALFD+CGGLWA G LVGKPAGIFFSTGT+GG
Sbjct  61   VATAETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGELVGKPAGIFFSTGTLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETT+FT+VTFL HQGMTFVPLG+R+P +FN+EE+HGGSPWGAG +AGGDGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLAHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
              +A  QG+SFA +AKKLSA
Sbjct  181  KAIATTQGKSFAEIAKKLSA  200

>CCA15845
Length=200

 Score = 278 bits (710),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 169/200 (85%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGH+A +AE+VK+G E V GVTAEIYQV ETLS+++L KMHA PK+++P
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVTAEIYQVAETLSDDVLAKMHAPPKKEHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +A+ D+LK+ADG+L G+PTRFG +PAQ+KA FD  G LW  G  +GKPAG+FFST T GG
Sbjct  61   IASMDVLKDADGILFGMPTRFGLVPAQMKAYFDMAGQLWQNGCTIGKPAGVFFSTATPGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT + FLTH GM FVPLGYRSPLL N++E+HGGS WGAGTLAG DGSRQ SKLE
Sbjct  121  GQETTAFTCLPFLTHLGMVFVPLGYRSPLLSNLDEVHGGSAWGAGTLAGADGSRQASKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L+VAKVQGESFA+V +KL+A
Sbjct  181  LEVAKVQGESFASVTRKLAA  200

>CCA27411
Length=200

 Score = 278 bits (710),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 169/200 (85%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAIIYYSTYGH+A +AE+VK+G E V GVTAEIYQV ETLS+++L KMHA PK+++P
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVTAEIYQVAETLSDDVLAKMHAPPKKEHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +A+ D+LK+ADG+L G+PTRFG +PAQ+KA FD  G LW  G  +GKPAG+FFST T GG
Sbjct  61   IASMDVLKDADGILFGMPTRFGLVPAQMKAYFDMAGQLWQNGCTIGKPAGVFFSTATPGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT + FLTH GM FVPLGYRSPLL N++E+HGGS WGAGTLAG DGSRQ SKLE
Sbjct  121  GQETTAFTCLPFLTHLGMVFVPLGYRSPLLSNLDEVHGGSAWGAGTLAGADGSRQASKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L+VAKVQGESFA+V +KL+A
Sbjct  181  LEVAKVQGESFASVTRKLAA  200

>PHYCA_132728
Length=200

 Score = 278 bits (710),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 167/199 (84%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGH+A +A++ KKG+ESV GVTA IYQV+ETL EE+L KMHA PK+D+P
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT + L+ ADG+L G P RFG+MPAQ+KA FD+CG LWA GAL GK  G+FFSTGT GG
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFL HQG+T+VPLGYRS  L NM+E+HGGSPWGAGT + GDGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFATVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LGLATTQGQSFAEVTKKLT  199

>PHYCA_124158
Length=200

 Score = 278 bits (710),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 167/199 (84%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGH+A +A++ KKG+ESV GVTA IYQV+ETL EE+L KMHA PK+D+P
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT + L+ ADG+L G P RFG+MPAQ+KA FD+CG LWA GAL GK  G+FFSTGT GG
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFL HQG+T+VPLGYRS  L NM+E+HGGSPWGAGT + GDGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFATVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LGLATTQGQSFAEVTKKLT  199

>PHYCA_19840
Length=200

 Score = 278 bits (710),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 167/199 (84%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGH+A +A++ KKG+ESV GVTA IYQV+ETL EE+L KMHA PK+D+P
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT + L+ ADG+L G P RFG+MPAQ+KA FD+CG LWA GAL GK  G+FFSTGT GG
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFL HQG+T+VPLGYRS  L NM+E+HGGSPWGAGT + GDGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFATVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LGLATTQGQSFAEVTKKLT  199

>PHYCA_132729
Length=200

 Score = 276 bits (705),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 166/199 (83%), Gaps = 0/199 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAIIYYSTYGH+A +A++ KKG+ESV GVTA IYQV+ETL EE+L KMHA PK+D+P
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT + L+ ADG+L G P RFG+MPAQ+K  FD+CG LWA GAL GK  G+FFSTGT GG
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKVFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT+VTFL HQG+T+VPLGYRS  L NM+E+HGGSPWGAGT + GDGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFATVAKKLS  199
            L +A  QG+SFA V KKL+
Sbjct  181  LGLATTQGQSFAEVTKKLT  199

>PYAP_25149
Length=200

 Score = 273 bits (697),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 168/200 (84%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAII+YSTYGH+A +AE++K+GV++V G +A IYQV ETL EE+L  +HA PK DYP
Sbjct  1    MTKIAIIHYSTYGHVAKLAEALKQGVKNVPGASATIYQVPETLPEEVLKMIHAPPKPDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
             AT D LK+ADG+L G PTRFGSMP+Q+K+  D+ GGLWA GALVGKPAGIFFSTGT GG
Sbjct  61   FATVDTLKDADGILFGFPTRFGSMPSQMKSYLDSTGGLWAKGALVGKPAGIFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAF+++ FL H GMT+VPLGYR+P   NMEEIHGGS WG GT AG DG+RQPSKLE
Sbjct  121  GQETTAFSTLPFLAHHGMTYVPLGYRAPQQANMEEIHGGSAWGVGTFAGSDGARQPSKLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L++A+VQGESFA +AKKLSA
Sbjct  181  LEIAEVQGESFAQIAKKLSA  200

>PYU1_G001466
Length=202

 Score = 271 bits (692),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 169/200 (85%), Gaps = 1/200 (1%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPK-RDY  59
            MT IAI+YYS YGH+  +A ++K G + V GV A++YQVQETL +E+LT++ AAPK +D+
Sbjct  1    MTKIAIVYYSMYGHVGKLASAIKAGAKKVPGVDAQLYQVQETLPQELLTRIGAAPKPQDH  60

Query  60   PVATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtig  119
             VATPD LK+ADG+LLG+PTRFG +P+Q+KAL DACGGLW  G L+GKP G+FFSTGT+G
Sbjct  61   AVATPDTLKDADGILLGLPTRFGMLPSQMKALMDACGGLWVGGGLIGKPCGLFFSTGTLG  120

Query  120  ggQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKL  179
            GGQETTA  +  FLTH GMTFVPLGYR+PLL N++EIHGGSPWGAGT+AG DGSRQPS L
Sbjct  121  GGQETTAMATTPFLTHHGMTFVPLGYRTPLLSNLDEIHGGSPWGAGTIAGADGSRQPSDL  180

Query  180  ELDVAKVQGESFATVAKKLS  199
            EL++A+VQGESFA + KK++
Sbjct  181  ELEIARVQGESFAEITKKMT  200

>PPTG_00540
Length=201

 Score = 270 bits (689),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 156/198 (79%), Gaps = 0/198 (0%)

Query  3    NIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVA  62
            N+AIIYYS YGH  T+AE+VK+GV+SV GV A IYQV ETLSEEILTKMHA PKRDYPVA
Sbjct  4    NVAIIYYSIYGHAVTLAEAVKEGVDSVQGVKATIYQVPETLSEEILTKMHAPPKRDYPVA  63

Query  63   TPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigggQ  122
            TP  LK ADG+L G PTRFG  PAQ K LFDA G LWAAG L+GKP G F ST  +G GQ
Sbjct  64   TPQTLKEADGILFGYPTRFGDFPAQAKNLFDATGQLWAAGDLIGKPGGCFVSTSLMGAGQ  123

Query  123  ETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELD  182
            ETT   ++ F+T  GMTFVPLGYR+  LFN++E+HGGSPWGAGT+AG D SRQ SKLE D
Sbjct  124  ETTQLMTMAFMTSHGMTFVPLGYRAKQLFNVDEVHGGSPWGAGTIAGPDNSRQVSKLEKD  183

Query  183  VAKVQGESFATVAKKLSA  200
            +A  QG+SFA V KKLS+
Sbjct  184  IAMEQGKSFAEVTKKLSS  201

>PYVX_13848
Length=200

 Score = 268 bits (686),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 163/200 (82%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYS YGH+A +A S+K GV SV GV A +YQV ETL E++L  +HA PK D P
Sbjct  1    MTKIAIVYYSMYGHVAKLAASIKAGVTSVPGVQASLYQVSETLPEDLLKALHAPPKPDMP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATP  LK+ADG+LLG PTRFG +P+QVK LFDACGGLWA GAL GK  GIFFST +IGG
Sbjct  61   IATPQTLKDADGILLGFPTRFGMLPSQVKGLFDACGGLWANGALTGKTCGIFFSTASIGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA T+  F+ HQGMTFVPLGYRSPL+ + EE+HGGSPWGAGT+A  DGSRQP+ +E
Sbjct  121  GQETTAMTTTPFIAHQGMTFVPLGYRSPLIGSNEELHGGSPWGAGTIANSDGSRQPTDIE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L++A+VQG+SFA + KKLS+
Sbjct  181  LEIARVQGQSFAEITKKLSS  200

>PHALS_11795
Length=183

 Score = 266 bits (681),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 168/183 (92%), Gaps = 0/183 (0%)

Query  18   MAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVATPDILKNADGVLLGI  77
            MAESVK GVESVDGVTAEIYQV+ETLS+E L+KMHA  K+D+P+ATPD+LK A+G+L GI
Sbjct  1    MAESVKSGVESVDGVTAEIYQVEETLSDETLSKMHAPSKKDHPIATPDVLKEANGILFGI  60

Query  78   PTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigggQETTAFTSVTFLTHQG  137
            PTRFG +PAQVKALFDACGGLWAAGALVGKPAGIFFSTGT+GGGQETTAFT++TFLTHQG
Sbjct  61   PTRFGLVPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTMGGGQETTAFTTLTFLTHQG  120

Query  138  MTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGESFATVAKK  197
            MTFVPLGYRS  L NM+EIHGGSPWGAGT AG  G+RQP++LELDVAK QGESFA VAKK
Sbjct  121  MTFVPLGYRSKHLLNMDEIHGGSPWGAGTFAGPSGARQPTQLELDVAKAQGESFAVVAKK  180

Query  198  LSA  200
            LSA
Sbjct  181  LSA  183

>PHYRA_71993
Length=201

 Score = 267 bits (682),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 159/198 (80%), Gaps = 0/198 (0%)

Query  3    NIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVA  62
            N+A+IYYS YGH AT+AES+K+GV+SV GV A IYQV ETLS+EILTKMHA PKRDYP+A
Sbjct  4    NVAVIYYSIYGHAATLAESIKEGVDSVPGVKATIYQVPETLSDEILTKMHAPPKRDYPIA  63

Query  63   TPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigggQ  122
            +P+ LK ADG+LLG PTRFG  PAQ K+LFDA G LWAAGAL+GKP G F ST  +G GQ
Sbjct  64   SPETLKEADGILLGYPTRFGDFPAQAKSLFDATGQLWAAGALIGKPGGAFVSTSLMGAGQ  123

Query  123  ETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELD  182
            ETT   ++ F+   GMTFVPLGYR+  LF+++E+HGGSPWGAG +AG D SRQ SKLE +
Sbjct  124  ETTQLMTMAFMVSHGMTFVPLGYRAKQLFDVDEVHGGSPWGAGAIAGPDNSRQVSKLEKE  183

Query  183  VAKVQGESFATVAKKLSA  200
            +A  QG+SFA V KKLSA
Sbjct  184  IAMEQGKSFAEVTKKLSA  201

>PYIR_25908
Length=199

 Score = 255 bits (652),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 161/200 (81%), Gaps = 1/200 (1%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  +AI+YYS YGH+AT+AE++K G+ESV+GVTA IYQV+ETL   +L KMHA PK+DYP
Sbjct  1    MAKVAIVYYSMYGHVATLAETIKAGIESVEGVTATIYQVEETLPAGVLEKMHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LK ADG+L G+PTRFG++PAQ+K LFDA GGLW +GAL+GKPAG+FFS  + GG
Sbjct  61   IATPDVLKEADGILFGMPTRFGTVPAQIKNLFDATGGLWQSGALIGKPAGVFFSCASQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            G ETTA  ++ FLTH GM ++PLG R+     ++E+ GG  WGAGT A GDGSRQPS+ E
Sbjct  121  GNETTALMTIPFLTHHGMLYIPLGTRAKKFGTLDEVVGGGKWGAGTYA-GDGSRQPSERE  179

Query  181  LDVAKVQGESFATVAKKLSA  200
            L +A+VQGESFA + KKL+A
Sbjct  180  LGIARVQGESFAEITKKLAA  199

>PHYSO_492858
Length=201

 Score = 255 bits (652),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 153/198 (77%), Gaps = 0/198 (0%)

Query  3    NIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVA  62
            N+AI+YYSTYGH AT+AES+K+GVE+V GVTA IYQ+ E LS+EIL KMHA   RD PVA
Sbjct  4    NVAIVYYSTYGHTATLAESIKEGVEAVPGVTATIYQIAEALSDEILAKMHAPSNRDNPVA  63

Query  63   TPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigggQ  122
            TP  LK ADG+L+G PTRFG  P Q KAL DA G LW  GALVGKPAG FFST  +G GQ
Sbjct  64   TPATLKEADGILVGFPTRFGVFPQQAKALIDATGQLWFGGALVGKPAGTFFSTSLLGAGQ  123

Query  123  ETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELD  182
            ETTA ++VTF+   GMT+VPLGYR+  LFN+EEIHGG PWGAG +AG    RQ SKLE D
Sbjct  124  ETTALSAVTFMVSHGMTYVPLGYRAKELFNVEEIHGGFPWGAGAIAGPQSDRQVSKLEKD  183

Query  183  VAKVQGESFATVAKKLSA  200
            +A  QG+SFA V KK+SA
Sbjct  184  IAVTQGKSFAEVVKKMSA  201

>PHYSO_491760
Length=201

 Score = 254 bits (649),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 153/198 (77%), Gaps = 0/198 (0%)

Query  3    NIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVA  62
            N+AI+YYSTYGH AT+AES+K+GVE+V GVTA IYQ+ E LS+EIL KMHA   RD PVA
Sbjct  4    NVAIVYYSTYGHTATLAESIKEGVEAVPGVTATIYQIAEALSDEILAKMHAPSNRDNPVA  63

Query  63   TPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigggQ  122
            TP  LK ADG+L+G PTRFG  P Q KAL DA G LW  GALVGKPAG FFST  +G GQ
Sbjct  64   TPATLKEADGILVGFPTRFGVFPQQAKALIDATGQLWFGGALVGKPAGTFFSTSLLGAGQ  123

Query  123  ETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELD  182
            ETTA ++VTF+   GMT+VPLGYR+  LFN+EEIHGG PWGAG +AG    RQ SKLE D
Sbjct  124  ETTALSAVTFMASHGMTYVPLGYRAKELFNVEEIHGGFPWGAGAIAGPQSDRQVSKLEKD  183

Query  183  VAKVQGESFATVAKKLSA  200
            +A  QG+SFA V KK++A
Sbjct  184  IAVTQGKSFAEVVKKMTA  201

>PYU1_G002524
Length=199

 Score = 254 bits (648),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 162/200 (81%), Gaps = 1/200 (1%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  +AIIYYSTYGH+AT+AE++K+GVES++GVTA IYQV+ETL E +L KMHA PK++YP
Sbjct  1    MAKVAIIYYSTYGHVATLAETIKEGVESIEGVTATIYQVRETLPEGVLEKMHAPPKKEYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VAT D+LK ADG+L G+PTRFG++PAQ+KA FDA GGLW  GAL+GKPAG+FFS+ + GG
Sbjct  61   VATNDVLKEADGILFGMPTRFGAVPAQMKAFFDAAGGLWQEGALIGKPAGVFFSSASQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            G ETT   ++ FLTH GM FVPLG R+     ++E+ GG  WGAGT A GDGSR+PS+ E
Sbjct  121  GNETTVLMTLPFLTHMGMLFVPLGTRAKKFGTLDEVVGGGKWGAGTYA-GDGSRKPSERE  179

Query  181  LDVAKVQGESFATVAKKLSA  200
            L +A+VQGESFA + KKL+A
Sbjct  180  LGIARVQGESFAEITKKLAA  199

>PYAR_19739
Length=204

 Score = 253 bits (647),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 157/200 (79%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGHI  +AE++K+GV+ V GV A IYQ+Q TL  +    + A PK +YP
Sbjct  1    MTKIAIVYYSTYGHIVPLAEAIKQGVDQVVGVDASIYQIQPTLRGDAHASIRAPPKTEYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
              TP IL  ADG+L G PTRFG+ PAQVKA FD+CG LW    L GKPAG FFSTGT+GG
Sbjct  61   TITPAILAAADGILFGFPTRFGAFPAQVKAFFDSCGSLWPQRVLEGKPAGFFFSTGTLGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETT  TS+TFL HQGM FVPLGYR+P LFN++E+HGGSPWG GT+AG +G+RQP+ LE
Sbjct  121  GQETTPMTSLTFLAHQGMLFVPLGYRTPHLFNLDEVHGGSPWGTGTIAGANGARQPTDLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L++A+VQG SFA +AKKL++
Sbjct  181  LEIARVQGSSFAEIAKKLAS  200

>PYAP_21525
Length=191

 Score = 251 bits (640),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 156/191 (82%), Gaps = 0/191 (0%)

Query  10   STYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVATPDILKN  69
            ST+GH+  +A+++K+GVE V G T  IYQV ETL E++L K+HAAPK D+P+ATP+IL +
Sbjct  1    STHGHVVQLAKALKQGVEKVAGATGTIYQVPETLDEDVLAKVHAAPKEDFPIATPEILTD  60

Query  70   ADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigggQETTAFTS  129
             DG+L G PTRFGS PAQ+K+ +DA GGLWA GAL GK AG+FFSTG  G GQE+TAFT+
Sbjct  61   FDGILFGFPTRFGSFPAQMKSFWDATGGLWARGALTGKTAGLFFSTGIQGDGQESTAFTA  120

Query  130  VTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGE  189
            +TFL + GMT+VPLGYRSP LFNMEEIHGGS WG GTLAG DG RQ +KLEL++A VQG+
Sbjct  121  LTFLANYGMTYVPLGYRSPHLFNMEEIHGGSCWGTGTLAGADGKRQATKLELEIADVQGQ  180

Query  190  SFATVAKKLSA  200
            SFA V KKL+A
Sbjct  181  SFAEVTKKLAA  191

>PHYCA_121985
Length=199

 Score = 247 bits (630),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 152/198 (77%), Gaps = 1/198 (1%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT +AII YS YGH+AT+AE+VK GVESV+GV A I QVQETL E +L KMHA PKRDYP
Sbjct  1    MTKVAIIIYSMYGHVATLAETVKSGVESVEGVEATILQVQETLPELVLEKMHAPPKRDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+L   DG+L G+PTRFG MPAQ+KA FD CGGLWA GAL+GK  GIFFS G+ GG
Sbjct  61   IATPDMLTEYDGILWGMPTRFGMMPAQIKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            G ETTAF +  F  HQGMTFVPLG R+  L  ++E+ GG  WGAGT A G G RQP++ E
Sbjct  121  GNETTAFNTAPFFAHQGMTFVPLGVRARHLHTLDEVIGGGKWGAGTYA-GTGDRQPTERE  179

Query  181  LDVAKVQGESFATVAKKL  198
            L  AK+QGESFA + KKL
Sbjct  180  LGTAKIQGESFAEITKKL  197

>PHYSO_327921
Length=209

 Score = 247 bits (631),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 152/200 (76%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            +TN+AIIYYS +GH AT+A+++KKGV+SV GV   IYQV ETLSE+IL KMHA PK D+P
Sbjct  10   VTNVAIIYYSIHGHAATLAKAIKKGVDSVPGVKGTIYQVAETLSEDILAKMHAPPKLDHP  69

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATP  LK ADG+L G PTRFG  PAQ K LFD+ G LWAAG L+GK  G F ST  +G 
Sbjct  70   IATPQTLKEADGILFGYPTRFGDFPAQAKTLFDSTGQLWAAGDLIGKLGGAFVSTSLLGA  129

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETT   ++ F+   GMTFVP GYR+  LFN++E+HGGSPWGAGT+AG D SRQ S LE
Sbjct  130  GQETTQLMTMAFMVSHGMTFVPPGYRAKQLFNVDEVHGGSPWGAGTIAGPDNSRQVSALE  189

Query  181  LDVAKVQGESFATVAKKLSA  200
             +VA  QG+SFA V KKLSA
Sbjct  190  KEVAVEQGKSFAEVTKKLSA  209

>PHYKE_35
Length=160

 Score = 245 bits (625),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 145/160 (91%), Gaps = 0/160 (0%)

Query  41   ETLSEEILTKMHAAPKRDYPVATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWA  100
            ETLSEE+LT +HAAPK+D+P+ATPD LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWA
Sbjct  1    ETLSEELLTTIHAAPKKDHPIATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWA  60

Query  101  AGALVGKPAgiffstgtigggQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGS  160
            AGALVGKPAGIFFSTGT GGGQETTAFT++TFL HQG+T+VPLGYR+P L NM+EIHGGS
Sbjct  61   AGALVGKPAGIFFSTGTQGGGQETTAFTALTFLAHQGLTYVPLGYRAPELANMDEIHGGS  120

Query  161  PWGAGTLAGGDGSRQPSKLELDVAKVQGESFATVAKKLSA  200
             WGAGTLAGGDGSRQPSKLEL VA  QG+SFA VAKKL+A
Sbjct  121  AWGAGTLAGGDGSRQPSKLELTVATTQGKSFAEVAKKLAA  160

>PHYRA_72407
Length=199

 Score = 243 bits (620),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 152/198 (77%), Gaps = 1/198 (1%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT +AII YS YGH+AT+AE+VK GVESV+GV A I QV ETL + +L KMHA PK+DYP
Sbjct  1    MTKVAIIIYSMYGHVATLAETVKSGVESVEGVEATILQVPETLPDVVLEKMHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+L + DG+L G+PTRFG MPAQVKA FD CGGLWA GAL+GK  GIFFS G+ GG
Sbjct  61   IATPDVLTDFDGILWGMPTRFGMMPAQVKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            G ETTAF +  F  HQGMTFVPLG R+  L  ++E+ GG  WGAGT AG  G RQP++ E
Sbjct  121  GNETTAFNTAPFFAHQGMTFVPLGVRARHLHTLDEVVGGGKWGAGTYAGA-GDRQPTERE  179

Query  181  LDVAKVQGESFATVAKKL  198
            L  AK+QGESFA + KKL
Sbjct  180  LGTAKIQGESFAEITKKL  197

>PHYKE_8238
Length=199

 Score = 241 bits (614),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 152/198 (77%), Gaps = 1/198 (1%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT +AI+ YS YGH+AT+AE++K GVESV+GVTA I QVQETL E +L KMHA PK+DYP
Sbjct  1    MTKVAIVIYSMYGHVATLAETIKAGVESVEGVTATILQVQETLPELVLEKMHAPPKKDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            + TP+ L + DG+L G+PTRFG MPAQVKA FD CGGLWA GAL+GK  GIFFS G+ GG
Sbjct  61   IITPEQLTDFDGILWGMPTRFGMMPAQVKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            G E+TA  + TF  HQGMTFVPLG R+  L  ++E+ GG  WGAGT A G G RQP++ E
Sbjct  121  GNESTAMNTATFFAHQGMTFVPLGVRARHLHTLDEVVGGGKWGAGTYA-GTGDRQPTERE  179

Query  181  LDVAKVQGESFATVAKKL  198
            L  AK+QGESFA + KK+
Sbjct  180  LGTAKIQGESFAVITKKI  197

>PHYCA_553010
Length=200

 Score = 240 bits (613),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 156/200 (78%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI++YST+GH+  MA +++ G++SV  V AE+YQV+ETL+E++L K+HA PK D+P
Sbjct  1    MTKIAIVFYSTFGHVTKMAAAIQAGIQSVPNVEAELYQVKETLNEQVLAKLHAPPKLDFP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATPD+LKNADG++LG PT FG +PAQ+KALFD+CG LW  G L+GKP G+FFS G+ GG
Sbjct  61   VATPDVLKNADGIMLGFPTHFGMVPAQMKALFDSCGALWMKGELIGKPCGVFFSCGSRGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQE +A ++  ++ H GM FVPL  R  ++   +E+HG S WG+GT+AG D SRQPS LE
Sbjct  121  GQEVSAMSTTPYIAHLGMLFVPLALRGNVIEATDELHGCSLWGSGTVAGSDRSRQPSDLE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA++QGE FA + KKLSA
Sbjct  181  LKVAQMQGEKFAEITKKLSA  200

>PYVX_22078
Length=1267

 Score = 258 bits (659),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 171/271 (63%), Gaps = 78/271 (29%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGH+A +AESVK+GVESV+GVTA IYQV ETL EE+L ++HAAPK+D+P
Sbjct  1    MTKIAIVYYSTYGHVAKLAESVKEGVESVEGVTATIYQVPETLPEELLAQIHAAPKKDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKP------------  108
            +AT D LK ADG+L G PTRFG+ PAQV+ALFDA GGLW +GALVGKP            
Sbjct  61   IATVDTLKEADGILFGFPTRFGAAPAQVRALFDATGGLWGSGALVGKPAGFFFSTGTLGG  120

Query  109  -------------------AgiffstgtigggQETTAFTSVTFLTHQGMTFVPLGYRSPL  149
                               AGIFFSTGT GGGQE TAF+++ F  HQG+TFVPLGYRSPL
Sbjct  121  GQETTALTTLTFLTHQGLTAGIFFSTGTQGGGQEVTAFSTLPFFAHQGLTFVPLGYRSPL  180

Query  150  LFNMEEIHGGSP-----------------------------------------------W  162
            LFNMEEIHGGSP                                               W
Sbjct  181  LFNMEEIHGGSPTGSQGGGQEVTAFTTLPFFAHQGLTYVPLGYRSQLLANMEEIHGGSAW  240

Query  163  GAGTLAGGDGSRQPSKLELDVAKVQGESFAT  193
            GAGT AG DGSRQPS+LEL VAKVQGESFAT
Sbjct  241  GAGTFAGSDGSRQPSELELGVAKVQGESFAT  271

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 52/106 (49%), Gaps = 44/106 (42%)

Query  122  QETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPS----  177
            QE TAFT++ F  HQG+T+VPLGYRS LL NMEEIHGGS WGAGT AG DGSRQPS    
Sbjct  200  QEVTAFTTLPFFAHQGLTYVPLGYRSQLLANMEEIHGGSAWGAGTFAGSDGSRQPSELEL  259

Query  178  ----------------------------------------KLELDV  183
                                                    KLE D+
Sbjct  260  GVAKVQGESFATHDLHVAVYCGSTWATGTVAEMDSSRLPSKLESDI  305

>PYAR_24476
Length=213

 Score = 237 bits (604),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)

Query  51   MHAAPKRDYPVATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAg  110
            MHAAPK+D+P+ TP+IL  ADGVL GIPTRFGSMPAQVKA FD+CGGLWA G LVGKPAG
Sbjct  1    MHAAPKKDHPIITPEILAAADGVLFGIPTRFGSMPAQVKAFFDSCGGLWAKGGLVGKPAG  60

Query  111  iffstgtigggQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGG  170
            +FFSTGT+GGGQETT  +S+TFLTH GM+FVPLGYRSPLLFN+EEIHGGSPWGAGTLAG 
Sbjct  61   MFFSTGTLGGGQETTVMSSLTFLTHHGMSFVPLGYRSPLLFNLEEIHGGSPWGAGTLAGA  120

Query  171  DGSRQPSKLELDVAKVQGESFATVAKKL  198
            DGSRQPS LELDVAKVQGE+FA VA+KL
Sbjct  121  DGSRQPSTLELDVAKVQGETFAQVAQKL  148

>PITG_12444
Length=200

 Score = 236 bits (601),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 0/164 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYSTYGH+A +A + KKG+E V GV A IYQVQETL EE+LTKMHA PK D+P
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIEFVGGVAATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +AT D LK ADG+L G P R GSMPAQVKA FD+CGGLWA+GALVGK AG+FFSTGT GG
Sbjct  61   IATIDTLKEADGILFGFPCRSGSMPAQVKAFFDSCGGLWASGALVGKTAGLFFSTGTQGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGA  164
            GQETTAFT+VTFL HQGMT+VPLGYR   L NM+E+HGGSPWGA
Sbjct  121  GQETTAFTAVTFLAHQGMTYVPLGYRGKELLNMDEMHGGSPWGA  164

>PYAR_22252
Length=201

 Score = 229 bits (583),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 153/201 (76%), Gaps = 1/201 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  +AI+YYST+GH   +AE++ +GVE+V+GV   IYQV ETLS++ L +  AAPK+DYP
Sbjct  1    MAKVAIVYYSTFGHTTVLAEAMLEGVENVEGVEGAIYQVAETLSKDALEQRKAAPKQDYP  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            + TP+IL   DGVL G PT+FG+MP Q+ A FD+CG LWA GALVGKPAG+F S+G +GG
Sbjct  61   LITPEILAEYDGVLFGFPTQFGAMPPQMAAFFDSCGSLWAKGALVGKPAGVFVSSGIMGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAG-GDGSRQPSKL  179
            G E++ FT++ FL HQGM FVPLGYR+ L+    E+HGGS WGAGTL+G     RQP+ L
Sbjct  121  GVESSPFTTLPFLAHQGMLFVPLGYRTKLVSTKHEVHGGSSWGAGTLSGITPDMRQPTFL  180

Query  180  ELDVAKVQGESFATVAKKLSA  200
            EL+ A VQG+SFA + KKL+A
Sbjct  181  ELECAMVQGQSFAEITKKLAA  201

>PPTG_03053
Length=225

 Score = 228 bits (582),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 154/200 (77%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT +AI++YST+GH+  MA +++KG+++V GV A++YQV+ETL+EE+L K+HA PK D+P
Sbjct  26   MTKVAIVFYSTFGHVTKMASAIQKGIQTVPGVQAQLYQVKETLNEEVLAKLHAPPKPDFP  85

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            +ATPD+LKNADG++LG PT FG +PAQ+KALFDA   LW  G L+GKP GIFFS G+ GG
Sbjct  86   IATPDVLKNADGIMLGFPTHFGMVPAQMKALFDASVALWVKGELIGKPCGIFFSCGSRGG  145

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQE +A ++  ++ H GM FVPL      +   +E+HG S WG+GT+AG D SRQPS LE
Sbjct  146  GQEVSAMSTTPYIAHLGMLFVPLALNGKTIEGSDEMHGCSLWGSGTVAGHDRSRQPSALE  205

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA++QG+ FA + KKL+A
Sbjct  206  LKVAEMQGKKFAEITKKLAA  225

>PHYRA_82142
Length=200

 Score = 226 bits (577),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 154/200 (77%), Gaps = 0/200 (0%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT +AI++YST+GH+  +A+S++ GV++V GV AE+YQV+ETLSEE+L K+ A PK+++ 
Sbjct  1    MTKVAIVFYSTFGHVTKLAKSIQAGVQAVPGVEAELYQVKETLSEEVLAKLRAPPKQEFS  60

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
            VATP +LK ADG++LG PT FG +PAQ+KALFD+CG LW  G L+GKP G+FFS G+ GG
Sbjct  61   VATPAVLKEADGIMLGFPTHFGMVPAQMKALFDSCGMLWMKGELIGKPCGVFFSCGSRGG  120

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQE +A ++  ++ H GM FVPL  R  ++   +E+HG S WG+GT+A  D SRQPS LE
Sbjct  121  GQEVSAMSTTPYIAHLGMMFVPLSLRGSVIEGNDELHGCSLWGSGTVANSDRSRQPSALE  180

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA++QG+ FA + KKLS+
Sbjct  181  LSVAEMQGKKFAEITKKLSS  200

>PHYCA_508489
Length=156

 Score = 213 bits (543),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 137/200 (69%), Gaps = 44/200 (22%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            M  IAI+YYS Y HI+TMAE+                                       
Sbjct  1    MAKIAIVYYSCYNHISTMAETT--------------------------------------  22

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
                  LK ADG+L G PTRFGS+P+Q+KA FD+CGGLWAAGALVGKPAGIFFSTGT GG
Sbjct  23   ------LKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  76

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTAFT++TFL HQGMT+VPLGYR+P L NMEEIHGGS WGAGTLA GDGSRQPSKLE
Sbjct  77   GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  136

Query  181  LDVAKVQGESFATVAKKLSA  200
            L VA  QG+SFA +AKKL+A
Sbjct  137  LTVATTQGKSFAEIAKKLAA  156

>PYAR_17624
Length=215

 Score = 189 bits (480),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 133/218 (61%), Gaps = 25/218 (11%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MT IAI+YYS YGH+  +AE+VK G + V GV A++YQV ETL  +IL KM A PK D P
Sbjct  1    MTRIAIVYYSLYGHVGKLAEAVKVGAKRVPGVDAQLYQVAETLPSDILQKMGAPPKPDLP  60

Query  61   VATPDILKNADGVLLG------------IPTRFGSM--------PAQVKALFDACGGLWA  100
            VATPD+LKN+    +G            I    G M        P          G  W 
Sbjct  61   VATPDVLKNSXXXXIGGGQETTALTSTPILAHHGMMYVPLGYRSPMLESNDHVHGGSDWG  120

Query  101  AGALVGKPAgiffstgtigggQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGS  160
             G +             IGGGQETTA TS+ FL H GM +VPLGYR+PLL + +++HGGS
Sbjct  121  TGTIT-----NGDXXXXIGGGQETTALTSMPFLAHHGMMYVPLGYRTPLLASNDQVHGGS  175

Query  161  PWGAGTLAGGDGSRQPSKLELDVAKVQGESFATVAKKL  198
            PWG GT+A GDGSRQPS+L L++AKVQGESFA +AKKL
Sbjct  176  PWGTGTIANGDGSRQPSELGLEIAKVQGESFAAIAKKL  213

>PYIW_26124
Length=139

 Score = 169 bits (429),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 111/139 (80%), Gaps = 1/139 (1%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKR-DY  59
            MT IA++YYS YGHI  +A ++K G   V GV  +++QVQETL + +LTKMHAAPK  D+
Sbjct  1    MTKIAVVYYSMYGHIGKLASAIKAGTSRVAGVETQLFQVQETLPDALLTKMHAAPKAADH  60

Query  60   PVATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtig  119
            PVATP+ L++AD +LLG+PTRFG +P+QVK LFDACGGLWA G L+GKP GIFFSTG++G
Sbjct  61   PVATPETLRDADAILLGLPTRFGMLPSQVKGLFDACGGLWATGGLIGKPCGIFFSTGSLG  120

Query  120  ggQETTAFTSVTFLTHQGM  138
            GGQETTA ++  FL H GM
Sbjct  121  GGQETTAMSTTPFLAHHGM  139

>PYVX_24503
Length=113

 Score = 167 bits (422),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 105/113 (93%), Gaps = 0/113 (0%)

Query  88   VKALFDACGGLWAAGALVGKPAgiffstgtigggQETTAFTSVTFLTHQGMTFVPLGYRS  147
            V+ALFDA GGLW +GALVGKPAG FFSTGT+GGGQETTA++++TFLTH G+ +VPLGY++
Sbjct  1    VRALFDATGGLWGSGALVGKPAGFFFSTGTLGGGQETTAYSTLTFLTHHGLVYVPLGYQT  60

Query  148  PLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGESFATVAKKLSA  200
            PLLFN++E+HGGSPWGAGTLAG DGSRQPSKLELDVA+VQGE FA +AKKLSA
Sbjct  61   PLLFNLDEVHGGSPWGAGTLAGPDGSRQPSKLELDVAEVQGEKFAGIAKKLSA  113

>PITG_19721
Length=147

 Score = 167 bits (424),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 120/199 (60%), Gaps = 53/199 (27%)

Query  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
            MTN+AIIYYS YGH+A +A S+K GV SV GV A                          
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVKAS-------------------------  35

Query  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigg  120
                    +ADG LLG PTRFG                     L+GKP GIFFS+ ++GG
Sbjct  36   --------DADGTLLGFPTRFG--------------------GLIGKPCGIFFSSASLGG  67

Query  121  gQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180
            GQETTA +   F+ HQGMTFVPLGYRSPL+   EEIHGGSPWGAGTLA  DGSRQP+ +E
Sbjct  68   GQETTAMSMTPFIAHQGMTFVPLGYRSPLVGTNEEIHGGSPWGAGTLANADGSRQPTDVE  127

Query  181  LDVAKVQGESFATVAKKLS  199
            L++AK+QG+SFA + KKLS
Sbjct  128  LEIAKIQGQSFAEITKKLS  146

>PPTG_20265
Length=89

 Score = 144 bits (362),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 79/89 (89%), Gaps = 0/89 (0%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
           M  IAI+YYSTYGHIA +AE+VKKGVES+ GVTA+IYQVQETL +EIL KM+AAPK+D+P
Sbjct  1   MAKIAIVYYSTYGHIAQLAEAVKKGVESIAGVTADIYQVQETLPDEILAKMYAAPKKDHP  60

Query  61  VATPDILKNADGVLLGIPTRFGSMPAQVK  89
           +ATP+ LK ADG+L G PTRFGS+PAQ+K
Sbjct  61  IATPETLKEADGILFGFPTRFGSLPAQMK  89

>PYIR_25309
Length=103

 Score = 136 bits (343),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)

Query  123  ETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELD  182
            ETTA+T++TFL H GMT+VPLGYRS L+F+ EEIHGGSPWGAG+ AG DGSRQPSKLELD
Sbjct  26   ETTAYTTLTFLAHHGMTYVPLGYRSKLVFSFEEIHGGSPWGAGSYAGPDGSRQPSKLELD  85

Query  183  VAKVQGESFATVAKKLSA  200
            VAKVQGESFA +AKKLSA
Sbjct  86   VAKVQGESFAQIAKKLSA  103

 Score = 41.6 bits (96),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKG  25
           MT IAI+YYSTYGHI  +AE++K G
Sbjct  1   MTKIAIVYYSTYGHIVKLAETIKAG  25

>PYVX_24541
Length=82

 Score = 134 bits (337),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 73/82 (89%), Gaps = 0/82 (0%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
           MT IAI+YYSTYGH+A +AESVK+GVESV+GVTA IYQV ETL EE+L ++HAAPK+D+P
Sbjct  1   MTKIAIVYYSTYGHVAKLAESVKEGVESVEGVTATIYQVPETLPEELLAQIHAAPKKDHP  60

Query  61  VATPDILKNADGVLLGIPTRFG  82
           +ATPD+LK ADG+L G PTRFG
Sbjct  61  IATPDVLKEADGILFGFPTRFG  82

>PYIW_24901
Length=123

 Score = 135 bits (340),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 93/124 (75%), Gaps = 1/124 (1%)

Query  77   IPTRFGSMPAQVKALFDACGGLWAAGALVGKPAgiffstgtigggQETTAFTSVTFLTHQ  136
            +PTRFGS+PAQ+K  FDA G LW  GAL+GKPAG+FFS G+ GGG ETTA  ++ FLTHQ
Sbjct  1    MPTRFGSVPAQLKNFFDATGSLWQKGALIGKPAGVFFSCGSQGGGNETTALMTIPFLTHQ  60

Query  137  GMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGESFATVAK  196
            GM FVPLG R+     ++E+ GG  WG GT A GDGSR+PS+ EL  AKVQG SFA + K
Sbjct  61   GMLFVPLGTRAKQFGTLDEVVGGGKWGTGTYA-GDGSRKPSERELSTAKVQGVSFAEITK  119

Query  197  KLSA  200
            KL+A
Sbjct  120  KLAA  123

>PYAR_17731
Length=63

 Score = 124 bits (312),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 60/63 (95%), Gaps = 0/63 (0%)

Query  138  MTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGESFATVAKK  197
            MTFVPLGYRSPLLFN+EEIHGGSPWGAGTLAGGDGSRQPSKLELDVAK QGESF  VAKK
Sbjct  1    MTFVPLGYRSPLLFNLEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKAQGESFTQVAKK  60

Query  198  LSA  200
            LSA
Sbjct  61   LSA  63

>PYIW_25666
Length=75

 Score = 123 bits (309),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 68/75 (91%), Gaps = 0/75 (0%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
           MTN+AI+YYSTYGHIAT+AE +K G+ESV+GVTA IYQ+QETL E++L KM+AAPK+D+P
Sbjct  1   MTNVAIVYYSTYGHIATLAEEIKAGIESVEGVTATIYQIQETLPEDVLAKMYAAPKKDHP  60

Query  61  VATPDILKNADGVLL  75
           VATPD+LK ADG+L 
Sbjct  61  VATPDVLKEADGILF  75

>PYIW_26817
Length=80

 Score = 123 bits (309),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 70/97 (72%), Gaps = 17/97 (18%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
           MTNIAI                 +GVE   GVTAEIYQ+ ETL EE+L KMHA PK+D+P
Sbjct  1   MTNIAI-----------------EGVEQATGVTAEIYQIAETLPEEVLAKMHAPPKKDHP  43

Query  61  VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGG  97
           +ATPD+LK ADG+L GIPTRFGSMPAQVKALFD+ GG
Sbjct  44  IATPDVLKAADGILFGIPTRFGSMPAQVKALFDSTGG  80

>PYIR_16433
Length=102

 Score = 117 bits (293),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 69/88 (78%), Gaps = 1/88 (1%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPK-RDY  59
           MT IA++YYS YGHI  +A ++K G   V GV  +++QVQETL +++L +MHAAPK  D+
Sbjct  1   MTKIAVVYYSMYGHIGKLASAIKAGTSRVPGVETQLFQVQETLPDDLLQRMHAAPKATDH  60

Query  60  PVATPDILKNADGVLLGIPTRFGSMPAQ  87
           P+ATPD LK ADG+LLG+PTRFG +P+Q
Sbjct  61  PIATPDTLKEADGILLGLPTRFGMLPSQ  88

>PITG_22462
Length=64

 Score = 110 bits (276),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)

Query  137  GMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGESFATVAK  196
            G+TFVPLGYR+P LFNM+E+HGGSPWGAGTLAGGDGSRQPSK EL VA  QG+SFA VAK
Sbjct  1    GLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKPELTVATTQGKSFAEVAK  60

Query  197  KLSA  200
            KL+A
Sbjct  61   KLAA  64

>PHYSO_525925
Length=73

 Score = 101 bits (252),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 60/74 (81%), Gaps = 1/74 (1%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60
           MTN+AI YYS YGH+A +A S+K GV SV GV A +YQVQ+TL++++L  +HA PK D P
Sbjct  1   MTNVAI-YYSMYGHVAKLANSLKAGVTSVPGVKASVYQVQKTLNDDLLKALHAPPKPDLP  59

Query  61  VATPDILKNADGVL  74
           +ATPD+LKNADG+L
Sbjct  60  IATPDVLKNADGIL  73

>PYVX_22081
Length=45

 Score = 81.6 bits (200),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)

Query  156  IHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGESFATVAKKLSA  200
            +HGGSPWGAGTLAG DGSRQPSKLELDVA+VQGE FA +AKKLSA
Sbjct  1    VHGGSPWGAGTLAGPDGSRQPSKLELDVAEVQGEKFAGIAKKLSA  45

>PHYKE_5219
Length=38

 Score = 66.2 bits (160),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQ  38
           M NIAI+YYS Y HIATMA+S+K+G+ESVDGVTA IYQ
Sbjct  1   MVNIAIVYYSCYNHIATMADSIKEGIESVDGVTATIYQ  38

>PHYKE_4826
Length=38

 Score = 58.5 bits (140),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)

Query  1   MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQ  38
           MT IAI+YYSTYGHIA +AE+ K+G+ES  GVTA IYQ
Sbjct  1   MTKIAIVYYSTYGHIAKLAEAAKEGIESTPGVTATIYQ  38

>PHYSO_329877
Length=115

 Score = 50.8 bits (120),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)

Query  76   GIPTRFGSMPAQVKALFDACGGLWAAGALVGK  107
            G+PTR   MPAQ+   FD CGGLWA GAL+G 
Sbjct  48   GLPTRLDVMPAQITEFFDCCGGLWAKGALIGN  79

>PITG_11840
Length=106

 Score = 35.8 bits (81),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 2/26 (8%)

Query  74  LLGIPTRFGSMPAQVKALFDACGGLW  99
           +LG+ TR   MPAQ+KALFDA G +W
Sbjct  1   MLGLSTRM--MPAQMKALFDARGDMW  24

>PYVX_20689
Length=397

 Score = 33.9 bits (76),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 42/101 (42%), Gaps = 13/101 (13%)

Query  12   YGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTK-----MHAAPKRDYP--VATP  64
            Y  +A    +  +  ESV G   +    Q+ ++E +L       M     R+ P  VA  
Sbjct  254  YDAVALDTATAAEEEESVGGKKMDSEGRQQHMAELLLCNGADPNMQEDVARETPLHVAVR  313

Query  65   DILKNADGVLL------GIPTRFGSMPAQVKALFDACGGLW  99
              L+   GVLL        P +FG  PA V A FDA   LW
Sbjct  314  QGLEKTTGVLLTNGADPNTPNKFGVTPAHVAAAFDASHELW  354

>CCA20300
Length=586

 Score = 32.0 bits (71),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 0/48 (0%)

Query  59   YPVATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVG  106
            +PV T D +KNADG+L  +     +  A+  ++ D+  G       VG
Sbjct  75   HPVTTNDYIKNADGILEALRAVHLTREAESASILDSLSGTDICSGDVG  122

Lambda      K        H        a         alpha
   0.316    0.132    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9038049390

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40