Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_115631114661361329940.0
PHYCA_5353791114662761019930.0
PPTG_092511114664160419690.0
PHYRA_816741114661661618970.0
PHYSO_3150181114663661918960.0
PITG_137381114661060218570.0
PYIW_147541114661663414190.0
PYVX_208581114662163314060.0
PYU1_G0059621114662464213780.0
PYIR_151781114663864913650.0
PYAR_232061114660062512864e-170
CCA15905111466206419606e-121
PYAP_22843111464725008753e-110
HYAP_08501111463523568071e-101
SPRG_06313111465155138053e-99
H310_01471111465606048051e-98
SDRG_01805111465195137705e-94
H257_00314111465636237441e-89
CCI46717111463823955031e-56
PYAP_228451005791351334279e-49
PHYKE_584211145550753115e-29
H257_08759141943107491242e-07
SPRG_0198212944175941273e-07
SDRG_0835412944174541248e-07
H257_06038125748684661292e-06
H310_13091125748662611264e-06
H257_0060512944186611204e-06
H310_06346144371139421141e-05
SPRG_07002125615170511151e-05
H257_068041410559331341221e-05
SDRG_08762144371109511111e-05
PYU1_G00943412944163591142e-05
H310_0120512944186541142e-05
H257_13532144371136421103e-05
PHALS_0990812944499461174e-05
PYIR_1325012944214531134e-05
PPTG_0962912944191541124e-05
PHYRA_9341712944332461155e-05
PYIW_1947412944224461126e-05
H310_05789125615223631073e-04
H310_10009141055972681103e-04
PYIR_141541564617401094e-04
PYAR_2052014949374591084e-04
PYAR_131768274621611094e-04
PYIW_233871564591501085e-04
SDRG_09580125615161511026e-04
CCA261325881266881057e-04
H310_08802141715190421037e-04
PYU1_G0085142443531661068e-04
PHALS_0899114949400421059e-04
SPRG_072961257485051041060.001
PYAR_252123353307541030.001
PPTG_0954714949391541040.001
PHYRA_8061324434881071040.001
SPRG_0012214949355541030.001
PITG_1875114949330541030.001
PYU1_G00937995722435631040.001
PYAP_18874993567559930.001
CCI452125881267881020.001
PYIR_1857114949403541030.001
SDRG_1151714949356541030.002
PYU1_G01390882421402921030.002
H310_0028417505994531040.002
SDRG_005063353738541030.002
PYVX_186598518452431020.002
H257_0818314171519374980.003
PHYKE_733314949376541010.003
SPRG_072003353714541020.003
PYIW_152968274675601020.003
PHYCA_10491214949347561010.003
PYIR_152761463315350960.003
PYAR_207062443530951010.003
H310_0652714332124351980.004
SDRG_077321476115942950.004
PHALS_12995785768751010.004
PHYSO_5583918518463441000.004
PHYSO_2884111494918754960.004
PYVX_173221494938544990.004
PYVX_1803057811665611000.004
SDRG_1038815292629421000.004
PYU1_G0049761463317256950.005
HYAP_041431812547047990.005
PPTG_0400510010643501000.005
H310_051271476120642960.005
H257_1367214440629373980.006
PYU1_G005703156441239990.006
PYU1_G0090581494938954980.006
PYAP_174261494936956980.006
PHYCA_1033721812514345930.007
H257_123931476120842950.007
PPTG_166532161792990.007
PYU1_G0017301476135846970.009
H257_0679117505102966980.010
SDRG_04254125748506110970.010
PITG_03821335383042970.011
PYIW_208531494922454940.011
PPTG_00523851846644960.012
PITG_192491529246544960.012
PITG_000252153556960.013
PHYSO_5539321476123342940.013
SPRG_005271476116442920.013
PITG_10321851846544960.013
PYIW_1843512899961107970.013
PYU1_G007193335383154960.016
H310_041401494936851950.017
PPTG_171321476128842940.017
PHYRA_7772578596842960.018
HYAP_0246278582142950.018
SDRG_1323612472713556890.018
PYAR_2014010387928444930.019
PITG_151951227860159940.022
H257_14373335371154940.023
PYIW_146641476142646940.023
PYAP_133712443482129940.025
H310_1432814440630344920.026
PYU1_G010079959999242850.027
PYIW_229991463321950910.028
PHYCA_107875851844144930.029
PYAP_177501476134359920.029
PITG_184621476122042910.029
PYVX_21138453342650930.029
PHYCA_568641244343461930.029
SPRG_157361529262243930.031
PPTG_06536335383754930.032
CCI451201476127046910.034
PHYSO_322360335381154930.034
HYAP_071061476129142910.034
PHYCA_525476335375342930.034
PHALS_072411476129042910.035
H257_079401494936948920.036
SDRG_06909926024044900.036
CCA18170244337456920.038
PHYCA_5309151476118642890.038
PHYKE_30151227861247920.039
CCA14180335384454930.039
PYIR_134461476142442920.040
PYVX_173022165053920.041
CCI43385335386254920.042
PYIR_169661227863447920.043
CCA1402315176239645910.043
SPRG_12576926024044900.043
PYU1_G007124329746457910.046
PYIW_21519329746754910.047
CCI4338616056278854920.048
PYIR_19269453346048910.052
CCI3999815176239645910.052
PYIR_19863754365256910.052
PYVX_147423353116053920.054
PYU1_G001639754361456910.054
PHYRA_810911476121242880.056
PHYRA_759921463315850870.056
PYIR_18310827467861910.057
PYAR_21118238441479900.059
PHYKE_83961476116042860.061
PYAP_13246335383242910.061
H310_11926335371142910.062
PHYKE_6978565161081910.062
SPRG_028712142249900.064
CCA188951476127457890.065
PYU1_G0128891227859247900.068
SDRG_131372142449900.069
PYAP_1919015084124845910.069
SPRG_1189812833814943850.070
PHYRA_941203353122754910.071
PHYSO_5442101227861547900.072
PHALS_040272159046900.072
PPTG_2412378599376900.075
PHYCA_1046322156953900.078
PHALS_006063353114242900.080
PYAR_2647710707819666870.080
PYIW_21541335382154900.088
PYIR_18633335386154900.089
PYAP_207831463319661860.090
PPTG_067621227859747890.091
H257_1154214332124451870.093
PYAR_149061227859047890.093
PHYRA_793171227859547890.094
PHALS_06891754354658890.096
PHYCA_5042431227859747890.096
PPTG_1928517505111587890.098
PYIW_23779419734656880.099
PYAP_19146156440745880.099
SPRG_0538112472713356840.100
HYAP_05107335390654890.10
PHYSO_46998691436149880.11
PHYSO_4769865683036149880.11
PYU1_G010963827464960890.11
PPTG_13607329743054880.11
PYIR_165178242158392880.11
SPRG_0219917505100772890.11
PHYSO_4944395781110175810.12
H257_0818414171617349850.12
HYAP_094721227863947880.12
CCA26695419729756870.12
CCA2347915583329756870.12
PHALS_006581812539729880.12
PYIR_22040244345766880.12
PYAR_213059841537348870.12
PHALS_130471227859447880.12
PYVX_167341463327750870.13
SDRG_1096117505100572880.13
PYAP_15538851844344880.13
PYVX_237211227861047880.13
PPTG_05556244348942880.13
PYAP_190478242151453870.14
PHALS_11589647333847870.14
PITG_06725565176550880.14
PHYSO_3582152140036846870.14
PYIR_15591329744654870.14
SPRG_10141704338558870.15
SDRG_003609011531135870.16
PPTG_11751827483452870.16
PHYKE_78373353144742880.16
H257_04593926024791850.17
PYIW_15735576240890870.17
H310_12571150604784119870.17
PYAR_16668851844845870.17
PHYSO_31799617505105759870.17
PHYSO_5160361463315750830.18
PYAP_233361227856247870.18
PYU1_G0034261442349248860.18
PYAP_13092588127754850.19
PITG_2285717505103659870.19
SDRG_0407012436918544830.19
PHALS_01600238447083860.20
PHALS_11946244349242860.20
PHYSO_4540285596384059870.20
PYVX_171686503927455850.20
CCA151992268522105860.20
PHYSO_441337244331363850.21
PITG_02789244331542850.21
SPRG_2062613426621544840.22
H257_034562150169860.22
PYAR_251059935643746860.23
CCA199781227853847860.23
PITG_03761329743154850.23
PYIW_131281077742544850.24
PYIR_132241289985863860.24
PYAP_1781510479826163840.24
CCI490161227853947860.24
HYAP_097395781115952820.25
PITG_0103891435246850.25
H310_019802147947850.26
PYIR_25281419735643850.27
SPRG_2109913446611975790.28
PYAP_151459841538148850.28
PHYRA_7959417505106859850.29
SPRG_113649011420135840.31
PYIR_178891508486050850.33
H310_066199260248102830.34
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_11563

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHALS_11563                                                           1157    0.0   
PHYCA_535379                                                          772     0.0   
PPTG_09251                                                            763     0.0   
PHYRA_81674                                                           735     0.0   
PHYSO_315018                                                          734     0.0   
PITG_13738                                                            719     0.0   
PYIW_14754                                                            551     0.0   
PYVX_20858                                                            546     0.0   
PYU1_G005962                                                          535     0.0   
PYIR_15178                                                            530     0.0   
PYAR_23206                                                            499     4e-170
CCA15905                                                              374     6e-121
PYAP_22843                                                            341     3e-110
HYAP_08501                                                            315     1e-101
SPRG_06313                                                            314     3e-99 
H310_01471                                                            314     1e-98 
SDRG_01805                                                            301     5e-94 
H257_00314                                                            291     1e-89 
CCI46717                                                              198     1e-56 
PYAP_22845                                                            169     9e-49 
PHYKE_5842                                                            124     5e-29 
H257_08759                                                            52.4    2e-07 
SPRG_01982                                                            53.5    3e-07 
SDRG_08354                                                            52.4    8e-07 
H257_06038                                                            54.3    2e-06 
H310_13091                                                            53.1    4e-06 
H257_00605                                                            50.8    4e-06 
H310_06346                                                            48.5    1e-05 
SPRG_07002                                                            48.9    1e-05 
H257_06804                                                            51.6    1e-05 
SDRG_08762                                                            47.4    1e-05 
PYU1_G009434                                                          48.5    2e-05 
H310_01205                                                            48.5    2e-05 
H257_13532                                                            47.0    3e-05 
PHALS_09908                                                           49.7    4e-05 
PYIR_13250                                                            48.1    4e-05 
PPTG_09629                                                            47.8    4e-05 
PHYRA_93417                                                           48.9    5e-05 
PYIW_19474                                                            47.8    6e-05 
H310_05789                                                            45.8    3e-04 
H310_10009                                                            47.0    3e-04 
PYIR_14154                                                            46.6    4e-04 
PYAR_20520                                                            46.2    4e-04 
PYAR_13176                                                            46.6    4e-04 
PYIW_23387                                                            46.2    5e-04 
SDRG_09580                                                            43.9    6e-04 
CCA26132                                                              45.1    7e-04 
H310_08802                                                            44.3    7e-04 
PYU1_G008514                                                          45.4    8e-04 
PHALS_08991                                                           45.1    9e-04 
SPRG_07296                                                            45.4    0.001 
PYAR_25212                                                            44.3    0.001 
PPTG_09547                                                            44.7    0.001 
PHYRA_80613                                                           44.7    0.001 
SPRG_00122                                                            44.3    0.001 
PITG_18751                                                            44.3    0.001 
PYU1_G009379                                                          44.7    0.001 
PYAP_18874                                                            40.4    0.001 
CCI45212                                                              43.9    0.001 
PYIR_18571                                                            44.3    0.001 
SDRG_11517                                                            44.3    0.002 
PYU1_G013908                                                          44.3    0.002 
H310_00284                                                            44.7    0.002 
SDRG_00506                                                            44.3    0.002 
PYVX_18659                                                            43.9    0.002 
H257_08183                                                            42.4    0.003 
PHYKE_7333                                                            43.5    0.003 
SPRG_07200                                                            43.9    0.003 
PYIW_15296                                                            43.9    0.003 
PHYCA_104912                                                          43.5    0.003 
PYIR_15276                                                            41.6    0.003 
PYAR_20706                                                            43.5    0.003 
H310_06527                                                            42.4    0.004 
SDRG_07732                                                            41.2    0.004 
PHALS_12995                                                           43.5    0.004 
PHYSO_558391                                                          43.1    0.004 
PHYSO_288411                                                          41.6    0.004 
PYVX_17322                                                            42.7    0.004 
PYVX_18030                                                            43.1    0.004 
SDRG_10388                                                            43.1    0.004 
PYU1_G004976                                                          41.2    0.005 
HYAP_04143                                                            42.7    0.005 
PPTG_04005                                                            43.1    0.005 
H310_05127                                                            41.6    0.005 
H257_13672                                                            42.4    0.006 
PYU1_G005703                                                          42.7    0.006 
PYU1_G009058                                                          42.4    0.006 
PYAP_17426                                                            42.4    0.006 
PHYCA_103372                                                          40.4    0.007 
H257_12393                                                            41.2    0.007 
PPTG_16653                                                            42.7    0.007 
PYU1_G001730                                                          42.0    0.009 
H257_06791                                                            42.4    0.010 
SDRG_04254                                                            42.0    0.010 
PITG_03821                                                            42.0    0.011 
PYIW_20853                                                            40.8    0.011 
PPTG_00523                                                            41.6    0.012 
PITG_19249                                                            41.6    0.012 
PITG_00025                                                            41.6    0.013 
PHYSO_553932                                                          40.8    0.013 
SPRG_00527                                                            40.0    0.013 
PITG_10321                                                            41.6    0.013 
PYIW_18435                                                            42.0    0.013 
PYU1_G007193                                                          41.6    0.016 
H310_04140                                                            41.2    0.017 
PPTG_17132                                                            40.8    0.017 
PHYRA_77725                                                           41.6    0.018 
HYAP_02462                                                            41.2    0.018 
SDRG_13236                                                            38.9    0.018 
PYAR_20140                                                            40.4    0.019 
PITG_15195                                                            40.8    0.022 
H257_14373                                                            40.8    0.023 
PYIW_14664                                                            40.8    0.023 
PYAP_13371                                                            40.8    0.025 
H310_14328                                                            40.0    0.026 
PYU1_G010079                                                          37.4    0.027 
PYIW_22999                                                            39.7    0.028 
PHYCA_107875                                                          40.4    0.029 
PYAP_17750                                                            40.0    0.029 
PITG_18462                                                            39.7    0.029 
PYVX_21138                                                            40.4    0.029 
PHYCA_568641                                                          40.4    0.029 
SPRG_15736                                                            40.4    0.031 
PPTG_06536                                                            40.4    0.032 
CCI45120                                                              39.7    0.034 
PHYSO_322360                                                          40.4    0.034 
HYAP_07106                                                            39.7    0.034 
PHYCA_525476                                                          40.4    0.034 
PHALS_07241                                                           39.7    0.035 
H257_07940                                                            40.0    0.036 
SDRG_06909                                                            39.3    0.036 
CCA18170                                                              40.0    0.038 
PHYCA_530915                                                          38.9    0.038 
PHYKE_3015                                                            40.0    0.039 
CCA14180                                                              40.4    0.039 
PYIR_13446                                                            40.0    0.040 
PYVX_17302                                                            40.0    0.041 
CCI43385                                                              40.0    0.042 
PYIR_16966                                                            40.0    0.043 
CCA14023                                                              39.7    0.043 
SPRG_12576                                                            39.3    0.043 
PYU1_G007124                                                          39.7    0.046 
PYIW_21519                                                            39.7    0.047 
CCI43386                                                              40.0    0.048 
PYIR_19269                                                            39.7    0.052 
CCI39998                                                              39.7    0.052 
PYIR_19863                                                            39.7    0.052 
PYVX_14742                                                            40.0    0.054 
PYU1_G001639                                                          39.7    0.054 
PHYRA_81091                                                           38.5    0.056 
PHYRA_75992                                                           38.1    0.056 
PYIR_18310                                                            39.7    0.057 
PYAR_21118                                                            39.3    0.059 
PHYKE_8396                                                            37.7    0.061 
PYAP_13246                                                            39.7    0.061 
H310_11926                                                            39.7    0.062 
PHYKE_6978                                                            39.7    0.062 
SPRG_02871                                                            39.3    0.064 
CCA18895                                                              38.9    0.065 
PYU1_G012889                                                          39.3    0.068 
SDRG_13137                                                            39.3    0.069 
PYAP_19190                                                            39.7    0.069 
SPRG_11898                                                            37.4    0.070 
PHYRA_94120                                                           39.7    0.071 
PHYSO_544210                                                          39.3    0.072 
PHALS_04027                                                           39.3    0.072 
PPTG_24123                                                            39.3    0.075 
PHYCA_104632                                                          39.3    0.078 
PHALS_00606                                                           39.3    0.080 
PYAR_26477                                                            38.1    0.080 
PYIW_21541                                                            39.3    0.088 
PYIR_18633                                                            39.3    0.089 
PYAP_20783                                                            37.7    0.090 
PPTG_06762                                                            38.9    0.091 
H257_11542                                                            38.1    0.093 
PYAR_14906                                                            38.9    0.093 
PHYRA_79317                                                           38.9    0.094 
PHALS_06891                                                           38.9    0.096 
PHYCA_504243                                                          38.9    0.096 
PPTG_19285                                                            38.9    0.098 
PYIW_23779                                                            38.5    0.099 
PYAP_19146                                                            38.5    0.099 
SPRG_05381                                                            37.0    0.100 
HYAP_05107                                                            38.9    0.10  
PHYSO_469986                                                          38.5    0.11  
PHYSO_476986                                                          38.5    0.11  
PYU1_G010963                                                          38.9    0.11  
PPTG_13607                                                            38.5    0.11  
PYIR_16517                                                            38.5    0.11  
SPRG_02199                                                            38.9    0.11  
PHYSO_494439                                                          35.8    0.12  
H257_08184                                                            37.4    0.12  
HYAP_09472                                                            38.5    0.12  
CCA26695                                                              38.1    0.12  
CCA23479                                                              38.1    0.12  
PHALS_00658                                                           38.5    0.12  
PYIR_22040                                                            38.5    0.12  
PYAR_21305                                                            38.1    0.12  
PHALS_13047                                                           38.5    0.12  
PYVX_16734                                                            38.1    0.13  
SDRG_10961                                                            38.5    0.13  
PYAP_15538                                                            38.5    0.13  
PYVX_23721                                                            38.5    0.13  
PPTG_05556                                                            38.5    0.13  
PYAP_19047                                                            38.1    0.14  
PHALS_11589                                                           38.1    0.14  
PITG_06725                                                            38.5    0.14  
PHYSO_358215                                                          38.1    0.14  
PYIR_15591                                                            38.1    0.14  
SPRG_10141                                                            38.1    0.15  
SDRG_00360                                                            38.1    0.16  
PPTG_11751                                                            38.1    0.16  
PHYKE_7837                                                            38.5    0.16  
H257_04593                                                            37.4    0.17  
PYIW_15735                                                            38.1    0.17  
H310_12571                                                            38.1    0.17  
PYAR_16668                                                            38.1    0.17  
PHYSO_317996                                                          38.1    0.17  
PHYSO_516036                                                          36.6    0.18  
PYAP_23336                                                            38.1    0.18  
PYU1_G003426                                                          37.7    0.18  
PYAP_13092                                                            37.4    0.19  
PITG_22857                                                            38.1    0.19  
SDRG_04070                                                            36.6    0.19  
PHALS_01600                                                           37.7    0.20  
PHALS_11946                                                           37.7    0.20  
PHYSO_454028                                                          38.1    0.20  
PYVX_17168                                                            37.4    0.20  
CCA15199                                                              37.7    0.20  
PHYSO_441337                                                          37.4    0.21  
PITG_02789                                                            37.4    0.21  
SPRG_20626                                                            37.0    0.22  
H257_03456                                                            37.7    0.22  
PYAR_25105                                                            37.7    0.23  
CCA19978                                                              37.7    0.23  
PITG_03761                                                            37.4    0.23  
PYIW_13128                                                            37.4    0.24  
PYIR_13224                                                            37.7    0.24  
PYAP_17815                                                            37.0    0.24  
CCI49016                                                              37.7    0.24  
HYAP_09739                                                            36.2    0.25  
PITG_01038                                                            37.4    0.25  
H310_01980                                                            37.4    0.26  
PYIR_25281                                                            37.4    0.27  
SPRG_21099                                                            35.0    0.28  
PYAP_15145                                                            37.4    0.28  
PHYRA_79594                                                           37.4    0.29  
SPRG_11364                                                            37.0    0.31  
PYIR_17889                                                            37.4    0.33  
H310_06619                                                            36.6    0.34  
PHYCA_34102                                                           37.0    0.35  
PYIR_18043                                                            37.0    0.35  
H257_06009                                                            37.0    0.36  
CCI43785                                                              37.0    0.36  
PYAR_17590                                                            37.4    0.36  
PYAR_13579                                                            37.0    0.36  
HYAP_10080                                                            37.4    0.36  
PYVX_13648                                                            37.0    0.37  
HYAP_09737                                                            37.0    0.38  
PYIR_23754                                                            37.0    0.38  
CCA15828                                                              37.0    0.39  
SPRG_17370                                                            36.6    0.39  
SPRG_01977                                                            37.0    0.40  
HYAP_10895                                                            37.0    0.40  
PYVX_24209                                                            37.0    0.40  
PHYCA_529249                                                          36.6    0.41  
PHYRA_95641                                                           37.0    0.41  
HYAP_05167                                                            36.6    0.42  
PYVX_19183                                                            35.8    0.43  
PYIR_23183                                                            36.6    0.43  
PHYRA_75300                                                           36.6    0.44  
PYAR_17169                                                            36.6    0.45  
PYIW_16105                                                            36.6    0.45  
PYIW_16281                                                            36.2    0.47  
PYVX_18934                                                            36.2    0.48  
PYU1_G002995                                                          36.6    0.49  
PPTG_11049                                                            36.6    0.50  
PHALS_02128                                                           36.6    0.51  
PHALS_09475                                                           36.6    0.51  
SPRG_16580                                                            35.4    0.52  
PYAP_24965                                                            36.6    0.53  
CCI44683                                                              36.6    0.53  
SDRG_08349                                                            36.6    0.54  
PPTG_18592                                                            36.6    0.54  
PYAP_13235                                                            36.2    0.57  
SDRG_05421                                                            35.8    0.57  
PYAP_18927                                                            36.6    0.58  
PYU1_G013365                                                          36.2    0.58  
CCA21163                                                              36.2    0.59  
CCI50606                                                              35.8    0.60  
HYAP_03293                                                            35.8    0.61  
PITG_06792                                                            36.6    0.62  
SPRG_15617                                                            34.3    0.63  
PYAR_21461                                                            36.6    0.63  
H310_00896                                                            36.2    0.63  
H310_01196                                                            36.2    0.64  
PHYCA_110463                                                          36.2    0.65  
PHYRA_77467                                                           35.8    0.67  
HYAP_05343                                                            35.8    0.67  
SDRG_10501                                                            36.2    0.69  
PYAR_26118                                                            35.0    0.70  
SPRG_04569                                                            36.2    0.72  
PHYCA_510382                                                          36.2    0.72  
PPTG_16286                                                            36.2    0.75  
PYAR_23449                                                            35.4    0.75  
PPTG_10322                                                            35.8    0.75  
PHYKE_6166                                                            36.2    0.75  
PYAR_23187                                                            35.8    0.76  
PYIW_14039                                                            36.2    0.77  
PYAR_14624                                                            35.0    0.77  
CCA27258                                                              36.2    0.77  
PYAR_20457                                                            34.3    0.77  
PYVX_20261                                                            35.8    0.80  
PYIR_15258                                                            35.8    0.80  
PHALS_13020                                                           35.8    0.81  
PHYSO_326395                                                          36.2    0.81  
PPTG_09394                                                            35.4    0.82  
SDRG_01807                                                            35.0    0.85  
PYAP_18050                                                            35.4    0.86  
PYVX_15421                                                            35.8    0.87  
PYVX_16915                                                            36.2    0.87  
PHYKE_9812                                                            35.4    0.88  
PPTG_20649                                                            35.0    0.90  
SDRG_13550                                                            35.8    0.91  
PPTG_03353                                                            35.8    0.92  
PYIR_15342                                                            35.8    0.92  
SDRG_12435                                                            35.0    0.95  
PITG_07745                                                            35.4    0.95  
PHYCA_98865                                                           35.4    0.97  
PYAP_18210                                                            35.4    0.97  
SPRG_20054                                                            35.4    0.97  
SDRG_06286                                                            34.3    0.98  
PYAP_22590                                                            35.4    1.0   
H257_03535                                                            35.4    1.0   
H310_12511                                                            33.5    1.0   
CCI40171                                                              35.8    1.0   
PHYSO_311785                                                          34.7    1.0   
PHYKE_6696                                                            35.4    1.1   
PHYCA_542886                                                          35.0    1.1   
PYAP_13170                                                            35.4    1.1   
CCA20583                                                              35.4    1.1   
PHYSO_491096                                                          35.4    1.1   
PYAR_17919                                                            33.1    1.2   
PITG_04571                                                            34.3    1.2   
PITG_09090                                                            35.4    1.2   
PITG_02723                                                            35.4    1.2   
PYVX_23586                                                            35.0    1.2   
PYAR_22168                                                            32.7    1.2   
SPRG_17132                                                            35.0    1.2   
PYIW_17946                                                            34.3    1.3   
PYAP_20567                                                            35.0    1.3   
PYIW_19621                                                            35.4    1.3   
H310_06071                                                            35.0    1.3   
PITG_06849                                                            35.0    1.3   
PHYSO_343005                                                          35.4    1.4   
PYIW_25641                                                            35.4    1.4   
PYVX_16402                                                            35.4    1.4   
PHYSO_474309                                                          35.0    1.4   
PYIR_23050                                                            34.7    1.4   
PHYRA_75528                                                           34.7    1.5   
PYU1_G010249                                                          35.0    1.5   
PHYRA_77537                                                           35.0    1.5   
PYU1_G000018                                                          35.0    1.5   
CCI40603                                                              34.7    1.5   
PHYRA_96819                                                           35.0    1.5   
PHALS_08957                                                           35.0    1.5   
PYU1_G009791                                                          34.7    1.6   
PYIW_17284                                                            35.0    1.6   
CCI40615                                                              34.7    1.6   
SPRG_10894                                                            35.0    1.6   
SDRG_13728                                                            35.0    1.6   
H310_14008                                                            34.7    1.7   
PYU1_G009074                                                          34.7    1.7   
CCA14290                                                              34.7    1.7   
PYIR_20315                                                            34.7    1.7   
HYAP_08680                                                            34.7    1.7   
PITG_04905                                                            34.7    1.7   
PYIW_14050                                                            34.7    1.8   
PHYRA_74793                                                           35.0    1.8   
PYVX_15397                                                            35.0    1.8   
PITG_18301                                                            33.5    1.8   
HYAP_01506                                                            33.5    1.8   
PPTG_04666                                                            34.7    1.9   
PHYCA_577126                                                          34.7    1.9   
PHYCA_537866                                                          33.9    1.9   
PHYSO_348603                                                          34.7    1.9   
SPRG_02648                                                            34.7    1.9   
PHYSO_484386                                                          34.7    1.9   
PYVX_17349                                                            32.0    1.9   
PHYKE_6903                                                            34.7    1.9   
PHYSO_479008                                                          34.7    2.0   
PYIW_15865                                                            35.0    2.0   
PYAP_18157                                                            34.3    2.0   
CCI47251                                                              34.7    2.0   
PYIW_22466                                                            34.7    2.0   
PYVX_21774                                                            34.3    2.0   
PYIR_15045                                                            34.7    2.0   
SPRG_09420                                                            34.7    2.0   
SPRG_11477                                                            34.3    2.0   
PPTG_00942                                                            34.3    2.1   
PPTG_13247                                                            34.7    2.1   
PYAR_13415                                                            34.3    2.1   
SDRG_03814                                                            34.7    2.1   
PYU1_G002937                                                          34.3    2.2   
PYAP_19539                                                            34.7    2.2   
H257_16246                                                            34.3    2.2   
PYAR_15260                                                            34.3    2.2   
PYIW_20686                                                            34.7    2.2   
PPTG_00492                                                            34.7    2.3   
SPRG_15545                                                            33.9    2.3   
H257_01336                                                            34.3    2.3   
CCA16906                                                              34.3    2.4   
PHYRA_80698                                                           34.7    2.4   
PPTG_16346                                                            34.3    2.4   
PYVX_14860                                                            33.9    2.5   
PHYSO_549695                                                          34.3    2.5   
PHYSO_496249                                                          34.3    2.5   
SDRG_03834                                                            34.3    2.6   
PITG_05331                                                            34.3    2.6   
PHYRA_79956                                                           33.9    2.6   
PPTG_05311                                                            34.3    2.6   
PYIR_18881                                                            33.9    2.7   
PPTG_18645                                                            34.3    2.7   
H257_03611                                                            34.3    2.7   
PYIW_13113                                                            34.3    2.9   
PHYCA_503511                                                          33.9    2.9   
PHYSO_472659                                                          33.9    2.9   
SPRG_16070                                                            34.3    2.9   
PITG_02571                                                            33.9    2.9   
H310_10136                                                            34.3    3.1   
PITG_18962                                                            34.3    3.1   
PYIW_18956                                                            34.3    3.1   
PYAR_13499                                                            33.9    3.1   
H257_13622                                                            33.9    3.1   
SDRG_11440                                                            33.5    3.2   
H310_02575                                                            34.3    3.2   
PYU1_G003417                                                          33.9    3.2   
PYAP_21108                                                            33.5    3.2   
PHYCA_575745                                                          33.9    3.2   
SDRG_12434                                                            33.5    3.2   
PYAR_21053                                                            33.1    3.2   
PHYRA_82951                                                           33.9    3.3   
PHALS_03635                                                           33.9    3.4   
PHYKE_134                                                             33.5    3.4   
PHYSO_359495                                                          33.9    3.5   
PYIW_16421                                                            33.5    3.5   
PHYSO_487639                                                          33.9    3.6   
PHYSO_322283                                                          33.9    3.6   
PITG_16469                                                            33.9    3.6   
PHYSO_385187                                                          33.9    3.6   
PHYCA_534275                                                          33.5    3.7   
PHYRA_80786                                                           33.5    3.7   
SDRG_16098                                                            33.9    3.8   
PHYSO_566581                                                          33.5    3.8   
PYU1_G004427                                                          33.5    3.8   
H257_00616                                                            33.9    3.8   
SDRG_05728                                                            33.5    3.8   
PYIW_15067                                                            33.9    4.0   
PHALS_14198                                                           33.9    4.1   
H257_13099                                                            33.9    4.1   
PYIR_15351                                                            33.9    4.1   
PYIW_25324                                                            32.0    4.1   
SPRG_15640                                                            33.9    4.1   
PYIW_17180                                                            33.5    4.3   
SDRG_14728                                                            33.1    4.7   
PPTG_12668                                                            33.5    4.8   
SDRG_06451                                                            33.5    4.9   
PHYCA_539182                                                          33.5    4.9   
H310_11163                                                            33.5    4.9   
SPRG_05620                                                            33.1    4.9   
H257_14340                                                            33.1    5.0   
SPRG_07442                                                            33.1    5.2   
H310_13121                                                            33.1    5.2   
PYVX_19904                                                            33.5    5.2   
PHYRA_95252                                                           33.1    5.4   
PHYKE_6488                                                            32.7    5.4   
PHYSO_348645                                                          32.3    5.5   
PYVX_21870                                                            33.5    5.5   
PYAP_21318                                                            33.1    5.6   
PYIW_22457                                                            32.7    5.6   
H257_14973                                                            33.1    5.9   
PHYRA_76714                                                           32.3    6.0   
SPRG_14175                                                            32.7    6.1   
H310_04502                                                            32.7    6.1   
SDRG_07298                                                            32.3    6.1   
PITG_06841                                                            33.1    6.1   
SDRG_14644                                                            31.6    6.3   
SDRG_12042                                                            32.7    6.3   
PYVX_21690                                                            32.7    6.4   
PHALS_04109                                                           32.7    6.5   
HYAP_05437                                                            32.7    6.5   
PHYRA_44707                                                           30.4    6.6   
PYAP_16130                                                            33.1    6.6   
H257_04671                                                            32.3    6.8   
PYAP_13397                                                            32.7    6.8   
PHYCA_113233                                                          30.4    6.9   
SPRG_08279                                                            32.0    7.1   
CCA14887                                                              33.1    7.2   
SPRG_05600                                                            33.1    7.2   
PYAR_24751                                                            32.3    7.2   

>PHALS_11563
Length=613

 Score = 1157 bits (2994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/613 (100%), Positives = 613/613 (100%), Gaps = 0/613 (0%)

Query  1    MKNRGSRNISNGGPDRRGPRREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhk  60
            MKNRGSRNISNGGPDRRGPRREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLAKYHHK
Sbjct  1    MKNRGSRNISNGGPDRRGPRREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLAKYHHK  60

Query  61   kkkssaPRTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTC  120
            KKKSSAPRTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTC
Sbjct  61   KKKSSAPRTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTC  120

Query  121  PICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQI  180
            PICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQI
Sbjct  121  PICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQI  180

Query  181  PPRVGSDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrk  240
            PPRVGSDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEAATFAARKRTRK
Sbjct  181  PPRVGSDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEAATFAARKRTRK  240

Query  241  LPNVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTS  300
            LPNVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTS
Sbjct  241  LPNVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTS  300

Query  301  ERLSISDDCSRGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLL  360
            ERLSISDDCSRGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLL
Sbjct  301  ERLSISDDCSRGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLL  360

Query  361  KEYTDELEHENAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEE  420
            KEYTDELEHENAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEE
Sbjct  361  KEYTDELEHENAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEE  420

Query  421  AQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFS  480
            AQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFS
Sbjct  421  AQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFS  480

Query  481  SPMYKSKVQTFSLQHENTHWPSPYEQTLAESVEDFHLSSSFAsdlltedetttsfeddeR  540
            SPMYKSKVQTFSLQHENTHWPSPYEQTLAESVEDFHLSSSFASDLLTEDETTTSFEDDER
Sbjct  481  SPMYKSKVQTFSLQHENTHWPSPYEQTLAESVEDFHLSSSFASDLLTEDETTTSFEDDER  540

Query  541  SFARITENSGYFPALGDAPSNESRHPSENSTASGSSHPWGNTISSNVAgrgskkkggkkg  600
            SFARITENSGYFPALGDAPSNESRHPSENSTASGSSHPWGNTISSNVAGRGSKKKGGKKG
Sbjct  541  SFARITENSGYFPALGDAPSNESRHPSENSTASGSSHPWGNTISSNVAGRGSKKKGGKKG  600

Query  601  ISVFSTTQRRSYR  613
            ISVFSTTQRRSYR
Sbjct  601  ISVFSTTQRRSYR  613

>PHYCA_535379
Length=627

 Score = 772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/610 (68%), Positives = 486/610 (80%), Gaps = 22/610 (4%)

Query  22   EQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIEYLHANYRFV  81
            EQ K M++EAR TRNGVSANHLLNFS+PERE    +H KKKKSSAPRTQIEYLHANYRFV
Sbjct  22   EQKKTMDYEARATRNGVSANHLLNFSMPEREKTVYHHQKKKKSSAPRTQIEYLHANYRFV  81

Query  82   IAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCW  141
            IAPLDP+ +VPTWD+E+LTEWS VEQVLLWYD  +PQTCPICMD+FR PKITKCGH+FCW
Sbjct  82   IAPLDPDAVVPTWDLEALTEWSSVEQVLLWYDIESPQTCPICMDTFRAPKITKCGHVFCW  141

Query  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIF  201
            PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL QLQIPP VGSDVTFQFLERPKS +F
Sbjct  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVGSDVTFQFLERPKSSMF  201

Query  202  PQLRVLP--STQLTDDCTESSA-FTHSSSEaatfaarkrtrkLPNVNDADATYSRILEAT  258
            PQLRVLP    ++  + TE+S+  T SS EA  FAARKR+RKLPNV DADATYSRILEAT
Sbjct  202  PQLRVLPPLDIKVERNATEASSNSTQSSPEAIAFAARKRSRKLPNVTDADATYSRILEAT  261

Query  259  PEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYGKPV  318
            P YLRELL +EMR LQSMDAEF+SSGDVDNLPFV EAMRNTS RL+ SDD + GTYG   
Sbjct  262  PGYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFTHGTYGANH  321

Query  319  TTFA--SDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEHEN-----  371
            +  A  + +  KP +  + D+YSFYQ+A+GTYV+LHPLNMKCLLKE++D  +HE      
Sbjct  322  SNIANVAGKKGKPRDDNSGDLYSFYQLADGTYVVLHPLNMKCLLKEFSDTHQHEQEEDSQ  381

Query  372  --AVEVKMESTWTTE-TSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFL  428
              A + ++E+ WT E +S A S   P +RY L+PEQ+HGRVLDIEH +MDEEAQKR+RFL
Sbjct  382  ELAHQKELEAAWTQEGSSSAGSEPLPVDRYQLLPEQIHGRVLDIEHVVMDEEAQKRYRFL  441

Query  429  SHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSSPMYKSKV  488
            SHLPRFCDFY+CELDL+SQLS+STL+AF+NDLKKR KQR+ K+K  +TPT SSP++K   
Sbjct  442  SHLPRFCDFYVCELDLTSQLSQSTLNAFRNDLKKRTKQRKLKMKQQSTPTPSSPIFKRNA  501

Query  489  QTFSLQHENTHWPSPYEQTLAESVEDFHLSSSFAsdlltedetttsfeddeRSFARITEN  548
              FSL+ E   WPSPYEQ LAES+E+FHLS+S + +L  E    +S  D+ERSFAR+TEN
Sbjct  502  DAFSLEEEGMMWPSPYEQALAESLEEFHLSNSSSLELEAELHAVSSSTDEERSFARVTEN  561

Query  549  SGYFPALGDAPSNESRHPSENSTASGSSHPWGN-----TISSNVAgrgskkkggkkgISV  603
            SGYFPALG    +ESR P     A GS   WGN      +++  +G+G KKK GKKG+SV
Sbjct  562  SGYFPALGGVGPSESRDP----IAFGSPSAWGNPSTSPPVTAWNSGKGGKKKAGKKGVSV  617

Query  604  FSTTQRRSYR  613
            FSTTQRRSYR
Sbjct  618  FSTTQRRSYR  627

>PPTG_09251
Length=641

 Score = 763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/604 (68%), Positives = 473/604 (78%), Gaps = 19/604 (3%)

Query  23   QNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIEYLHANYRFVI  82
            Q K M++EARVTRNGVSANHLLNFS+PERE    +H KKKKSSAPRTQ EYLHANYRFVI
Sbjct  44   QKKTMDYEARVTRNGVSANHLLNFSMPERERHVYHHQKKKKSSAPRTQSEYLHANYRFVI  103

Query  83   APLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWP  142
            APLD + IVPTWD+E+LTEWS VEQ+LLWYD  +PQTCPICMD+FR PKITKCGHIFCWP
Sbjct  104  APLDHDTIVPTWDLEALTEWSSVEQILLWYDVESPQTCPICMDTFRAPKITKCGHIFCWP  163

Query  143  CILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIFP  202
            CILRYLSMTDKYWRRCPMCFESVQKGHLR+VQLQQLQIPP VGSDVTFQFLERPKS +FP
Sbjct  164  CILRYLSMTDKYWRRCPMCFESVQKGHLRNVQLQQLQIPPHVGSDVTFQFLERPKSSMFP  223

Query  203  QLRVLPSTQLTDDCTESSAFTHSSS---EaatfaarkrtrkLPNVNDADATYSRILEATP  259
            QLRVLP+ +   +  E+ A +HS+    EA  FAARKR+RKLPNVND DA YSRILEATP
Sbjct  224  QLRVLPTAESKGEHAETDASSHSTQSTPEAVAFAARKRSRKLPNVNDVDAIYSRILEATP  283

Query  260  EYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYGKPVT  319
            EYLRELL +EMR LQSMD EF+SSGDVD+LPFV EAMRNTS RL+ SDD S GTY +  +
Sbjct  284  EYLRELLYSEMRDLQSMDTEFRSSGDVDSLPFVEEAMRNTSGRLAKSDDFSHGTYRQANS  343

Query  320  TFASDQSIK--PLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEH--ENAVEV  375
               S    K  P E+G+ D YSFYQIA+GTYV+LHPLNMKCLLKEY+DE +H  E+  + 
Sbjct  344  ASNSTAGKKSTPKENGSGDAYSFYQIADGTYVVLHPLNMKCLLKEYSDEHQHEQEHGEDA  403

Query  376  KMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLSHLPRFC  435
             +E+ W  E+S A++   P +RYHL+PE++HG+VLDIEH +MDEEAQKR+RFLSHLPRFC
Sbjct  404  HLEAAW-IESSSASAEPLPVDRYHLLPERIHGKVLDIEHVVMDEEAQKRYRFLSHLPRFC  462

Query  436  DFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSSPMYKSKVQTFSLQH  495
            DFYICELDL+SQLS STL+ F+NDLKKRAKQR+HK K  N P  SSP++K     FSLQ 
Sbjct  463  DFYICELDLTSQLSSSTLNTFRNDLKKRAKQRKHKHK-QNAPIPSSPIFKRNADAFSLQE  521

Query  496  ENTHWPSPYEQTLAESVEDFHLSSSFAsdlltedetttsfeddeRSFARITENSGYFPAL  555
            E   WPSPYEQ LAES+E+FHLS+S     +  D    S  D+ERSFAR+TENSGYFPAL
Sbjct  522  EGMMWPSPYEQALAESLEEFHLSNS----SVELDAEHHSAADEERSFARVTENSGYFPAL  577

Query  556  GDAPSNESRHPSENSTASGSSHPWGNTISSNVAgr------gskkkggkkgISVFSTTQR  609
            G A + E R    +  A GS   WGN  +S  A        G KK  GKKG+SVFSTTQR
Sbjct  578  GGAAAREPRPHVTDPIAFGSPSAWGNASTSPPAVAWSSGKGGKKKGAGKKGVSVFSTTQR  637

Query  610  RSYR  613
            RSYR
Sbjct  638  RSYR  641

>PHYRA_81674
Length=616

 Score = 735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/616 (67%), Positives = 473/616 (77%), Gaps = 33/616 (5%)

Query  16   RRGPRREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIEYLH  75
            RRGPRREQ KNM++E RVTRNGVSANHLLNF+LPERE    +H KKKKSSAPRTQ EYLH
Sbjct  16   RRGPRREQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQKKKKSSAPRTQSEYLH  75

Query  76   ANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKC  135
            ANYRFVI+PL+P+ +VPTWD+E+LTEWS VEQVLLWYD  +PQTCPICMD+FR PKITKC
Sbjct  76   ANYRFVISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKC  135

Query  136  GHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLER  195
            GHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL QLQIPP V SD TFQFLER
Sbjct  136  GHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQIPPHVDSDATFQFLER  195

Query  196  PKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVNDADATYSRIL  255
            PKS +FPQLR LPS ++  + T  SA      EA+ FA RKR+RKLP++ND DATYSRIL
Sbjct  196  PKSSMFPQLRALPSAEV--EATSRSAIP--PPEASAFAERKRSRKLPSINDVDATYSRIL  251

Query  256  EATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYG  315
            EATP YLRELL +EMR LQSMDAEF+SSGDVDNLPFV EAMRNTS RL+ SDD S GTYG
Sbjct  252  EATPAYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYG  311

Query  316  KPVT-TFASDQSI---KPLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEH--  369
               T    S+  +   KP E+ + + YSFYQIA+GTYV+LHPLNMKCLL+EY+DE +H  
Sbjct  312  SSHTYNMNSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLLREYSDEHQHEL  371

Query  370  -----ENAVEVKMESTWTTET-SCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQK  423
                 E+A + +ME+ WT E  S A+S   PA+RYHL+PE++HGRVLDIEH +MDEE  K
Sbjct  372  EGRHEEDARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDIEHVVMDEEVLK  431

Query  424  RFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSSPM  483
            R+RFLSHLPRFCDFYICELDL+SQLS STL+ F+N+LKKR KQR+ K +  N  T SSP+
Sbjct  432  RYRFLSHLPRFCDFYICELDLTSQLSPSTLNLFRNELKKRTKQRKQKQRQQNATTPSSPI  491

Query  484  YKSKVQTFSLQHENTHWPSPYEQTLAESVEDFHLSSSFAsdlltedetttsfeddeRSFA  543
            +KS    FSL+ E   WPSPYEQ +AES+E+FHLS+S       E ++     D E SFA
Sbjct  492  FKSNAAAFSLEQEGMTWPSPYEQAIAESLEEFHLSNS-------ELDSAAVSPDVESSFA  544

Query  544  RITENSGYFPALGDAPSNESRHPSENSTASGSSHPWGNTISSNVAgr------gskkkgg  597
            R+TENSGYFPALG  P    R P  +  A GS   WGN  +S  A        G KK  G
Sbjct  545  RVTENSGYFPALGGEP----RTPVADPIAFGSPAAWGNASTSPPAAAWGSGKGGKKKGAG  600

Query  598  kkgISVFSTTQRRSYR  613
            KKG+SVFSTTQRRSYR
Sbjct  601  KKGVSVFSTTQRRSYR  616

>PHYSO_315018
Length=636

 Score = 734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/619 (66%), Positives = 469/619 (76%), Gaps = 31/619 (5%)

Query  22   EQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIEYLHANYRFV  81
            EQ KNM++EARVTRNGVSANHLLNFS+PERE    +H KKKKSSAPRTQ EYLHANYRFV
Sbjct  22   EQKKNMDYEARVTRNGVSANHLLNFSMPERERHVHHHQKKKKSSAPRTQSEYLHANYRFV  81

Query  82   IAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCW  141
            IAPLDP+ +VPTWD+E+LTEWS VEQVLLWYD  +PQTCPICMD+FR PKITKCGHIFCW
Sbjct  82   IAPLDPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTCPICMDTFRAPKITKCGHIFCW  141

Query  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIF  201
            PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQ+PP VG DV FQFLERPKS +F
Sbjct  142  PCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQVPPHVGDDVAFQFLERPKSSMF  201

Query  202  PQLRVLPSTQLTDDCTESSAFTHS---SSEaatfaarkrtrkLPNVNDADATYSRILEAT  258
            PQLRVLP  +   D     A +HS   S +A  FA RKR+RKLP V+D DATYSRILEAT
Sbjct  202  PQLRVLPPAEAKGDLAGIEATSHSALPSPDAPAFAKRKRSRKLPRVDDVDATYSRILEAT  261

Query  259  PEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYGKP-  317
            P+YLRELL +EMR LQSMDAEF+SSGDVDNLPFV EAMRNTS RL+ SDD S GTYG   
Sbjct  262  PDYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYGSNH  321

Query  318  -----VTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEHE--  370
                  +  A+    KP ++   D YSFYQIANGTYV+LHPLNMKCLLKEY+DE +HE  
Sbjct  322  ANNAIGSGSATGVKGKPHQNEGGDAYSFYQIANGTYVVLHPLNMKCLLKEYSDEHQHELE  381

Query  371  -----NAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRF  425
                 +A + ++E+ WT     A+S   P +RYHL+PEQ+ GRVLDIEH +MDEEAQKR+
Sbjct  382  GDHGDDAHQKELEAAWTP---SASSEPLPVDRYHLLPEQIRGRVLDIEHVVMDEEAQKRY  438

Query  426  RFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSSPMYK  485
            RFLSHLPRFCDFYICELDL+SQLS STL++F+NDLKKRAKQR+ K +  N P+ SSP++K
Sbjct  439  RFLSHLPRFCDFYICELDLTSQLSPSTLNSFRNDLKKRAKQRKQKQRQQNAPSPSSPIFK  498

Query  486  SKVQTFSLQHENTHWPSPYEQTLAESVEDFHLSSSFAsdlltedetttsfed-----deR  540
            S    FSL+ E   WPSPYEQ LAES+E+FHL+++ + +   E     +          R
Sbjct  499  SNAAAFSLEQEGMMWPSPYEQALAESLEEFHLTNASSVEFEGEVHAAATPASPYSDDVGR  558

Query  541  SFARITENSGYFPALGDAPSNESRHPSENSTASGSSHPWGNTISSNVAgr------gskk  594
            SFAR+TENSGYFP LG  PS E+R    +  A GS   WGN  +S  A        G KK
Sbjct  559  SFARVTENSGYFPVLGGGPS-ETRAHVTDPIAFGSPAAWGNPSTSPPAVAWSSGKGGKKK  617

Query  595  kggkkgISVFSTTQRRSYR  613
              GKKG+SVFSTTQRRSYR
Sbjct  618  GAGKKGVSVFSTTQRRSYR  636

>PITG_13738
Length=610

 Score = 719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/602 (67%), Positives = 466/602 (77%), Gaps = 18/602 (3%)

Query  19   PRREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIEYLHANY  78
            PRREQ KNM++EARVTRNGVSANHLLNFS+PERE    +H KK KSS PRTQ EYLHANY
Sbjct  20   PRREQKKNMDYEARVTRNGVSANHLLNFSMPERERQVHHHQKKTKSSTPRTQSEYLHANY  79

Query  79   RFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHI  138
            RFVIAPLD + IVPTWD+E+LTEWS VEQVLLWYD  +PQTCPICMD+FR PKITKCG  
Sbjct  80   RFVIAPLDRDTIVPTWDLEALTEWSSVEQVLLWYDVGSPQTCPICMDTFRAPKITKCGP-  138

Query  139  FCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKS  198
               PCILRYLSM++KYWRRCPMCFESVQKGHLRSVQLQQLQIPP V SDVTFQFLERPKS
Sbjct  139  -PGPCILRYLSMSEKYWRRCPMCFESVQKGHLRSVQLQQLQIPPHVSSDVTFQFLERPKS  197

Query  199  RIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVNDADATYSRILEAT  258
             +FPQLRVLP+ +   +   SS  T SS EAA FAARKR+RKLPNV+DADA YSRILEAT
Sbjct  198  SMFPQLRVLPTAEDKSEHAASSHATQSSPEAAAFAARKRSRKLPNVDDADAIYSRILEAT  257

Query  259  PEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYGKPV  318
             EYLRELL +EMR LQSMD EF+SSGDVDNLPFV EAMRNTS RL+ SDD S GTY +  
Sbjct  258  LEYLRELLYSEMRDLQSMDTEFRSSGDVDNLPFVEEAMRNTSGRLAKSDDFSHGTYRQAN  317

Query  319  TTFASDQSIK--PLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEHENAVEVK  376
            +T  S    K  P +  + D YSFYQIA+GTYV+LHPLNMKCL+KEY+D  EH+   E  
Sbjct  318  STNNSTTGKKNTPKDSDSGDTYSFYQIADGTYVVLHPLNMKCLMKEYSD--EHQEHGEDT  375

Query  377  MESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLSHLPRFCD  436
              + W TE+S  +S   P +RY ++PE++HG++LDIEH ++DEEAQKR+RFLSHLPRFCD
Sbjct  376  QLTAW-TESSSVSSELLPVDRYRMLPERIHGKILDIEHVVLDEEAQKRYRFLSHLPRFCD  434

Query  437  FYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSSPMYKSKVQTFSLQHE  496
            FYICELDL+S LS STL+AF+NDLKKRAKQR+HK K  + PT +SP++K     FS++ E
Sbjct  435  FYICELDLTSHLSSSTLNAFRNDLKKRAKQRKHKHK-QSAPTPASPIFKRNADAFSIEQE  493

Query  497  NTHWPSPYEQTLAESVEDFHLSSSFAsdlltedetttsfeddeRSFARITENSGYFPALG  556
               WPSPYEQ LAES+E+F+LS++       E E   +  D+E+SFAR+TENSGYFPALG
Sbjct  494  GMMWPSPYEQALAESLEEFNLSNT-----SVELEAEHTEADEEQSFARVTENSGYFPALG  548

Query  557  DAPSNESRHPSENSTASGSSHPWGNTISSNVAgr-----gskkkggkkgISVFSTTQRRS  611
             A   E R    +  A GS   WGNT +S  A       G+KKK GKKG+SVFSTTQRRS
Sbjct  549  GAAPIEPRPHVTDPIAFGSPSAWGNTSTSPPAVAWGSGKGAKKKAGKKGVSVFSTTQRRS  608

Query  612  YR  613
            YR
Sbjct  609  YR  610

>PYIW_14754
Length=616

 Score = 551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/634 (50%), Positives = 409/634 (65%), Gaps = 52/634 (8%)

Query  11   NGGPDRRGPRREQ---NKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaP  67
            N G  RRG R++Q   N+ ++HE R TRNGVSANHLLNFSLPERE    +  KKK     
Sbjct  4    NNGSGRRGSRKDQMHMNRALDHEIRSTRNGVSANHLLNFSLPEREKQQVFAKKKKSGPM-  62

Query  68   RTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSF  127
            RTQ E+L AN+RFV+APL+ +   P WD+E+LTEW  VEQVLLW+D A+P +CPIC+D F
Sbjct  63   RTQNEFLQANFRFVVAPLEDDVNTPVWDMEALTEWKNVEQVLLWHDEASPMSCPICLDDF  122

Query  128  RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSD  187
            R PKITKCGHIFCWPCILRYLS+T+KYWRRCPMCF++VQKG LRSV+L+++ +PPRV SD
Sbjct  123  RAPKITKCGHIFCWPCILRYLSLTEKYWRRCPMCFDAVQKGQLRSVRLEKVNLPPRVDSD  182

Query  188  VTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVNDA  247
             TFQFL+R KS  FP +                AF  SSSE       KR RKLP+V D 
Sbjct  183  ATFQFLQRNKSSFFPHM---------------PAFAGSSSE-----NMKRVRKLPSVYDP  222

Query  248  DATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISD  307
             AT+SRILEAT EYL  +LL EMR LQ++DAEF+SSGDVD+LPFV+EAMR TS RL+ +D
Sbjct  223  AATFSRILEATQEYLTHILLDEMRDLQALDAEFRSSGDVDSLPFVDEAMRATSGRLAHND  282

Query  308  DCSRGTYGKPVTTFASDQSIKPL-EHGTNDMYSFYQIANGTYVILHPLNMKCLLKEY---  363
               +     P          K   +  ++++YSFYQ ANG YV+LHPLNMKCLLKE+   
Sbjct  283  GGEQQGGSPPENDTPRRGGGKAATDSSSSEVYSFYQQANGIYVVLHPLNMKCLLKEFAEP  342

Query  364  ----TDELEHENAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDE  419
                 +ELE  + V        +  ++  +       RY L+PE++HGRVL+IEH +MD+
Sbjct  343  KPKDVEELEVRDEVSAIWAEASSLASASTSEIPVAGVRYDLLPERIHGRVLEIEHVVMDD  402

Query  420  EAQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTF  479
            E QKR+RFLSH+PRFCDFY+CELDLS  LS +T+SAF+ ++KKR +QR+ K +  + P  
Sbjct  403  EMQKRYRFLSHMPRFCDFYLCELDLSELLSPATVSAFRGEIKKRERQRKQKQRSKDKPVN  462

Query  480  SSPMYKSKVQTFSLQHENTHWPSPYEQTLAESVED---FH------LSSSFAsdlltede  530
            SSP+YK  +  FSL+ E   WP+P E +L+++ E+    H       ++S A    T  +
Sbjct  463  SSPIYKGALSGFSLEQEGMAWPAPAEMSLSDAFEESLSLHENGAAGEANSRAVIESTSPQ  522

Query  531  tttsfeddeRSFARITENSGYFPALGDAPSNESRHPSENSTASGSSHPWGNTIS------  584
            +      DE SFA IT  SGY+P L  A S+++         + S   WG T S      
Sbjct  523  SPYFGSSDEGSFATITRQSGYYPPLSRAASSDTNTRPAFGDYAQSPLAWGVTASPPPLFD  582

Query  585  -----SNVAgrgskkkggkkgISVFSTTQRRSYR  613
                     G+G KK  GKKG+S+FST+Q+RSYR
Sbjct  583  LDLDSLLRKGKGGKKGSGKKGVSLFSTSQQRSYR  616

>PYVX_20858
Length=621

 Score = 546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/633 (50%), Positives = 409/633 (65%), Gaps = 50/633 (8%)

Query  3    NRGSRNISNGGPDRRGPRREQ----NKNMNHEARVTRNGVSANHLLNFSLPEREHLakyh  58
            N GS +    G  RRGPRREQ     KN++ +AR +RNGVSANHLLNF+LPERE    + 
Sbjct  17   NAGSGSAPGSG--RRGPRREQVDRAKKNLDFDARSSRNGVSANHLLNFTLPEREK-PTFA  73

Query  59   hkkkkssaPRTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQ  118
             KKK    PRTQ E+LHAN+RFVI+ L+    VP  D+E+LTEW+ VEQVLLWYD  +P 
Sbjct  74   RKKKTHVQPRTQSEFLHANFRFVISQLEDRTAVPLGDLEALTEWTSVEQVLLWYDDDSPM  133

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQL  178
            TCPICMD+FR PKITKCGHIFCWPCILRYLS++DKYWRRCPMCFESVQKG LRSV+L+++
Sbjct  134  TCPICMDNFRAPKITKCGHIFCWPCILRYLSLSDKYWRRCPMCFESVQKGQLRSVRLEKV  193

Query  179  QIPPRVGSDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrt  238
            ++PPRVGS+V FQFL+R K+ +FP LR           + + A  H++S           
Sbjct  194  ELPPRVGSEVEFQFLQRSKASMFPTLRQ----------SATPALAHAAS------VTNAN  237

Query  239  rkLPNVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRN  298
              +P++ D+ A +SRILE+TPEY+ +L+LAEMR L+++DAE +SSG+VD+LPFV EAMR 
Sbjct  238  DCVPSIYDSAAAFSRILESTPEYVMQLVLAEMRDLEALDAEHRSSGEVDSLPFVVEAMRA  297

Query  299  TSERLSISDDCSRGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKC  358
            TS RL+  +  S G           D     +   T ++YSFYQIANG+YVILHP+NMKC
Sbjct  298  TSGRLAQLESSSHGD---------RDSDDDHVRVATGELYSFYQIANGSYVILHPINMKC  348

Query  359  LLKEYTDELEHENA--VEVKMESTWTTETSCANSRSP--PANRYHLVPEQVHGRVLDIEH  414
            LLKEY+ E   E A     ++   W+     A    P  P +R+H +P+ V GRVLD+EH
Sbjct  349  LLKEYSPENRVEAAPPSNDQVAEAWSDTGGTAPESHPVLPVDRHHFMPDTVRGRVLDVEH  408

Query  415  FIMDEEAQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLK--  472
             +MD+E+QKR+RFLSHLPRFCD Y+CE+DLS+QLS +TL  F+ +LKKR K R  + K  
Sbjct  409  VVMDDESQKRYRFLSHLPRFCDLYVCEIDLSAQLSAATLECFRAELKKREKHRRAEAKHR  468

Query  473  -LLNTPTFSSPMYKSKVQTFSLQHENTHWPSPYEQT--LAESVEDFHLSSSFAsdllted  529
                    +SP++ S++  FS++ E   WP+P E +  + E   D    S  A       
Sbjct  469  HAEAAARAASPLFASRMDGFSIEQEGMMWPAPAELSSEMHELSLDESGGSDEAHLSPVSP  528

Query  530  etttsfeddeRSFARITENSGYFPALGD-APSNESRHPSENSTASGSSHPWGNTISSN--  586
              TT   DDE SFA IT  SGYFP LG  A  + S   + +S + GS   WG   S++  
Sbjct  529  PLTTLATDDESSFATITRQSGYFPPLGGPAHHSPSLGAAPSSGSFGSPSAWGAHPSTSPP  588

Query  587  ------VAgrgskkkggkkgISVFSTTQRRSYR  613
                      G KK GGKKG+ +FSTTQRRSYR
Sbjct  589  ALDWDAAGRGGKKKAGGKKGVPLFSTTQRRSYR  621

>PYU1_G005962
Length=624

 Score = 535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/642 (48%), Positives = 406/642 (63%), Gaps = 60/642 (9%)

Query  11   NGGPDRRGPRREQ---NKNMNHEARVT-RNGVSANHLLNFSLPEREHLakyhhkkkkssa  66
            N G  RR  R++Q   N+ +++E R   RNGVSANHLLNFSLPERE       KK     
Sbjct  4    NNGFGRRSSRKDQLHLNRTLDYEIRTGGRNGVSANHLLNFSLPEREKQVYVKKKKNAPM-  62

Query  67   PRTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDS  126
             RTQ EYLHANYRFV+APL  +   P WD+E+LTEW  VEQVLLWYD A+P +CPIC+D 
Sbjct  63   -RTQNEYLHANYRFVVAPLSNDANTPFWDMEALTEWKNVEQVLLWYDEASPASCPICLDD  121

Query  127  FRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGS  186
            FR PKITKCGHIFCWPCILRYLS++DKYWRRCPMCFESVQKG LRSV+L ++ +PPRV S
Sbjct  122  FRAPKITKCGHIFCWPCILRYLSLSDKYWRRCPMCFESVQKGQLRSVRLDKVSLPPRVNS  181

Query  187  DVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVND  246
            D TFQFL+R KS  FP LR      L D   ++SA    + + A          LP+V D
Sbjct  182  DATFQFLQRSKSSYFPHLRSDSKHDLND--LDASALGGGNKKRARK--------LPSVYD  231

Query  247  ADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSIS  306
              ATYSRILE++ EYL +LLL EMR L+++DAEF+SSGDVD+LPFV EAMR TS RL+ +
Sbjct  232  PAATYSRILESSQEYLTQLLLDEMRDLEALDAEFRSSGDVDSLPFVEEAMRATSGRLAQN  291

Query  307  DDCSRGTYGKPVTTFASDQSIKPLEHGTN------DMYSFYQIANGTYVILHPLNMKCLL  360
            D       G   +  +  ++    E G +      ++YSFYQ++NG YV+LHPLNMKCL+
Sbjct  292  D-------GSQQSVSSGYEAANEYEAGASSGGEDENVYSFYQLSNGIYVVLHPLNMKCLM  344

Query  361  KEYTD--------ELEHENAVEVKMESTWTTETSCANSRSPPAN-RYHLVPEQVHGRVLD  411
            KEY +        + +H++  +V + + W   TS ++S       RY L+P  + GR+LD
Sbjct  345  KEYAEPKRKERDADHDHKDPDDV-VSAAWADATSPSSSSELSTGPRYDLLPNTIRGRILD  403

Query  412  IEHFIMDEEAQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKL  471
            +EH +MDEE QKR+RFLSHLPRFCDFY+CELDLS QLS  TL AF+ ++KKR KQR+ + 
Sbjct  404  VEHVVMDEEMQKRYRFLSHLPRFCDFYLCELDLSGQLSPETLDAFRGEIKKREKQRKQRQ  463

Query  472  KLLNTPTFSSPMYKSKVQTFSLQHENTHWPSPYEQTLAESVE------------DFHLSS  519
            +     + +SP+YK  +  FS++ E   WP+P E +L+++ +            D   ++
Sbjct  464  RS-KARSANSPVYKGALAGFSIEQEGMSWPAPAEMSLSDAFQEGVNLNGTYDEGDDLAAA  522

Query  520  SFAsdlltedetttsfeddeRSFARITENSGYFPALG---DAPSNESRHPSENSTASGSS  576
              AS   +         D E SFA IT  SGY+P L    ++ + E+ H    S    +S
Sbjct  523  QIASTSTSPPSPYYPAYDAEGSFATITRQSGYYPPLSRVTNSEAGEAAHTQSPSVWGAAS  582

Query  577  HP---WGNTISS--NVAgrgskkkggkkgISVFSTTQRRSYR  613
             P   +   + S     G+G K   GKKG+++FST+Q+RSYR
Sbjct  583  SPPPLFDLDLDSLPRTKGKGKKGGAGKKGVALFSTSQQRSYR  624

>PYIR_15178
Length=638

 Score = 530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/649 (48%), Positives = 409/649 (63%), Gaps = 60/649 (9%)

Query  11   NGGPDRRGPRREQ---NKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaP  67
            N G  RRG R++Q   N+ +++E R TRNGVSANHLLNFSLPERE   +   KKKK+   
Sbjct  4    NNGSGRRGSRKDQVHMNRALDYEIRSTRNGVSANHLLNFSLPERE--KQVFTKKKKAGPT  61

Query  68   RTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSF  127
            RTQ E+LHAN+RFVIAPL+ +   P WD+E+LTEW+ VEQVLLWYD A+P +CPIC+D F
Sbjct  62   RTQNEFLHANFRFVIAPLEDDASTPFWDMEALTEWTSVEQVLLWYDEASPMSCPICLDDF  121

Query  128  RVPKITKCGHIF--------CWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQ  179
            R PKITKCGHIF         WPCILRYLS+T+KYWRRCPMCF+SVQKG LRSV+L+++ 
Sbjct  122  RAPKITKCGHIFWCERRSSTLWPCILRYLSLTEKYWRRCPMCFDSVQKGQLRSVRLEKVD  181

Query  180  IPPRVGSDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtr  239
            +PPRV SD TFQFL+R KS  FP L   P  Q        +    +S++           
Sbjct  182  LPPRVDSDATFQFLQRSKSSFFPHL---PIAQQHGSPAAGAGNGGASNKKRVRK------  232

Query  240  kLPNVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNT  299
             LP+V D  ATYSRILE+  EYL  +L+ EMR L+++DAEF SSGDVD+LPFV EAMR T
Sbjct  233  -LPSVYDPAATYSRILESNREYLTHILMDEMRDLEALDAEFHSSGDVDSLPFVEEAMRAT  291

Query  300  SERLSISDDCSRGTYGKPV--TTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMK  357
            S RL+   + S    G P   T  +   +        +++YSFYQ+ANG YV+LHPLNMK
Sbjct  292  SGRLA--QNGSGKGQGPPDNDTNRSGAMTSGSKADSGSEVYSFYQLANGIYVVLHPLNMK  349

Query  358  CLLKEYT-------DELEHENAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVL  410
            CLLKE+        DE++  + V        +  ++ ++       RY L+PE++HGRVL
Sbjct  350  CLLKEFAEPKPKEEDEVQERDEVNAAWAEASSLSSASSSDTPAVGVRYDLLPERIHGRVL  409

Query  411  DIEHFIMDEEAQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHK  470
            D+EH +MD+E QKR+RFLSHLP+FCDFY+CELDLS  LS +TL AF+ ++KKR +QR+ K
Sbjct  410  DVEHVVMDDEMQKRYRFLSHLPKFCDFYLCELDLSEFLSPATLGAFRGEIKKRERQRKQK  469

Query  471  LKLLNTPTFSSPMYKSKVQTFSLQHENTHWPSPYEQTLAESVE------DFHLSSSF---  521
             K   + + +SP+YK  +  FSL+ E   WP+P E +L+++ E      D H        
Sbjct  470  QKSKQSKSANSPIYKGAMSGFSLEQEGMAWPAPAEMSLSDAFEESVSLNDHHNGGEHDHH  529

Query  522  -AsdlltedetttsfeddeRSFARITENSGYFPALGDAPSNESRHPSENST-----ASGS  575
             A+   T  ++      DE SFA IT  SGY+P L  A S++S  P+  +      A GS
Sbjct  530  HANLESTSPQSPYFGSYDESSFATITRQSGYYPPLSRAGSSDSGAPTSAAAAFGDYARGS  589

Query  576  SHPWGNTISSNV-----------AgrgskkkggkkgISVFSTTQRRSYR  613
               WG T S               G+G KK  GKKG+S+FST+Q+RSYR
Sbjct  590  PSAWGVTSSPPPLFDLDLDSLPRKGKGGKKGSGKKGVSLFSTSQQRSYR  638

>PYAR_23206
Length=600

 Score = 499 bits (1286),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 303/625 (48%), Positives = 387/625 (62%), Gaps = 77/625 (12%)

Query  31   ARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIEYLHANYRFVIAPLDPECI  90
             R+TRNG+SANHLLNF+LPERE  A    KKK +S  RTQ+EYLHANYRFVIAPL  +  
Sbjct  11   GRMTRNGLSANHLLNFTLPEREKYAPQGKKKKAASV-RTQMEYLHANYRFVIAPLSNDDA  69

Query  91   VPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIF-C--WPCILRY  147
            V  WD+E+LTEW  VEQVLLWYD ++P TCPIC+DSFR PKIT+CGHIF C  WPCILRY
Sbjct  70   VACWDIETLTEWKSVEQVLLWYDESSPATCPICLDSFRAPKITRCGHIFWCVFWPCILRY  129

Query  148  LSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIFPQLRVL  207
            LSMTDKYWRRCPMCF++VQKG LRSVQLQ +Q+PPRV +   FQFL RPK+ + P +R  
Sbjct  130  LSMTDKYWRRCPMCFDAVQKGQLRSVQLQSVQLPPRVDATTQFQFLRRPKASLSPFVRG-  188

Query  208  PSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVNDADATYSRILEATPEYLRELLL  267
            PS++                       ++  RKLP V D +A Y+RILE+T EYL  L +
Sbjct  189  PSSK----------------------EKRVVRKLPTVYDEEAKYARILESTHEYLLHLAM  226

Query  268  AEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYGKPVTTFA--SDQ  325
             EMR L+ +DAE +SSGD D LPFV EAM+ TS+RL+ ++        +PVT  +  S  
Sbjct  227  DEMRDLEVLDAECRSSGDADTLPFVEEAMKATSQRLAAAE------ANQPVTAESELSSS  280

Query  326  SIKPLEH-GTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELE--HENAVEVKMESTWT  382
              + L+  G +DMYSFYQ  NG YV+LHPLNMKCL +E+ ++++   E   E +  +T T
Sbjct  281  KFQSLDGLGVSDMYSFYQQQNGCYVVLHPLNMKCLTREFAEKVQPSAEADEETQASATTT  340

Query  383  TETSCANSRSPPAN----------RYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLSHLP  432
             E +   + SPP +           Y L+P+ + GRVLD+EH +MD+  QKR+RFL HLP
Sbjct  341  LEDAWTGAASPPLSSRAEPSVHSPHYELLPDTIEGRVLDVEHLVMDDAVQKRYRFLGHLP  400

Query  433  RFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHK---LKLLNTPTFS-----SPMY  484
            +FCDFY+CELDLS  LSR TL AF+ +LKKR KQR  K    K  N+   S     S M 
Sbjct  401  KFCDFYVCELDLSPLLSRETLEAFRPELKKREKQRRLKNNADKKSNSGNNSKHANGSAMS  460

Query  485  KS----------KVQTFSLQHENTHWPSPYEQ-TLAESVED-FHLSSSFAsdlltedett  532
            ++           ++ FSL+    HWP+P E  +LA++ +D    SS  AS    +    
Sbjct  461  RATLAVHYGDHPTLRGFSLEDGEAHWPAPSEMPSLADAFQDGLQFSSDSASSFTDQVPAD  520

Query  533  tsfeddeRSFARITENSGYFPALG----DAPSNESRHPSENSTASGSSHPWGNTISSNVA  588
            +       SFA IT NSGY+P LG     AP + +  PS   +++G     G        
Sbjct  521  SDA-----SFATITRNSGYYPPLGGSASGAPRDVTSSPSMWGSSTGPLSGSGAASPPMAP  575

Query  589  grgskkkggkkgISVFSTTQRRSYR  613
            G G KK   KKG  +FSTTQRRSYR
Sbjct  576  GGGKKKGAMKKGTPLFSTTQRRSYR  600

>CCA15905
Length=620

 Score = 374 bits (960),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 239/641 (37%), Positives = 342/641 (53%), Gaps = 88/641 (14%)

Query  20   RREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIEYLHANY-  78
            RRE+N     ++R TR GV AN+LLNFSLPER++        KK+   RTQ E+LHA Y 
Sbjct  21   RRERNDFNQEKSRWTRRGVPANYLLNFSLPERQNSFHAGRYGKKALVTRTQKEFLHAKYT  80

Query  79   ----------------RFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPI  122
                            RF+I  L  +       +E L EW  VEQV +W  A  P  CPI
Sbjct  81   KRTSQHMIVIKFLCSFRFIIGALRRD--ESHRLLEDLVEWKNVEQVKVWQKAKFPMQCPI  138

Query  123  CMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPP  182
            C+D FR+P+ T+CGHIFCW CIL YLS++DKYWRRCPMCFE V+K HLR+V+++ +  PP
Sbjct  139  CLDEFRLPRTTRCGHIFCWTCILHYLSLSDKYWRRCPMCFECVEKIHLRAVEIESVVSPP  198

Query  183  RVGSDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLP  242
             VGS   F+FL+R K      L V  S Q  D         HS +     + ++    +P
Sbjct  199  VVGSIAKFKFLQRSK------LDVATSYQPID---------HSKA-----SKKRFLPTIP  238

Query  243  NVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSER  302
            +V D ++ +SR+++AT EYL +LL ++++ L+S+    +S G+++ LPF+  A+ +T+ R
Sbjct  239  SVYDPNSRFSRVMQATNEYLIQLLDSDLQQLRSLADGLRSCGELNELPFIEGAILHTTSR  298

Query  303  LSISDDCSRGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKE  362
            L    D  +        T    + +   E  +N  YSFYQ+ NGTYVILHP+NMKCLLKE
Sbjct  299  L----DSIKIVVDDDELTKMQMEELNGTEGRSNSFYSFYQLENGTYVILHPVNMKCLLKE  354

Query  363  YTDELEHEN---------------AVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHG  407
               + E  N               +V +  E+  T+  S   S      ++  +P+ V G
Sbjct  355  ALLQSEKRNKTSHRNGEVDDLSDSSVNLPSEAAETSSMS-VTSDGGSCTQHDALPDYVQG  413

Query  408  RVLDIEHFIMDEEAQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQR  467
             VL +EH +MD+E+Q+R+RFLSHLP++CDFY+CELDLS  LS+ TL + K +L+ R +QR
Sbjct  414  EVLSVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLHSLKKELESRRRQR  473

Query  468  EHKLKLLNTPTFSSPMYKSKVQTFSLQHENTHWPSPYE------QTLAESVEDFHLSSSF  521
              K KLL+     + +  +     ++  + T   SP E        L E   + HL +S 
Sbjct  474  AAKQKLLDEQLDDNEIVHASPNCTNISSDATPSISPREGVEPEPSNLVEEFVELHLQNS-  532

Query  522  AsdlltedetttsfeddeRSFARITENSGYFPALGDAPSNESRHPSENSTASGSSHPWG-  580
                        + ++   S+A +T NSGYFPAL       S    E + A     PWG 
Sbjct  533  --------RIDQASDESSSSYATVTRNSGYFPALEGRIVQASVSGHEEANA-----PWGR  579

Query  581  -----NTISSNVAgrgskkkggkkgIS---VFSTTQRRSYR  613
                 N +  + A     K+   +  +   VFST+QRRSYR
Sbjct  580  NREGTNEVFGHAASETGNKRTKGRKKNSKEVFSTSQRRSYR  620

>PYAP_22843
Length=472

 Score = 341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 215/500 (43%), Positives = 286/500 (57%), Gaps = 64/500 (13%)

Query  150  MTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIFPQLRVLPS  209
            MTDKYWRRCPMCFESVQKG LRSV+L+ + +PP++ S  TFQFL+RPK+ +FP +     
Sbjct  1    MTDKYWRRCPMCFESVQKGQLRSVRLESVHLPPQLDSQATFQFLQRPKASLFPHI-----  55

Query  210  TQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVNDADATYSRILEATPEYLRELLLAE  269
                          H S+     A RKR RKLP V D +A Y+RILE+T EY+ +L L+E
Sbjct  56   --------------HDST-GGPMAPRKRVRKLPTVYDEEAKYARILESTKEYVVQLALSE  100

Query  270  MRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYGKPVTTFASDQSIKP  329
            MR L+++DAE +SSGD+D LPFV EAM+ TS RL+  D  +  T  +    F S   +  
Sbjct  101  MRDLEALDAECRSSGDIDTLPFVEEAMKATSGRLAGYDAMTDNT--QSANGFQSFDGL--  156

Query  330  LEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEHENAV--EVKMESTWTTETSC  387
                T D+YSFYQ+ NG YV+LHPLN+KCL KE+ ++ + + +V  E ++ + W   +S 
Sbjct  157  ---ATGDLYSFYQLQNGCYVVLHPLNVKCLTKEFAEKKDRKPSVDSEDQITAAWAGASSP  213

Query  388  ANS----RSPP-ANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLSHLPRFCDFYICEL  442
              S    R PP A  Y L+P  + GRVLD+EH +MD++ QKR+RFL HLP+FCDFY+CEL
Sbjct  214  PVSGRFDRQPPSAVNYELLPNTIQGRVLDVEHLVMDDDVQKRYRFLGHLPKFCDFYVCEL  273

Query  443  DLSSQLSRSTLSAFKNDLKKRAKQREHK-----------LKLLNTPTFSSPMYKSKVQTF  491
            DLS  LS  T+ AFK + KKR K R  K           L      T SSP+++ ++  F
Sbjct  274  DLSDILSPETIQAFKGEFKKREKVRRAKREAEKKSKKNGLSGAEATTRSSPVFR-QMPAF  332

Query  492  SLQHENTHWPSPYEQTLAESVEDFHLSSSFAsdl----------------ltedetttsf  535
            SL     HWP+P E +L +S +     +  + D                      T    
Sbjct  333  SLDEGAAHWPAPAELSLNDSFDGAMQVNDTSGDEELAAALAASSMMSPPFGASTSTYAVE  392

Query  536  eddeRSFARITENSGYFPALGDAPSNESRHPSENSTASGSSHP--WGNTISSNVAgrgsk  593
            +    SFA IT NSGYFP LG + ++ S  P+ +S   G+S P   G      VAG   K
Sbjct  393  DGVYGSFATITRNSGYFPPLGGSTNDTSSAPATSSPMWGASSPPLLGARGPGIVAGGSKK  452

Query  594  kkggkkgISVFSTTQRRSYR  613
            K   KKG  +FST QRRSYR
Sbjct  453  KGAMKKGTQLFSTAQRRSYR  472

>HYAP_08501
Length=352

 Score = 315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 242/356 (68%), Gaps = 16/356 (4%)

Query  270  MRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCSRGTYGKPVTTFASDQSIKP  329
            MR LQSMDAEF+SSGD++NLPFV EA++ TSERL+ S D  +    + +T       ++ 
Sbjct  1    MRDLQSMDAEFRSSGDIENLPFVEEALQCTSERLAKSADARKNETHRSITIPRVKGELE-  59

Query  330  LEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEHE-------NAVEVKMESTWT  382
             E G+ D YSFYQIANGTYVILHPLN+KCLLKE++D+ + +       +A +  +E+ W 
Sbjct  60   -EGGSGDAYSFYQIANGTYVILHPLNVKCLLKEFSDQKQPQQQGESINDAHKTDLEAVWI  118

Query  383  TETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLSHLPRFCDFYICEL  442
             E + + +  P  NRYHL+PE++ GRVLDIEH +M++EA KR+RFLSHLPRFCDFYICEL
Sbjct  119  QEVASSETIRP--NRYHLLPERISGRVLDIEHMVMNDEALKRYRFLSHLPRFCDFYICEL  176

Query  443  DLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSSPMYKSKVQTFSLQHENTHWPS  502
            DL+SQLS  TL+AF+N+LKKR+KQR+ KLKL +  T  SP+ K     FSL+ E T WPS
Sbjct  177  DLTSQLSPPTLNAFQNELKKRSKQRKQKLKLHSATTPLSPIAKRDASAFSLEQEGTMWPS  236

Query  503  PYEQTLAESVEDFHLSS-SFAsdlltedetttsfeddeRSFARITENSGYFPALGDAPSN  561
            PYEQ L ES+ED  L   S  +         +  E++++SF R+TENSG FPALG A ++
Sbjct  237  PYEQALIESMEDIALDEFSLDTAEQESQSYASVVEEEQQSFERVTENSGLFPALGGASTS  296

Query  562  ESRHPSENSTASGSSHPWGNTISSNVAgr----gskkkggkkgISVFSTTQRRSYR  613
            ++R    NS   GS   WG+  SS  A        KK  GKKG+S+FSTTQRRSYR
Sbjct  297  DARPFGSNSIVFGSPSAWGSASSSPPAVAWTPGKKKKGAGKKGVSLFSTTQRRSYR  352

>SPRG_06313
Length=515

 Score = 314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/513 (38%), Positives = 274/513 (53%), Gaps = 84/513 (16%)

Query  17   RGPRREQNKNM----NHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIE  72
            +G RR   K +      + R  + GVSANHLLNFSLPERE       +KKK+  PRT+ E
Sbjct  20   KGQRRRGAKPVPEPRGGDRRKRQGGVSANHLLNFSLPEREE-KAVAMRKKKAPPPRTRDE  78

Query  73   YLHANYRFVIAPLDPECIVPT-WDVESLTEWSLVEQVLLWYDAANP-QTCPICMDSFRVP  130
            +LHANYRFVIAPL  E      +D E+LT W  VEQV++  + +   + CPIC+D+ R P
Sbjct  79   FLHANYRFVIAPLASEKAANVLFDPEALTAWDNVEQVIVTNEQSEADRRCPICLDTLRAP  138

Query  131  KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTF  190
            KIT+CGH FCW CIL YLS+++ YW RCPMCF+SV+K  LRSV + + +  P V    TF
Sbjct  139  KITRCGHTFCWSCILMYLSLSENYWWRCPMCFDSVKKTDLRSVLVDRERSMPSVNRAATF  198

Query  191  QFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVNDADAT  250
              L R K   FP    LP+T                              +P+V+  D  
Sbjct  199  ALLHRSKGSWFPH---LPTT-------------------------GSRSGVPSVHSDDGR  230

Query  251  YSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCS  310
            +SRILEA+  YLRE++  E+  LQ +  E +SSG+ + LP + E +    ++L      S
Sbjct  231  FSRILEASASYLREMVEGELLDLQRLHVEAESSGERNMLPVIQEGITFCEKQLEKQGSAS  290

Query  311  RGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEHE  370
                  P+ T   D S         ++Y+FYQ+ANG  V LHP+ M+CL KE+ D L   
Sbjct  291  ASV---PIKTSDDDAS---------ELYTFYQLANGHTVFLHPITMRCLAKEFGDAL---  335

Query  371  NAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLSH  430
                                           P  + G+VL++EH +M+++A+KRFRFLSH
Sbjct  336  -------------------------------PSSLGGKVLELEHVVMNDDARKRFRFLSH  364

Query  431  LPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKL-LNTPTFSSPMYKSKVQ  489
            LP  CDFY+ E++L   +S  TL  F++DLKKRA+ R+ K +  ++          +++ 
Sbjct  365  LPGLCDFYLAEIELKDTVSPETLLHFQSDLKKRARARQAKKRAEVHEERKRLDAVDARLV  424

Query  490  TFSLQHENTHWPSPYEQTLAESVEDFHLSSSFA  522
              +L++E   WP+P   TL  S   FH +S FA
Sbjct  425  NLTLENEML-WPAPQPTTLVSSSSSFH-ASDFA  455

>H310_01471
Length=560

 Score = 314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 209/604 (35%), Positives = 305/604 (50%), Gaps = 76/604 (13%)

Query  22   EQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIEYLHANYRFV  81
            + NK      R    G  ANHLLNFSLP R +      +KKK   PRT+ E+LHANYRFV
Sbjct  21   KGNKRHGGSDRRKSKGSVANHLLNFSLPVRNNDPPSFVRKKKGPPPRTRDEFLHANYRFV  80

Query  82   IAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAAN-PQTCPICMDSFRVPKITKCGHIFC  140
            I+PL        +D+++LTEW  +EQV++  DA N  Q CPIC+D+ R PKIT+CGH +C
Sbjct  81   ISPLSANESPTLYDLDALTEWDKIEQVIVANDATNIDQRCPICLDTLRAPKITRCGHAYC  140

Query  141  WPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRI  200
            W CIL YLSMT+ YWRRCPMCF+SV+K  LRSV + + +  P +GS  TF  + R +S  
Sbjct  141  WHCILTYLSMTENYWRRCPMCFDSVKKHDLRSVLIDRHRTIPLIGSSATFHLIHRSRSSW  200

Query  201  FPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVNDADATYSRILEATPE  260
            FP L     + L                           K+P+V+ ++A YSRILE+TP 
Sbjct  201  FPHLPAAMGSSLV------------------------KGKIPSVHCSNAAYSRILESTPS  236

Query  261  YLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERL----SISDDCSRGTYGK  316
            YL+ ++  EM  L ++ AE QSSGD   LP V EA+    +RL    + +     G    
Sbjct  237  YLQAMIEFEMHDLHTLAAEAQSSGDDHALPVVQEALAYCEKRLAKLFATTSSEGDGVAAD  296

Query  317  PVTTFASDQSIKPLEHGTNDM--YSFYQIANGTYVILHPLNMKCLLKEYTDELEHENAVE  374
                 +   + K     ++D   Y+FYQ+ NG   ILHPL M+ L +E+     H+N+  
Sbjct  297  ASGIVSRSAATKAAIDASDDEPPYTFYQLHNGHTAILHPLCMRALTREFG----HDNS--  350

Query  375  VKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLSHLPRF  434
                                       P  +   VL+IEH +M+++ +KRFR+++HLP  
Sbjct  351  --------------------------FPYDITATVLEIEHVVMNDDVRKRFRYMAHLPSH  384

Query  435  CDFYICELDLSSQLSRSTLSAFKNDLKKRAKQRE---HKLKLLNTPTFSSPMYKSKVQTF  491
            CD ++ E+DL+  +S  T+S F+ + KKRA+ R+      KL    T S     S +   
Sbjct  385  CDLFLVEVDLAGIVSPDTMSHFQTEFKKRARARQLAKRHQKLDKKKTRSDSFEVSLMLQL  444

Query  492  SLQHENTHWPSPYEQTLAESVEDFHLSSSFAsdlltedetttsfeddeRSFARITENSGY  551
            +L ++ TH+P      +    +       F +   +   +  +      +FA +T N GY
Sbjct  445  ALDND-THYPQLQNVAVGAPPDKDGELERFDTPDESPYNSPYA------TFASVTTNQGY  497

Query  552  FPA--LGDAPSNESRHPSENSTASGSSHPWGNTISSNVAgrgskkkggkkgISVFSTTQR  609
            +PA  +G         P   +  S  + P+ N          + KK   KG+S+F+T+QR
Sbjct  498  YPAFNVGGRDGTSMSTPGWPNVGSAMAVPF-NLDELQKELGPNGKKAKGKGVSLFATSQR  556

Query  610  RSYR  613
            RSYR
Sbjct  557  RSYR  560

>SDRG_01805
Length=519

 Score = 301 bits (770),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 190/513 (37%), Positives = 275/513 (54%), Gaps = 84/513 (16%)

Query  17   RGPRREQNKNM----NHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaPRTQIE  72
            +G RR   K +      + R  + GVSANHLLNFSLPERE       +KKK+  PRT+ E
Sbjct  23   KGQRRRGAKPVPEPRGGDRRKRQGGVSANHLLNFSLPEREE-KAVAMRKKKAPPPRTRDE  81

Query  73   YLHANYRFVIAPLDPECIVPT-WDVESLTEWSLVEQVLLWYDAANP-QTCPICMDSFRVP  130
            +LHANYRFV+APL  E      +D E+L  W  VEQV++  + A   + CPIC+D+ R P
Sbjct  82   FLHANYRFVVAPLASEKAANVLFDPEALAAWDNVEQVIVNNEQAEADRRCPICLDTLRAP  141

Query  131  KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTF  190
            KIT+CGH FCW CIL YLS+++ YWRRCPMCF+SV+K  LRSV + + +  P V    TF
Sbjct  142  KITRCGHTFCWSCILMYLSLSENYWRRCPMCFDSVKKTDLRSVLVDRERSMPSVNRAATF  201

Query  191  QFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVNDADAT  250
              L R K   FP    LP+T                              +P+V+  D  
Sbjct  202  ALLHRSKGSWFPH---LPTT-------------------------ASRSGVPSVHSDDGR  233

Query  251  YSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSISDDCS  310
            +SRILEA+  YLRE++  E+  LQ +  E +SSG+ + LP + E +    ++L       
Sbjct  234  FSRILEASASYLREMVEGELLDLQRLYVEAESSGERNMLPVIQEGITFCEKQLE------  287

Query  311  RGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLLKEYTDELEHE  370
                 K  +   +  SI   +   +++Y+FYQ+A+G  V LHP+ M+CL KE+ D L   
Sbjct  288  -----KQASASIASASITTSDDDASELYTFYQLASGHTVFLHPITMRCLTKEFGDAL---  339

Query  371  NAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEAQKRFRFLSH  430
                                           P  + G+VL++EH +M+++A+KRFRFLSH
Sbjct  340  -------------------------------PSSLSGKVLELEHVVMNDDARKRFRFLSH  368

Query  431  LPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKL-LNTPTFSSPMYKSKVQ  489
            LP   DFY+ E++L   +S  TL  F++DLKKRA+ R+ K +  ++          +++ 
Sbjct  369  LPGLGDFYLAEIELKDTVSPETLLHFQSDLKKRARARQAKKRAEVHEERKRLDAVDARLV  428

Query  490  TFSLQHENTHWPSPYEQTLAESVEDFHLSSSFA  522
              +L++E   WP+P + T+  S   FH +S FA
Sbjct  429  NLTLENEML-WPAP-QPTMLLSSASFH-ASDFA  458

>H257_00314
Length=563

 Score = 291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 207/623 (33%), Positives = 306/623 (49%), Gaps = 99/623 (16%)

Query  8    NISNGGPDRRGPRREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaP  67
            N  NGG DRR  +                G  ANHLLNFS P R +      +KKK   P
Sbjct  23   NKRNGGFDRRKGK----------------GSVANHLLNFSRPVRNNDTTSFVRKKKGPPP  66

Query  68   RTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAA--NPQTCPICMD  125
            RT+ E+LHAN+RFVI+PL        +D ++LTEW  +EQV++ +DA       CPIC+D
Sbjct  67   RTRDEFLHANFRFVISPLAANESRALYDPDALTEWDKIEQVIVAHDATVDADHRCPICLD  126

Query  126  SFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQIPPRVG  185
            + R PKIT+CGH +CW CIL YLS+T+ YWRRCPMCF++V+K  LRSV + + +  P VG
Sbjct  127  TLRAPKITRCGHAYCWHCILTYLSLTENYWRRCPMCFDAVKKHDLRSVLIDRHRTIPSVG  186

Query  186  SDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtrkLPNVN  245
            S  TF+++ R +   FP    LP+ Q       SS   H   +            +P+V+
Sbjct  187  SSATFRYVHRGRGSWFPH---LPAPQ----AAPSSTKNHHPQQ---------KGGIPSVH  230

Query  246  DADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTSERLSI  305
             A+A +SRILE+TP YL  ++ +E   L ++ AE +SSGD   LP + EA+    +RL+ 
Sbjct  231  GANAVFSRILESTPSYLESMIQSETEDLDALAAEAKSSGDDHALPVIQEALAYCEKRLAK  290

Query  306  SDDCSRGTYGKPVTTFASDQSIKPLEHGTNDM----YSFYQIANGTYVILHPLNMKCLLK  361
                S     +PV T  +  + K      ++     YSFYQ+ NG   ILHPL ++ L +
Sbjct  291  LRGPSTAP-DEPVPTTTAKATKKTSSPSEHEEEEAPYSFYQLDNGHAAILHPLCLRALTR  349

Query  362  EYTDELEHENAVEVKMESTWTTETSCANSRSPPANRYHLVPEQVHGRVLDIEHFIMDEEA  421
            E+                                   H  P  +   VL+IEH ++ ++ 
Sbjct  350  EF--------------------------------GSTHSFPHTITATVLEIEHMVVTDDV  377

Query  422  QKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSS  481
            ++RFR+++HLP  CD ++ E+DLS  +S +T S F +D+KKRA+ R+ K +  +      
Sbjct  378  RRRFRYMAHLPSHCDLFLVEVDLSPVVSPATYSHFYSDIKKRARGRQAK-RHPHHDKKPQ  436

Query  482  PMYKSKVQTFSLQ---HENTHWPSPYEQTLAESVEDFHLSSSFAsdlltedetttsfedd  538
            P   S      LQ     + H+P   +   ++      L    A+   +           
Sbjct  437  PRSDSFDMCLMLQLALDNDDHYPHLQDTAASDDKTSRRLDDEGATGDYSSPYA-------  489

Query  539  eRSFARITENSGYFPALGDAPSNESRHPSENSTASGSSHPWGNTISSN--------VAgr  590
              SFA +T N GY+P+     ++        + A G    W N   S         +   
Sbjct  490  --SFANVTTNQGYYPSFN---ADGDDRRPAAAAAPG----WPNVNGSTDVPFDIDELKKE  540

Query  591  gskkkggkkgISVFSTTQRRSYR  613
              + K  KKG+S+F+T+QRRSYR
Sbjct  541  SQQGKKAKKGVSLFATSQRRSYR  563

>CCI46717
Length=382

 Score = 198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 139/395 (35%), Positives = 211/395 (53%), Gaps = 39/395 (10%)

Query  241  LPNVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTS  300
            +P+V D ++ +SR+++A  EY  ++L+ +++ L+S+  E +S G+V+ LPF+ EA+  T+
Sbjct  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64

Query  301  ERLSISDDCSRGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLL  360
             RL   +    G   +P       + I   E   + +YS+YQ+ NGTYV+LHP+NMKCLL
Sbjct  65   SRLDSVEVIQDG--NEPTQM----EDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLL  118

Query  361  KEYTDELEHENAV-------EVK-----MESTWTTETSCANSRSPPANRYHLVPEQVHGR  408
            KE   + E +N +       +VK      E   T+  S A S    + ++  +P+ V G 
Sbjct  119  KEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGS----STQHDALPDVVQGE  174

Query  409  VLDIEHFIMDEEAQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQRE  468
            VL +EH +MD+E+Q+R+RFLSHLP++CDFY+CELDLS  LS+ TL + K +L  R +QRE
Sbjct  175  VLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQRE  234

Query  469  HKLKLLNTPTFSSPMYKSKVQTFSLQHENTHWPSPYEQTLAESVEDFHLSSSFAsdllte  528
             K KLL+       +  +   T +  ++     SP     AE +++ +L   F    L  
Sbjct  235  AKKKLLDEQLDGDELIHALPYTSTFTNDLIPSNSP---RAAEELKESNLVDEFDELRLQN  291

Query  529  detttsfeddeRSFARITENSGYFPAL-GDAPSNESRHPSENSTASGSSHPWGNTISS--  585
                   +D   S+A IT NSGYFPAL G  P   +  P+          PWG    +  
Sbjct  292  TRIAQISDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIV----PWGRNREATH  347

Query  586  -------NVAgrgskkkggkkgISVFSTTQRRSYR  613
                   + +G    K   K    VFST+QRRSYR
Sbjct  348  EVYGHIPSESGHKKMKGKKKNCKEVFSTSQRRSYR  382

>PYAP_22845
Length=135

 Score = 169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 101/133 (76%), Gaps = 1/133 (1%)

Query  9    ISNGGPDRRGPRREQNKNMNHEARVTRNGVSANHLLNFSLPEREHLakyhhkkkkssaP-  67
            + N G  R G ++E++       R+TRNG+SANHLLNFSLPERE    +HH KKK +AP 
Sbjct  1    MRNNGSRRGGSKKERDYIEYEGGRMTRNGLSANHLLNFSLPEREKQQAHHHGKKKKNAPT  60

Query  68   RTQIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSF  127
            RTQ+EYLHANYRFVIAPL  +  V  WDVE+LTEW  VEQVLLWYD  +P TCPIC+DSF
Sbjct  61   RTQMEYLHANYRFVIAPLTDDTAVSCWDVETLTEWKSVEQVLLWYDELSPATCPICLDSF  120

Query  128  RVPKITKCGHIFC  140
            R PKIT+CGHIFC
Sbjct  121  RAPKITRCGHIFC  133

>PHYKE_5842
Length=550

 Score = 124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)

Query  241  LPNVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTS  300
            LP+VNDADATYSRILE+TPEYL+ELL +EMR LQSMDAEF+SSGDVDNLPFV EAMRNTS
Sbjct  81   LPSVNDADATYSRILESTPEYLKELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTS  140

Query  301  ERLSISDDCSRGTYG  315
             RL+ S D ++GT+G
Sbjct  141  GRLAKSGDFAQGTHG  155

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 90/146 (62%), Gaps = 11/146 (8%)

Query  441  ELDLSSQLSRSTLSAFKNDLKKRAKQREHKLKLLNTPTFSSPMYKSKVQTFSLQHENTHW  500
            E DL+SQLS STL+ F N+LKKR K R+HKLKL NT   SSP+YKS    FSL+ E   W
Sbjct  177  ENDLTSQLSPSTLNCFHNELKKRVKHRKHKLKLQNTAAPSSPIYKSSAAAFSLEEEGASW  236

Query  501  PSPYEQTLAESVEDFHLSSSFAsdlltedetttsfeddeRSFARITENSGYFPALGDAPS  560
            P+  E+ LAES+ DF L+ +   D       +    D E SFAR+TENSGYFPALG + +
Sbjct  237  PA-LEEALAESLADFTLAGT-KLDDERHAAPSLHSTDQEGSFARVTENSGYFPALG-SEA  293

Query  561  NESRHPSENSTAS-----GSSHPWGN  581
             ESR    + TAS     GS   WG+
Sbjct  294  GESR---AHGTASGPFGFGSPSAWGS  316

 Score = 35.8 bits (81),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)

Query  105  VEQVLLWYDAANPQTCPI  122
            VEQVLLWYD  + QTCPI
Sbjct  27   VEQVLLWYDDESQQTCPI  44

>H257_08759
Length=107

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 30/49 (61%), Gaps = 0/49 (0%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            TCP+C+D    P  T+CGHIFC  C+ R+ +       RCP+C + +Q+
Sbjct  48   TCPVCLDPILHPIATRCGHIFCRDCLDRWWTEGRMVSTRCPVCNKRLQR  96

>SPRG_01982
Length=175

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 6/94 (6%)

Query  114  AANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            AA    C IC+D  + P +T CGH++CWPC+ ++++  ++    CP+C   V K ++  V
Sbjct  4    AATDFDCNICLDRVKEPVVTLCGHLYCWPCLFQWIANHNE----CPVCKAGVTKENVIPV  59

Query  174  QLQQLQ-IPPRVGSDVTFQFLERPK-SRIFPQLR  205
              +    I PR           RP+  R  P LR
Sbjct  60   YGRGANSIDPRTIDGADDSIPNRPRGQRPAPSLR  93

>SDRG_08354
Length=174

 Score = 52.4 bits (124),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query  114  AANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            AA    C IC+D  + P +T CGH++CWPC+ ++++  ++    CP+C   V K
Sbjct  4    AATDFDCNICLDRVKEPVVTLCGHLYCWPCLFQWIANHNE----CPVCKAGVTK  53

>H257_06038
Length=684

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 9/66 (14%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR---SVQLQ  176
            CPIC++S  VP    C H FC PCI     M   Y  +CP+C  S +K HLR   SVQ  
Sbjct  24   CPICLESVTVPYSLPCNHCFCEPCI----GMALTYAPKCPVCKASAKKRHLRLDESVQRI  79

Query  177  Q--LQI  180
            Q  LQ+
Sbjct  80   QNALQV  85

>H310_13091
Length=662

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR-SVQLQQL  178
            CPIC++S  VP    C HIFC PCI   L+    Y  +CP+C    +K HLR    +Q++
Sbjct  26   CPICLESVTVPYSLPCNHIFCEPCIGVALT----YAPKCPVCKAPAKKRHLRLDESIQRI  81

Query  179  Q  179
            Q
Sbjct  82   Q  82

>H257_00605
Length=186

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 35/61 (57%), Gaps = 4/61 (7%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            D ++   C IC+D  + P +T CGH++CWPC+ R++    +    CP+C   V + ++  
Sbjct  18   DGSHAFDCNICLDHVKEPVVTLCGHLYCWPCLYRWICSNSQ----CPVCKAGVTQDNVIP  73

Query  173  V  173
            V
Sbjct  74   V  74

>H310_06346
Length=139

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/42 (43%), Positives = 27/42 (64%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C+D+ +VP  T CGHI+C  CI+  L +     ++CPMC
Sbjct  87   CAVCLDAVQVPTATTCGHIYCRTCIVESLHVR----KKCPMC  124

>SPRG_07002
Length=170

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (57%), Gaps = 4/51 (8%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            CPIC+D F     T CGH+FC PCI   +++  K    CP+C  S  + HL
Sbjct  121  CPICLDEFNELASTSCGHLFCAPCISNAVAVNGK----CPLCQASPVQIHL  167

>H257_06804
Length=933

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 60/134 (45%), Gaps = 17/134 (13%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQ  179
            C ICMD  +   IT C H +C PC+L  L         CP+C + VQ  HL    +  + 
Sbjct  693  CAICMDPLQDAVITMCRHFYCRPCLLCALQAKPT----CPLCRQDVQPAHL----VADVA  744

Query  180  IPPRVGSDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSSEaatfaarkrtr  239
             PP V  D        P S++   L++L   +LT    +S  F+  +S  A      +  
Sbjct  745  APPLVEMDQVL-----PSSKMEALLKLL---RLTPPGVKSVVFSQWTSMLALTKKVLQAN  796

Query  240  kLPNVNDADATYSR  253
             +P+++  D + SR
Sbjct  797  DIPSIS-YDGSMSR  809

>SDRG_08762
Length=109

 Score = 47.4 bits (111),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 29/51 (57%), Gaps = 3/51 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            CP+C+D+   P  TKCGH+FC  C+++ L        +CP+C   V +  L
Sbjct  57   CPVCLDAVCKPVATKCGHVFCDECLMQALQRAK---HKCPVCRRRVTRNQL  104

>PYU1_G009434
Length=163

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 32/59 (54%), Gaps = 10/59 (17%)

Query  113  DAANPQT------CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            DAA   T      C IC+D+   P +T CGH++CWPC+ +++    +    CP+C   +
Sbjct  12   DAAGGATGNPTFDCNICLDTVSSPVVTLCGHLYCWPCLFQWMEARSE----CPVCKAGI  66

>H310_01205
Length=186

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C IC+D  + P +T CGH++CW C+ R++S  ++    CP+C   V + ++  V
Sbjct  40   CNICLDHVKEPVVTLCGHLYCWSCLYRWISRNNQ----CPVCKAGVTQENVIPV  89

>H257_13532
Length=136

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D+ +VP  T CGHI+C  CI+  L +     ++CPMC
Sbjct  84   CAICLDAVQVPTATTCGHIYCRACIVESLHL----RKKCPMC  121

>PHALS_09908
Length=499

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 28/46 (61%), Gaps = 4/46 (9%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC+D+   P +T CGH++CWPC+ +++    +    CP+C   V
Sbjct  332  CNICLDTVSSPVVTLCGHLYCWPCLYQWM----QSHSECPVCKAGV  373

>PYIR_13250
Length=214

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query  114  AANPQ-TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            AA P   C IC+D+   P +T CGH++CWPC+ +++    +    CP+C   +
Sbjct  43   AAKPSFDCNICLDTVSSPVVTLCGHLYCWPCLYQWMESRSE----CPVCKAGI  91

>PPTG_09629
Length=191

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C IC+D+   P +T CGH++CWPC+ +++    +    CP+C   V + ++  V
Sbjct  24   CNICLDTVSSPVVTLCGHLYCWPCLYQWMQNHSE----CPVCKAGVSEQNVIPV  73

>PHYRA_93417
Length=332

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 28/46 (61%), Gaps = 4/46 (9%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C +C+D+   P +T CGH++CWPC+ +++    +    CP+C   +
Sbjct  25   CNVCLDTVSSPVVTLCGHLYCWPCLYQWMQNHSE----CPVCKAGI  66

>PYIW_19474
Length=224

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 28/46 (61%), Gaps = 4/46 (9%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC+D+   P +T CGH++CWPC+ +++    +    CP+C   V
Sbjct  56   CNICLDTVSSPVVTLCGHLYCWPCLYQWMESRSE----CPVCKAGV  97

>H310_05789
Length=223

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query  100  TEWSLVEQVLL-WYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRC  158
            T+  L  QV L  Y  A   TC IC+D+ R    T CGHIFC  CI + +  + K    C
Sbjct  153  TQVCLDNQVALEMYRKAT--TCAICLDTLRDLTSTSCGHIFCRECITQAVFASQK----C  206

Query  159  PMC  161
            PMC
Sbjct  207  PMC  209

>H310_10009
Length=972

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 33/68 (49%), Gaps = 6/68 (9%)

Query  103  SLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCF  162
            SLVE  +L     + + C ICMD  +   IT C H FC PCI   L +       CPMC 
Sbjct  713  SLVE--ILQEAINSGEECAICMDPLKDAVITMCRHFFCRPCISCALQVKPS----CPMCR  766

Query  163  ESVQKGHL  170
            + VQ   L
Sbjct  767  QDVQASQL  774

>PYIR_14154
Length=617

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 0/40 (0%)

Query  109  LLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYL  148
            +L    A+P TCP+C  +   P ++  G++FC+PCI RY+
Sbjct  310  VLTLSTADPSTCPVCRQTRVNPAMSVSGYVFCYPCIYRYV  349

>PYAR_20520
Length=374

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query  115  ANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
              P+ C +C+     P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  315  GRPKKCALCLGERTSPATTPCGHVFCWECIVGW---CQKNKPECPICRQEAHPQQIKCV  370

>PYAR_13176
Length=621

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR-SVQLQQL  178
            CPIC+ ++  P    C H FC  CI R L +     + CP+C    +K  LR    +QQL
Sbjct  54   CPICLCAYTAPASLPCNHCFCEECIHRALELK----QVCPICKAPAKKRSLRHDTMIQQL  109

Query  179  Q  179
            Q
Sbjct  110  Q  110

>PYIW_23387
Length=591

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query  110  LWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCP  159
            L    A+P TCP+C  +   P ++  G++FC+PCI RY+   D   +R P
Sbjct  302  LMLSTADPSTCPVCRQTRVNPAMSVSGYVFCYPCIYRYVEEHDD-MKRAP  350

>SDRG_09580
Length=161

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 28/51 (55%), Gaps = 4/51 (8%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            C IC+D F     T CGH+FC PC+   +++  K    CP+C  +  + HL
Sbjct  112  CSICLDEFTELASTSCGHLFCAPCVSNAVAVNGK----CPLCQATPVQIHL  158

>CCA26132
Length=266

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 42/88 (48%), Gaps = 13/88 (15%)

Query  113  DAANPQTCPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRR-----CPMC---FE  163
            D  + + CPIC+       +T+ CGHIFC  CI  ++    K  R+     CPMC   F 
Sbjct  39   DILDNELCPICLQKLDAAVMTQNCGHIFCCDCICLWVDHVTKKSRKRGLPECPMCKREFR  98

Query  164  SVQKGHLRSVQLQQLQIPPRVGSDVTFQ  191
            ++       + L +L++      D+TF+
Sbjct  99   TLYANITSDIHLVKLEL----DGDLTFK  122

>H310_08802
Length=190

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC D+   P  T+CGH +C PC++++   T +    CP C
Sbjct  6    CPICYDACYDPVRTRCGHAYCRPCLVQW---TAEGHTSCPTC  44

>PYU1_G008514
Length=531

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 26/66 (39%), Gaps = 0/66 (0%)

Query  96   VESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYW  155
             E + EW          D  N   C IC D F  P +  C H FC  C+ +YL     + 
Sbjct  12   AEDMHEWEWPRHCAELRDIENLLRCQICGDFFHGPVLLPCSHAFCSECVRKYLQTRGAHD  71

Query  156  RRCPMC  161
              CP C
Sbjct  72   GCCPEC  77

>PHALS_08991
Length=400

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C+   +VP  T CGH+FCW CI+ +     K    CP+C
Sbjct  346  CSLCLGERKVPSATPCGHVFCWECIVGW---CQKNKAECPLC  384

>SPRG_07296
Length=505

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 45/104 (43%), Gaps = 15/104 (14%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR---SVQLQ  176
            CPIC+++   P    C H FC  CI   LS    +   CP+C  +V+K  LR   SVQ  
Sbjct  20   CPICLEALERPFSLPCNHCFCEACINTALS----FATTCPVCKAAVRKRTLRHDGSVQ--  73

Query  177  QLQIPPRVGSDVTFQFLERPKSRIFPQLRVLPSTQLTDDCTESS  220
                  R+   +      RP     P    +P++   D C+E S
Sbjct  74   ------RIQDALQKLMAMRPVVEAPPPAATMPTSICIDLCSEES  111

>PYAR_25212
Length=307

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (56%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +++ +  ++SV
Sbjct  254  CSVCQDRHKDVIISKCSHLFCKECIDSNLRSRN---RKCPTCKKTLGQDDVKSV  304

>PPTG_09547
Length=391

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P +T CGH+FCW C++ +     K    CP+C +      ++ V
Sbjct  337  CALCLGERVSPAVTPCGHVFCWECVVGW---CQKNKAECPLCRQETHPQQIKCV  387

>PHYRA_80613
Length=488

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 41/107 (38%), Gaps = 11/107 (10%)

Query  99   LTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRC  158
            L EW          D  N   C IC D F  P +  C H FC  C+ R+L     +   C
Sbjct  8    LDEWEWPADCQAQRDMENHLRCQICGDFFHGPVLLPCSHTFCSTCVRRFLQSKGAHG-CC  66

Query  159  PMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIFPQLR  205
            P C +     +L         +P R    VT  F ++ K  +  +LR
Sbjct  67   PSCKQPCTAQNL---------VPNRALEQVTLLF-DKAKPELLKRLR  103

>SPRG_00122
Length=355

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P +T CGH+FCW CI+ +     +    CP+C + VQ   ++ +
Sbjct  302  CALCLTERSHPAMTPCGHVFCWECIVGWCQNKPE----CPLCRQLVQPQDVKCI  351

>PITG_18751
Length=330

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P +T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  276  CALCLGERVSPAVTPCGHVFCWECIVGW---CQKNKAECPLCRQEAHPQQIKCV  326

>PYU1_G009379
Length=435

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 11/63 (17%)

Query  115  ANPQTCPICMDS------FRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            + P  CP+CM++       R+  + KCGH+F   CI R+L       ++CP+C   V+K 
Sbjct  242  SQPTECPVCMEACTLSGPHRIVSL-KCGHVFGQKCIERWL----MERKKCPVCNHVVRKT  296

Query  169  HLR  171
             LR
Sbjct  297  DLR  299

>PYAP_18874
Length=75

 Score = 40.4 bits (93),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/59 (36%), Positives = 29/59 (49%), Gaps = 4/59 (7%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQ  174
            +PQ C +C +  R     KCGHI C PC   +  M    +  CPMC    Q G+L  ++
Sbjct  11   DPQ-CFVCYEISRKAYAAKCGHICCLPC---WQKMDKDGFNSCPMCKVPFQLGNLSLIR  65

>CCI45212
Length=267

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 13/88 (15%)

Query  112  YDAANPQTCPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRR-----CPMC---F  162
            +D    + CPIC+    +  +T+ CGHIFC  CI  ++    K  ++     CPMC   F
Sbjct  39   HDTLENELCPICLQKVDLAVMTQDCGHIFCCDCICLWVDHVKKKSQKRGLPECPMCKREF  98

Query  163  ESVQKGHLRSVQLQQLQIPPRVGSDVTF  190
            +++       + L +L++     +D+TF
Sbjct  99   DTLYANITSDINLVKLEL----DNDLTF  122

>PYIR_18571
Length=403

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P  T CGH+FCW CI+ +     K    CP+C + V    ++ +
Sbjct  349  CALCLGERISPAATPCGHVFCWECIVGW---CQKNKAECPLCRQEVHPQQIKCI  399

>SDRG_11517
Length=356

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P +T CGH+FCW CI+ +     +    CP+C + VQ   ++ +
Sbjct  303  CALCLTERSHPAMTPCGHVFCWECIVGWCQNKPE----CPLCRQLVQPQDVKCI  352

>PYU1_G013908
Length=402

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 19/92 (21%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            +A NP  C IC +S  +P    C H+FC  C++ +        R CP+C  SV    LR 
Sbjct  329  EAGNPD-CSICYESMHLPVKLSCSHMFCEECVMEWFDRE----RSCPLCRASVATS-LR-  381

Query  173  VQLQQLQIPPRVGSDVTFQFLERPKSRIFPQL  204
               +Q ++ P        QFL+   S +FPQL
Sbjct  382  ---EQDEVKP--------QFLDGSTS-LFPQL  401

>H310_00284
Length=994

 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 27/53 (51%), Gaps = 2/53 (4%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q CP+C+D    P +T CGH+ C  C+L +L+        CP+C   V    L
Sbjct  747  QECPVCLDVPTAPVLTPCGHLMCKECVLGFLNAGATAC--CPVCRADVTPDQL  797

>SDRG_00506
Length=738

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D+ +   I+KC H+FC  C+   L   +   R+CP C +   +  L+SV
Sbjct  685  CSVCQDALKDVIISKCSHMFCKDCMDANLKARN---RKCPTCKKMFGQDDLKSV  735

>PYVX_18659
Length=452

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (56%), Gaps = 4/43 (9%)

Query  120  CPICMDS-FRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+ +  ++P    CGH FCW C+ +     +  +  CPMC
Sbjct  187  CPICLGAQIKLPITLSCGHTFCWSCLSK---AAEHRFHSCPMC  226

>H257_08183
Length=193

 Score = 42.4 bits (98),  Expect = 0.003, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 33/74 (45%), Gaps = 8/74 (11%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQ  179
            CPIC D    P  T+CGH +C PC+ ++   T +    CP C     +G +   +     
Sbjct  6    CPICYDPCYDPVQTRCGHKYCRPCLSQW---TAEGHTSCPTC-----RGFITPPKTDPEL  57

Query  180  IPPRVGSDVTFQFL  193
              P +G  V   FL
Sbjct  58   ASPSLGRYVAIHFL  71

>PHYKE_7333
Length=376

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  322  CALCLGERVSPAATPCGHVFCWECIVGW---CQKNKAECPLCRQETHPQQIKCV  372

>SPRG_07200
Length=714

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D+ +   I+KC H+FC  C+   L   +   R+CP C +   +  L+SV
Sbjct  661  CSVCQDALKDVIISKCSHMFCKDCMDANLKARN---RKCPTCKKMFGQDDLKSV  711

>PYIW_15296
Length=675

 Score = 43.9 bits (102),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR-SVQLQQL  178
            C IC+ ++  P    C H FC  CI R L +  +    CPMC    +K  LR    +QQL
Sbjct  28   CAICLSTYANPASLPCNHCFCEECIHRALELKAE----CPMCKAPAKKRKLRYDSMIQQL  83

>PHYCA_104912
Length=347

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            + C +C+     P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  291  RKCALCLGERVSPAATPCGHVFCWECIVGW---CQKNKTECPLCRQETHPQQIKCV  343

>PYIR_15276
Length=153

 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query  120  CPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            CPIC+D+   P +T  CG  FC  C+   L+ TD     CPMC E + KG
Sbjct  32   CPICLDTLERPVLTTCCGQSFCDACLNAALAKTDA----CPMCREPLLKG  77

>PYAR_20706
Length=530

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 39/95 (41%), Gaps = 19/95 (20%)

Query  85   LDPECIVPTWDVESLTEWSLVEQVLLWYDAANPQ--------TCPICMDSFRVPKITKCG  136
            +DP         E++ EW       LW  AA P+         C IC D F  P +  C 
Sbjct  1    MDPPVTATAMLDEAMDEW-------LWP-AACPELRQMESALRCQICGDFFHGPVLLPCT  52

Query  137  HIFCWPCILRYL-SMTDKYWRRCPMCFESVQKGHL  170
            H FC  C+ R+L S  +  W  CP C +    G L
Sbjct  53   HTFCSECVRRFLQSRANHGW--CPECKQPCTPGEL  85

>H310_06527
Length=243

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (53%), Gaps = 1/51 (2%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGH  169
            TCPIC+   R+   T CGH FC PC+  Y + + +    CP C + +   H
Sbjct  59   TCPICLTDVRLACETNCGHGFCTPCLTSYFA-SRRLDYPCPYCRQYIHLVH  108

>SDRG_07732
Length=159

 Score = 41.2 bits (95),  Expect = 0.004, Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+D ++    T CGH+FC  CI   ++   K    CP+C
Sbjct  108  CPLCLDPYQEMASTTCGHVFCKECITLVVAKIHK----CPLC  145

>PHALS_12995
Length=768

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 31/75 (41%), Gaps = 20/75 (27%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQ  179
            C +C + F+ P+   C H FC PCIL++L     +   CP C                 Q
Sbjct  21   CTLCNNIFQEPQCLDCKHNFCLPCILQHLKQNKSH---CPTC-----------------Q  60

Query  180  IPPRVGSDVTFQFLE  194
            +P R       QFLE
Sbjct  61   LPTRPSEVTRNQFLE  75

>PHYSO_558391
Length=463

 Score = 43.1 bits (100),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICMDS-FRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+ S  + P    C H FCW C+ R        +R CP+C
Sbjct  202  TCPICLCSEVQAPITLSCAHTFCWSCLSR---AAQHRFRSCPLC  242

>PHYSO_288411
Length=187

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  133  CALCLGERVSPAATPCGHVFCWECIVGW---CQKNKAECPLCRQETHPQQIKCV  183

>PYVX_17322
Length=385

 Score = 42.7 bits (99),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (7%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            + C +C+     P  T CGH+FCW CI+ +          CP+C
Sbjct  329  RKCALCLGERVAPAATPCGHVFCWECIVGWCQKNKA---ECPLC  369

>PYVX_18030
Length=665

 Score = 43.1 bits (100),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQ-LQQ  177
            TCPIC+ ++  P    C H FC  CI R L +       CP+C    +K  LR  Q L+Q
Sbjct  36   TCPICLCAYDNPTSLPCNHCFCEECIHRALEVKPV----CPICKAPAKKRRLRYDQMLRQ  91

Query  178  L  178
            L
Sbjct  92   L  92

>SDRG_10388
Length=629

 Score = 43.1 bits (100),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+  F  P    C H FCW C+ +     + +   CP+C
Sbjct  170  CPICLYHFTSPVTLSCSHTFCWSCLAK---AAEHHIHACPLC  208

>PYU1_G004976
Length=172

 Score = 41.2 bits (95),  Expect = 0.005, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 28/56 (50%), Gaps = 6/56 (11%)

Query  120  CPICMDSFRVPKI--TKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            CPIC+D+   P +  T CG  FC  C+   L   D     CPMC E + +G   +V
Sbjct  9    CPICLDTLAAPVVLSTCCGQSFCRVCLDAALVKVDA----CPMCREPLLRGGKHAV  60

>HYAP_04143
Length=470

 Score = 42.7 bits (99),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 4/47 (9%)

Query  114  AANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            A +P  CP+C      P +T  G++FC+PCI RY+    K    CP+
Sbjct  309  AMDPAFCPLCKQKRVNPAMTDSGYVFCYPCIYRYVERHGK----CPI  351

>PPTG_04005
Length=643

 Score = 43.1 bits (100),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query  114  AANPQT--CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            A  PQ+  CPIC+ + + P    CGH+ CW C+ + LS     +  CP+C
Sbjct  84   APVPQSIACPICLRATQFPVRQDCGHVLCWSCMQQSLSS----FGVCPLC  129

>H310_05127
Length=206

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 25/42 (60%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+D+      TKCGH++C  CI   ++    +  +CP+C
Sbjct  155  CPLCLDTMVTITSTKCGHVYCRSCIAEAIN----HIHKCPLC  192

>H257_13672
Length=293

 Score = 42.4 bits (98),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 38/73 (52%), Gaps = 9/73 (12%)

Query  94   WDVE-SLTEWSLVEQVLLWYDAANPQT--CPICMDSFR--VPKITKCGHIFCWPCILRYL  148
            WD + + +   L +Q +    AA  Q   CPIC+D+F   V +  +C H+FC PC+   L
Sbjct  50   WDAKPAESTLELRKQAVRDAVAAAQQAFRCPICLDTFGELVVECAECAHVFCDPCMRESL  109

Query  149  SMTDKYWRRCPMC  161
               DK    CP+C
Sbjct  110  KRKDK----CPLC  118

>PYU1_G005703
Length=412

 Score = 42.7 bits (99),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  110  LWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYL  148
            L    A+P TCP+C      P ++  G++FC+PCI  Y+
Sbjct  346  LMLSTADPSTCPVCRQIRVNPAMSVSGYVFCYPCIYHYV  384

>PYU1_G009058
Length=389

 Score = 42.4 bits (98),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 26/54 (48%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P  T CGH+FCW CI+ +     K    CP+C +      ++ +
Sbjct  335  CALCLGDRITPAATPCGHVFCWECIVGW---CQKNKAECPLCRQETHPQQIKCI  385

>PYAP_17426
Length=369

 Score = 42.4 bits (98),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            + C +C+     P  T CGH+FCW CI+ +     K    CP+C +      ++ V
Sbjct  313  KKCALCLGERISPATTPCGHVFCWECIVGW---CQKNKPECPICRQEAHPQQIKCV  365

>PHYCA_103372
Length=143

 Score = 40.4 bits (93),  Expect = 0.007, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 4/45 (9%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            +P  CP+C      P +   G++FC+PCI R++      +  CP+
Sbjct  83   DPALCPLCKKQRANPAMAPSGYVFCYPCIYRHVEQ----YGECPI  123

>H257_12393
Length=208

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+D+      T+CGH++C  CI +  ++ D +  RCP+C
Sbjct  157  CPLCLDTMVSITSTRCGHVYCRDCIAQ--AIVDMH--RCPLC  194

>PPTG_16653
Length=617

 Score = 42.7 bits (99),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (45%), Gaps = 19/92 (21%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            +A +P  C IC ++ R P    C H+FC  C+  +      + R CP+C  SV  G    
Sbjct  544  EAGSPD-CSICYETMRQPVKLACSHMFCEECVTEWF----DHERSCPLCRASVGSG----  594

Query  173  VQLQQLQIPPRVGSDVTFQFLERPKSRIFPQL  204
                     P    ++  QFL+  ++ + PQL
Sbjct  595  ---------PSAEENIKPQFLD-GRTSLVPQL  616

>PYU1_G001730
Length=358

 Score = 42.0 bits (97),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (52%), Gaps = 4/46 (9%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            N   C IC+D+      T CGH++C  CI   + +T K    CP+C
Sbjct  303  NALKCSICLDTIDEMTSTMCGHVYCGKCIRLAIRVTGK----CPLC  344

>H257_06791
Length=1029

 Score = 42.4 bits (98),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 9/66 (14%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQ  177
            Q CP+C+D    P +T C H+ C  C++ +LS        CP+C     + H+   QL +
Sbjct  780  QECPVCLDVPVAPVLTPCAHLMCHACVVAFLSNGGC----CPVC-----RAHISPDQLIR  830

Query  178  LQIPPR  183
            +  P +
Sbjct  831  VDPPDK  836

>SDRG_04254
Length=506

 Score = 42.0 bits (97),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 48/110 (44%), Gaps = 13/110 (12%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR-SVQLQQL  178
            CPIC+++   P    C H FC  CI   L     +   CP+C   V+K  LR    +Q++
Sbjct  20   CPICLEALSRPFSLPCNHFFCEACIHTALG----FATTCPVCKAMVRKRTLRHDTSVQRI  75

Query  179  QIPPRVGSDVTFQFLE-RPKSRIFPQLRVLPSTQLTDDCTESSAFTHSSS  227
            Q       D   + +  RP          +P++   D C+E S +  S+S
Sbjct  76   Q-------DALQKLMAMRPAIEAPVPAVTVPTSICIDLCSEESEYEQSNS  118

>PITG_03821
Length=830

 Score = 42.0 bits (97),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C
Sbjct  777  CSVCQDRRKDVLISKCSHMFCKECIENNLKSRN---RKCPTC  815

>PYIW_20853
Length=224

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 26/54 (48%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C+     P  T CGH+FCW CI+ +     K    CP+C +      ++ +
Sbjct  170  CALCLGDRISPAATPCGHVFCWECIVGW---CQKNKAECPLCRQETHPQQIKCI  220

>PPTG_00523
Length=466

 Score = 41.6 bits (96),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query  119  TCPICM-DSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    + P    C H FCW C+ R        +R CP+C
Sbjct  202  TCPICLCADVQAPITLSCAHTFCWSCLSR---AAQHRFRSCPLC  242

>PITG_19249
Length=465

 Score = 41.6 bits (96),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query  119  TCPICM-DSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    + P    C H FCW C+ R        +R CP+C
Sbjct  205  TCPICLCADVQAPITLSCAHTFCWSCLSR---AAQHRFRSCPLC  245

>PITG_00025
Length=535

 Score = 41.6 bits (96),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 28/56 (50%), Gaps = 5/56 (9%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            +A +P  C IC ++ R P    C H+FC  C+  +      + R CP+C  SV  G
Sbjct  462  EAGSPD-CSICYETMRQPVKLACSHMFCEECVTEWF----DHERSCPLCRASVGSG  512

>PHYSO_553932
Length=233

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI + +  + K    CP+C
Sbjct  182  CSICLDVIEDITSTTCGHIFCGGCIHQAIRASGK----CPLC  219

>SPRG_00527
Length=164

 Score = 40.0 bits (92),  Expect = 0.013, Method: Composition-based stats.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+D +     T CGH++C  CI   ++   K    CP+C
Sbjct  113  CPLCLDPYEEMASTTCGHVYCKECITLVVAKIHK----CPLC  150

>PITG_10321
Length=465

 Score = 41.6 bits (96),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query  119  TCPICM-DSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    + P    C H FCW C+ R        +R CP+C
Sbjct  205  TCPICLCADVQAPITLSCAHTFCWSCLSR---AAQHRFRSCPLC  245

>PYIW_18435
Length=961

 Score = 42.0 bits (97),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (48%), Gaps = 10/107 (9%)

Query  116  NPQTCPICMDSFRVPK-----ITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
             P  C IC+D+  +         KCGH+F   CI R++ +T K    CP+C  +V+K  +
Sbjct  177  QPTECTICIDACTLAGPHRLVALKCGHLFGKLCIERWV-LTKKT---CPICNAAVRKPDI  232

Query  171  RSVQLQQLQIPPRVG-SDVTFQFLERPKSRIFPQLRVLPSTQLTDDC  216
            R++    + +    G SD+T ++      RI  +  +  + Q   DC
Sbjct  233  RALFSDHVAVVDNSGISDITEKYESEKAKRIQLEAALEQTKQQLLDC  279

 Score = 36.6 bits (83),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 24/90 (27%), Positives = 38/90 (42%), Gaps = 9/90 (10%)

Query  115  ANPQTCPICMDSFRVP-----KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGH  169
            A P  C IC D   +         KCGH+F   CI R++       + CP C  +V+K  
Sbjct  397  AQPTECTICYDPCMISGRHRLAALKCGHLFGKKCIERWV----LERKSCPNCNVAVKKAD  452

Query  170  LRSVQLQQLQIPPRVGSDVTFQFLERPKSR  199
            +R +    + +    G +   Q  E  K++
Sbjct  453  IRPLFSDHVAVVDNSGVEGMKQMYEDEKNK  482

>PYU1_G007193
Length=831

 Score = 41.6 bits (96),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  ++SV
Sbjct  778  CSVCQDQRKNVLISKCFHMFCKDCIDSNLKSRN---RKCPTCKKMFGQDDVKSV  828

>H310_04140
Length=368

 Score = 41.2 bits (95),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 4/51 (8%)

Query  115  ANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            A  + C +C+     P +T CGH+FCW CI+ +     +    CP+C + V
Sbjct  310  AVVKKCVLCLAERTHPSVTPCGHLFCWECIVGWCQNKPE----CPLCRQLV  356

>PPTG_17132
Length=288

 Score = 40.8 bits (94),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI + +  + K    CP+C
Sbjct  237  CSICLDVLEDMTSTLCGHIFCAGCIHQAIRASGK----CPLC  274

>PHYRA_77725
Length=968

 Score = 41.6 bits (96),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C D F+ P+   C H FC PCIL +L        +CP C
Sbjct  211  CTLCGDMFQDPQCLDCKHNFCRPCILLHLKQNHT---QCPSC  249

>HYAP_02462
Length=821

 Score = 41.2 bits (95),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C   F+ P+   C H FC PCIL +L   + Y   CP C
Sbjct  21   CTLCDQMFQDPQCLDCKHNFCRPCILLHLKHNNSY---CPNC  59

>SDRG_13236
Length=135

 Score = 38.9 bits (89),  Expect = 0.018, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (4%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL  175
            C IC+D    P    CGH F   C+ R    T      CP+C   ++  HL+ +++
Sbjct  13   CAICLDVLTAPTTLACGHSFDLRCVRRLHKATSAL--ACPVCRAPIKPSHLQVLRV  66

>PYAR_20140
Length=284

 Score = 40.4 bits (93),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query  119  TCPICMDSFRVPKI-TKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             CPIC+D+   P + T CG  FC  C+   L+  D     CP+C
Sbjct  12   ACPICLDTMETPMLATCCGRSFCRACLYAALAAVDA----CPLC  51

>PITG_15195
Length=601

 Score = 40.8 bits (94),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQ  177
            C IC + F    + T CG IFC  CI R++S        CPMC E++    L   +L Q
Sbjct  230  CAICQEVFTNATEATCCGQIFCKDCIERWVSERGS----CPMCREAIGSSLLARSRLAQ  284

>H257_14373
Length=711

 Score = 40.8 bits (94),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D+ +   I+KC H+FC  C+   L   +   R+CP C +   +  ++ V
Sbjct  658  CSVCQDAPKEVMISKCSHMFCKECMESNLKARN---RKCPTCKKMFGQDDVKGV  708

>PYIW_14664
Length=426

 Score = 40.8 bits (94),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 4/46 (9%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            N   C IC+D       T CGHI+C  CI   + +T K    CP+C
Sbjct  371  NSLKCSICLDVIEEMTSTICGHIYCGKCIRLAIRVTAK----CPLC  412

>PYAP_13371
Length=482

 Score = 40.8 bits (94),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 51/129 (40%), Gaps = 31/129 (24%)

Query  95   DVESLTEWSLVEQVLLWYDAA-------NPQTCPICMDSFRVPKITKCGHIFCWPCILRY  147
            D + + EW       LW DA        +   C IC D F  P +  C H FC  C+ R+
Sbjct  2    DADDMDEW-------LWPDACPELRQMESTLRCLICGDFFHGPVLLPCTHTFCSECVRRF  54

Query  148  LSMTDKYWRRCPMCFESVQKGHL---RSVQLQQLQIPPRVGSDVTFQFLERPKSRIFPQL  204
            L         CP C +    G L   RS++        +VG  V FQ +   K ++ P L
Sbjct  55   LQSRGASG-CCPECKQPCAPGDLVPNRSLE--------KVG--VLFQQM---KPKVLPML  100

Query  205  RVLPSTQLT  213
                +  LT
Sbjct  101  SSNKTATLT  109

>H310_14328
Length=303

 Score = 40.0 bits (92),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 26/44 (59%), Gaps = 6/44 (14%)

Query  120  CPICMDSF--RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+D++   V +  +C H+FC PC+   L   DK    CP+C
Sbjct  84   CPICLDTYGDMVVECAECAHVFCDPCMRESLKRKDK----CPLC  123

>PYU1_G010079
Length=92

 Score = 37.4 bits (85),  Expect = 0.027, Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CPIC+ S   P    CGH+ C  C  + +SM       CP+C
Sbjct  24   CPICLRSELAPIRQDCGHVLCLQCTHQAISMIGS----CPLC  61

>PYIW_22999
Length=219

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query  120  CPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            CPIC+D+   P +T  CG  FC  C+   L+ T+     CPMC E +  G
Sbjct  27   CPICLDTLERPVLTTCCGQSFCDACLNAALAKTNA----CPMCREPLLSG  72

>PHYCA_107875
Length=441

 Score = 40.4 bits (93),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query  119  TCPICM-DSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+    + P    C H FCW C+ R        +R CP+C
Sbjct  195  TCPICLCADVQAPITLSCTHTFCWSCLSR---AAQHRFRSCPLC  235

>PYAP_17750
Length=343

 Score = 40.0 bits (92),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (46%), Gaps = 9/59 (15%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQL  178
            C +C+D       T CGH++C  CI   +  T K    CP+C     + HLR   +  L
Sbjct  292  CSVCLDVIEEMTSTICGHVYCARCIKLAIRATQK----CPLC-----QRHLRPTDIHGL  341

>PITG_18462
Length=220

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI + +  + K    CP+C
Sbjct  169  CSICLDVLEDMTSTLCGHIFCACCIHQAIRASGK----CPLC  206

>PYVX_21138
Length=426

 Score = 40.4 bits (93),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +  TCP+C+      +++ CGH+    CI R+L+ +     RCP+C E V
Sbjct  137  DGATCPVCLMDDVDTQLSACGHLLHAKCIKRWLAKS----ARCPVCREEV  182

>PHYCA_568641
Length=434

 Score = 40.4 bits (93),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 25/61 (41%), Gaps = 1/61 (2%)

Query  101  EWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            EW   E      +  N   C IC D F  P +  C H FC  C+ R+L     +   CP 
Sbjct  14   EWEWPEDCKPQREMENHLRCQICGDFFHGPVLLPCSHTFCSTCVRRFLQSKGAHG-CCPS  72

Query  161  C  161
            C
Sbjct  73   C  73

>SPRG_15736
Length=622

 Score = 40.4 bits (93),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 21/43 (49%), Gaps = 3/43 (7%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +CPIC+     P    C H FCW C+ +     + +   CP+C
Sbjct  169  SCPICLYHLTSPVTLSCSHSFCWSCLAK---AAEHHIHACPLC  208

>PPTG_06536
Length=837

 Score = 40.4 bits (93),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +      ++SV
Sbjct  784  CSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTCKKMFGHDDVKSV  834

>CCI45120
Length=270

 Score = 39.7 bits (91),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 23/46 (50%), Gaps = 4/46 (9%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            N   C IC+D       T CGH+FC  CI   +  T    ++CP+C
Sbjct  215  NSLKCSICLDLIDRMTSTICGHVFCRRCIRSAIQST----KKCPLC  256

>PHYSO_322360
Length=811

 Score = 40.4 bits (93),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +      ++SV
Sbjct  758  CSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTCKKMFGHDDVKSV  808

>HYAP_07106
Length=291

 Score = 39.7 bits (91),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI + +  + K    CP+C
Sbjct  240  CAICLDVLEDITSTVCGHIFCAGCICQAIRASGK----CPLC  277

>PHYCA_525476
Length=753

 Score = 40.4 bits (93),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C
Sbjct  700  CSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTC  738

>PHALS_07241
Length=290

 Score = 39.7 bits (91),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (48%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  CI   +    K    CP+C
Sbjct  239  CSICLDVLEDMTSTLCGHIFCAGCIHEAIRANGK----CPLC  276

>H257_07940
Length=369

 Score = 40.0 bits (92),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            + C +C+     P  T CGH+FCW CI+ +     +    CP+C + V
Sbjct  314  KKCALCLAERSHPSATPCGHLFCWDCIVGWCQSKPE----CPLCRQLV  357

>SDRG_06909
Length=240

 Score = 39.3 bits (90),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 3/44 (7%)

Query  119  TCPICMDSFRVP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TC +C   FR P  + +C H FC  CI +++   DK  R CP+C
Sbjct  17   TCTLCNGYFRQPYTVRECIHTFCKSCIFKHIVTQDK--RACPVC  58

>CCA18170
Length=374

 Score = 40.0 bits (92),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 25/56 (45%), Gaps = 1/56 (2%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL  175
            C IC D    P +  C HIFC  C+ RYL +       CP C  S +    R + L
Sbjct  25   CSICGDYLHGPVLLPCSHIFCSECVRRYLQVKGSNG-CCPQCKASCEAIDFRPIPL  79

>PHYCA_530915
Length=186

 Score = 38.9 bits (89),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGH+FC  CI + +    K    CP+C
Sbjct  135  CSICLDVLENMTSTICGHVFCAVCIRQAIRANGK----CPLC  172

>PHYKE_3015
Length=612

 Score = 40.0 bits (92),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC ES+
Sbjct  242  CAICQEVFTNATEATCCGQIFCKECIERWVSERGS----CPMCRESI  284

>CCA14180
Length=844

 Score = 40.4 bits (93),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  ++SV
Sbjct  791  CSVCQDRRKSVIISKCYHMFCKDCIDSNLKARN---RKCPSCKKMFGQDDVKSV  841

>PYIR_13446
Length=424

 Score = 40.0 bits (92),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGH++C  CI   + +T K    CP+C
Sbjct  373  CSICLDVIEEMTSTTCGHVYCGKCIRLAIRVTAK----CPLC  410

>PYVX_17302
Length=650

 Score = 40.0 bits (92),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 5/53 (9%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +A +P  C IC +S  +P    C H+FC  C++ +        R CP+C  SV
Sbjct  576  EAGSPD-CSICYESMHLPVKLSCSHMFCEECVMEWFDRE----RSCPLCRASV  623

>CCI43385
Length=862

 Score = 40.0 bits (92),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  ++SV
Sbjct  809  CSVCQDRQKSVIISKCYHMFCKECIDSNLKARN---RKCPSCKKMFGQDDVKSV  859

>PYIR_16966
Length=634

 Score = 40.0 bits (92),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSFR-VPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC ES+
Sbjct  267  CAICQEVFTGATEATCCGQIFCKDCIERWVSERGS----CPMCRESI  309

>CCA14023
Length=396

 Score = 39.7 bits (91),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (9%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            +P +C +C+ +   P     GH+FC+PCI  Y+    K    CP+
Sbjct  333  HPSSCSLCLKTRTNPAAASSGHVFCYPCIYEYVKRHHK----CPL  373

>SPRG_12576
Length=240

 Score = 39.3 bits (90),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 3/44 (7%)

Query  119  TCPICMDSFRVP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TC +C   FR P  + +C H FC  CI +++   DK  R CP+C
Sbjct  17   TCTLCNGYFRQPYTVRECIHTFCKSCIFKHIVTQDK--RACPVC  58

>PYU1_G007124
Length=464

 Score = 39.7 bits (91),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (51%), Gaps = 5/57 (9%)

Query  118  QTCPICMDSFRVPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            Q C IC++  R   +   CGH+F   CIL+ L +  +    CP+C     + HL S+
Sbjct  10   QECHICLEELRQDLVACPCGHVFHHACILQALQVNTQ----CPICRRYAAESHLISL  62

>PYIW_21519
Length=467

 Score = 39.7 bits (91),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 5/54 (9%)

Query  118  QTCPICMDSFRVPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q C IC++  R   +   CGH+F   CIL+ L + ++    CP+C     + HL
Sbjct  10   QECHICLEELRQDLVACPCGHVFHHACILQALQVNNQ----CPICRRFAAESHL  59

>CCI43386
Length=788

 Score = 40.0 bits (92),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  ++SV
Sbjct  735  CSVCQDRQKSVIISKCYHMFCKECIDSNLKARN---RKCPSCKKMFGQDDVKSV  785

>PYIR_19269
Length=460

 Score = 39.7 bits (91),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +TCP+C+      ++T+CGH     CI R++    +   RCP+C E V
Sbjct  230  ETCPVCLADDVDTQLTQCGHRIHAKCIKRWI----QSGTRCPVCREQV  273

>CCI39998
Length=396

 Score = 39.7 bits (91),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (58%), Gaps = 4/45 (9%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            +P  C +C+ +   P  +  GH+FC+PCI  Y+    K  ++CP+
Sbjct  333  HPSLCSLCLKTRTNPAASSSGHVFCYPCIYEYV----KRHQKCPL  373

>PYIR_19863
Length=652

 Score = 39.7 bits (91),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 28/56 (50%), Gaps = 9/56 (16%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL  175
            C +C+ +    +I  CGH F   C LR+  M     R CP+C     +GH+  VQL
Sbjct  170  CSVCLSANAYAQIALCGHTFHSKCFLRWFRMN----RSCPLC-----RGHVDKVQL  216

>PYVX_14742
Length=1160

 Score = 40.0 bits (92),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (6%)

Query  109  LLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            L   D      C +C D  +   I+KC H+FC  C+   L   +   R+CP C
Sbjct  767  LELQDLQKAVKCSVCQDRQKTVIISKCFHMFCKECVDNNLKSRN---RKCPTC  816

>PYU1_G001639
Length=614

 Score = 39.7 bits (91),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 28/56 (50%), Gaps = 9/56 (16%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL  175
            C +C+ +    +I  CGH F   C LR+  M     R CP+C     +GH+  +QL
Sbjct  152  CSVCLSANAYAQIASCGHTFHSKCFLRWFRMN----RSCPLC-----RGHVDKIQL  198

>PHYRA_81091
Length=212

 Score = 38.5 bits (88),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC+D       T CGHIFC  C+ + +    K    CP+C
Sbjct  161  CSICLDVLEDMTSTLCGHIFCAQCVHQAIRANGK----CPLC  198

>PHYRA_75992
Length=158

 Score = 38.1 bits (87),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 5/50 (10%)

Query  120  CPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            CPIC+  F  P +   CG  FC PC+   L   D     CPMC   +  G
Sbjct  9    CPICLGGFERPVLASCCGQSFCRPCLDAALRQVDA----CPMCRSPLLSG  54

>PYIR_18310
Length=678

 Score = 39.7 bits (91),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (48%), Gaps = 5/61 (8%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR-SVQLQQ  177
            +C IC+ ++  P    C H FC  CI R L +       CP+C    +K  LR    +QQ
Sbjct  2    SCAICLCAYANPSSLPCNHCFCEECIHRALELKPV----CPICKAPAKKRKLRYDSMIQQ  57

Query  178  L  178
            L
Sbjct  58   L  58

>PYAR_21118
Length=414

 Score = 39.3 bits (90),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 21/79 (27%), Positives = 33/79 (42%), Gaps = 3/79 (4%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQ  179
            CP+C+D F       C H FC  CI  +   +      CP C   V+   +R+  L  L 
Sbjct  238  CPVCLDYFSNSATLACSHTFCGHCISHWFRASSAL--SCPECRTGVRHMPVRNRALDDL-  294

Query  180  IPPRVGSDVTFQFLERPKS  198
            +   VG    ++   R ++
Sbjct  295  VHSLVGDTDAYRLAVRKRT  313

>PHYKE_8396
Length=160

 Score = 37.7 bits (86),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C+D       T CGHIFC  CI + +    K    CP+C
Sbjct  109  CSVCLDVLENMTSTLCGHIFCAGCIHQAIRANGK----CPLC  146

>PYAP_13246
Length=832

 Score = 39.7 bits (91),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C D  +   I+KC H+FC  C+   L   +   R+CP C
Sbjct  779  CSVCQDRHKNVIISKCFHMFCKECVDSNLKSRN---RKCPTC  817

>H310_11926
Length=711

 Score = 39.7 bits (91),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C D+ +   I+KC H+FC  C+   L   +   R+CP C
Sbjct  658  CSVCQDAPKEVMISKCCHMFCKECMESNLKARN---RKCPTC  696

>PHYKE_6978
Length=610

 Score = 39.7 bits (91),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 7/81 (9%)

Query  119  TCPICMDSFRVP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQ  177
            TC  C+  F  P  +  CGH +C  C+ +Y S+       C MC  S ++     +    
Sbjct  527  TCLQCIQLFTSPMTLAPCGHTYCAACLAKYGSVDVPSAISCKMCEGSTKQQETECI----  582

Query  178  LQIPPRVGSDVTFQFLERPKS  198
               P    +D+T +F+ R +S
Sbjct  583  --FPNHALADLTARFVFRQQS  601

>SPRG_02871
Length=422

 Score = 39.3 bits (90),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +A NP+ C IC D+   P   +C H+FC  C+  +        R CP+C
Sbjct  346  EAGNPE-CSICYDAMHTPVQLRCSHMFCEECVCEWFDRE----RNCPLC  389

>CCA18895
Length=274

 Score = 38.9 bits (89),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (44%), Gaps = 4/57 (7%)

Query  105  VEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +E   +     N   C IC+D       T CGH+FC  CI   +  T K    CP+C
Sbjct  208  IENAEIIEQFKNSLKCSICLDLIDRMTSTICGHVFCRHCIRSAIRSTSK----CPLC  260

>PYU1_G012889
Length=592

 Score = 39.3 bits (90),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSFR-VPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC ES+
Sbjct  226  CAICQEVFTGATEATCCGQIFCKNCIERWVSERGS----CPMCRESI  268

>SDRG_13137
Length=424

 Score = 39.3 bits (90),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +A NP+ C IC D+   P   +C H+FC  C+  +        R CP+C
Sbjct  344  EAGNPE-CSICYDAMHTPVQLRCSHMFCEECVCEWFDRE----RNCPLC  387

>PYAP_19190
Length=1248

 Score = 39.7 bits (91),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query  118   QTCPICMDSFRVPKITKCGHIFCWPCILRYL-SMTDKYWRRCPMC  161
             Q+C IC +    P    CGH+FC  C+  ++ S+ D     CP C
Sbjct  976   QSCVICHEDVEDPVEATCGHVFCRECVKEFVESLPDGAAATCPDC  1020

>SPRG_11898
Length=149

 Score = 37.4 bits (85),  Expect = 0.070, Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +CPIC++       + CGH +C+ CI  ++    +    CP+C
Sbjct  3    SCPICLEPATAAWTSPCGHAYCYACIAEWVR---RRQHTCPIC  42

>PHYRA_94120
Length=1227

 Score = 39.7 bits (91),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  +++V
Sbjct  709  CSVCQDRRKDVLISKCFHMFCKECIENNLKSRN---RKCPTCKKMFGQDDVKTV  759

>PHYSO_544210
Length=615

 Score = 39.3 bits (90),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  245  CAICQEVFTNATEATCCGQIFCKECIERWVSERGS----CPMCREAI  287

>PHALS_04027
Length=590

 Score = 39.3 bits (90),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 22/46 (48%), Gaps = 4/46 (9%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC +  R P    C HIFC  C+  +      + R CP+C  +V
Sbjct  524  CSICYERMRQPVKLACSHIFCEECVTEWF----DHERSCPLCRATV  565

>PPTG_24123
Length=993

 Score = 39.3 bits (90),  Expect = 0.075, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 31/76 (41%), Gaps = 20/76 (26%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQL  178
            +C +C   F+ P+   C H FC  CIL +L   + +   CP+C                 
Sbjct  216  SCTLCGKIFQDPQCLDCKHNFCLQCILLHLKQNNSH---CPIC-----------------  255

Query  179  QIPPRVGSDVTFQFLE  194
            Q+P R       QFLE
Sbjct  256  QLPTRPSEVTRNQFLE  271

>PHYCA_104632
Length=569

 Score = 39.3 bits (90),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 5/53 (9%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +A +P  C IC ++ R P    C H+FC  C+  +      + R CP+C  SV
Sbjct  497  EAGSPD-CSICYETMRQPVKLVCSHMFCEECVTEWFD----HERSCPLCRASV  544

>PHALS_00606
Length=1142

 Score = 39.3 bits (90),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C
Sbjct  780  CSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTC  818

>PYAR_26477
Length=196

 Score = 38.1 bits (87),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 37/66 (56%), Gaps = 5/66 (8%)

Query  103  SLVEQVLLWYDAANPQT--CPICMDSFRVPK---ITKCGHIFCWPCILRYLSMTDKYWRR  157
            S+++ +  ++  +  ++  C +C++S   P+   +T CGH +C PC+  YL++  +    
Sbjct  48   SVIQTIASFFGVSGSKSLRCLVCLESVPEPQCVALTACGHKYCKPCLTMYLTVNIREGLV  107

Query  158  CPMCFE  163
             P CF+
Sbjct  108  YPKCFQ  113

>PYIW_21541
Length=821

 Score = 39.3 bits (90),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I KC H+FC  C+   L   +   R+CP C +   +  +++V
Sbjct  768  CSVCQDQRKNVLIGKCFHMFCRDCVDSNLKSRN---RKCPTCKKMFGQDDVKAV  818

>PYIR_18633
Length=861

 Score = 39.3 bits (90),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I KC H+FC  C+   L   +   R+CP C +   +  +++V
Sbjct  808  CSVCQDQRKNVLIGKCFHMFCRDCVDNNLKSRN---RKCPTCKKMFGQDDVKAV  858

>PYAP_20783
Length=196

 Score = 37.7 bits (86),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 28/61 (46%), Gaps = 12/61 (20%)

Query  109  LLWYDAANPQTCPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            LLW        CPIC+D+   P +T  CG  FC  C+   L+  D     CPMC   +  
Sbjct  21   LLW-------KCPICLDTLHEPMLTTCCGQSFCRECLDAALAKADS----CPMCRSPLLS  69

Query  168  G  168
            G
Sbjct  70   G  70

>PPTG_06762
Length=597

 Score = 38.9 bits (89),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  227  CAICQEVFSNATEATCCGQIFCKDCIERWVSERGS----CPMCREAI  269

>H257_11542
Length=244

 Score = 38.1 bits (87),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (51%), Gaps = 1/51 (2%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGH  169
            TCPIC+   ++   T CGH FC  C+  Y + + +    CP C + +   H
Sbjct  59   TCPICLSDVQLACETNCGHSFCTSCLTSYFA-SRRVAYPCPCCRQHIHLVH  108

>PYAR_14906
Length=590

 Score = 38.9 bits (89),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSFR-VPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  232  CAICQEVFTGATEATCCGQIFCKDCIERWVSERGS----CPMCRENI  274

>PHYRA_79317
Length=595

 Score = 38.9 bits (89),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  224  CAICQEVFTNATEATCCGQIFCKECIERWVSERGS----CPMCREAI  266

>PHALS_06891
Length=546

 Score = 38.9 bits (89),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (52%), Gaps = 9/58 (16%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQ  177
            C +C+ +    +I+ CGHIF   C LR+  +     R CP+C     +G +  VQL Q
Sbjct  115  CSVCLSTNAYAQISSCGHIFHPNCFLRWFRLN----RSCPLC-----RGAVDKVQLAQ  163

>PHYCA_504243
Length=597

 Score = 38.9 bits (89),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  226  CAICQEVFTNATEATCCGQIFCKECIERWVSERGS----CPMCREAI  268

>PPTG_19285
Length=1115

 Score = 38.9 bits (89),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 39/87 (45%), Gaps = 11/87 (13%)

Query  103  SLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCF  162
            S++ QV    D  + Q CPIC+D  +   +T C H+ C  C+    S+ +     CP+C 
Sbjct  832  SVIAQV---EDGLDSQECPICLDPPQDAVLTPCAHVLCNQCLRD--SLANDPDNGCPVCR  886

Query  163  ESVQKGHLRSVQLQQLQIPPRVGSDVT  189
              V    +  +       PP+  SD T
Sbjct  887  TVVDMAKVFKLP------PPKTQSDDT  907

>PYIW_23779
Length=346

 Score = 38.5 bits (88),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 24/56 (43%), Gaps = 4/56 (7%)

Query  106  EQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +Q ++  D      C IC   FR    T CGH FC  C L++   T     RC  C
Sbjct  231  DQYVIKSDDEEQFACTICRGPFRNAIETICGHFFCEACALKHFKKT----SRCFNC  282

>PYAP_19146
Length=407

 Score = 38.5 bits (88),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 25/45 (56%), Gaps = 4/45 (9%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            +  TCPIC      P  +  G++FC+PCI R++    +  R CP+
Sbjct  348  DASTCPICQKRRVNPAASVSGYVFCYPCIYRHV----EEHRACPV  388

>SPRG_05381
Length=133

 Score = 37.0 bits (84),  Expect = 0.100, Method: Composition-based stats.
 Identities = 16/56 (29%), Positives = 27/56 (48%), Gaps = 2/56 (4%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQL  175
            C IC+D    P    CGH F   C+ R  +        CP+C   ++  HL+++++
Sbjct  13   CAICLDVLTTPATLACGHSFDLRCVRRLRASPCAI--ACPVCRAPMKASHLQALRV  66

>HYAP_05107
Length=906

 Score = 38.9 bits (89),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            C +C D  +   I+KC H+FC  CI   L   +   R+CP C +   +  +++V
Sbjct  853  CSVCQDRRKDVIISKCFHMFCKDCIETNLKARN---RKCPTCKKMFGQDDVKTV  903

>PHYSO_469986
Length=361

 Score = 38.5 bits (88),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 24/49 (49%), Gaps = 3/49 (6%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQ  166
            Q C IC  +   P  T C H FC  C+ ++ S   +    CPMC  S++
Sbjct  316  QPCTICFGNIDHPITTSCSHTFCAGCLAKWRSGGHEL---CPMCRSSLK  361

>PHYSO_476986
Length=361

 Score = 38.5 bits (88),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 24/49 (49%), Gaps = 3/49 (6%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQ  166
            Q C IC  +   P  T C H FC  C+ ++ S   +    CPMC  S++
Sbjct  316  QPCTICFGNIDHPITTSCSHTFCAGCLAKWRSGGHEL---CPMCRSSLK  361

>PYU1_G010963
Length=649

 Score = 38.9 bits (89),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 5/60 (8%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR-SVQLQQL  178
            C IC+ ++  P    C H FC  CI R L +       CP+C    +K  LR    +QQL
Sbjct  25   CAICLCAYANPVSLPCNHCFCEECIHRALELKSV----CPICKTPAKKRKLRYDTMIQQL  80

>PPTG_13607
Length=430

 Score = 38.5 bits (88),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query  118  QTCPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q C IC++  R   +   CGH+F   CI++ L +     ++CP+C  S     L
Sbjct  7    QECHICLEELRSDLVAAPCGHVFHHACIIQALQVN----KQCPICRRSTYDADL  56

>PYIR_16517
Length=583

 Score = 38.5 bits (88),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (45%), Gaps = 16/92 (17%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            +A +P  C IC +    P    C H+FC  C++ +        R CP+C  ++     R 
Sbjct  507  EAGSPD-CSICYEEMHQPVKLSCSHMFCEECVMEWFDRE----RSCPLCRANMAATSDRG  561

Query  173  VQLQQLQIPPRVGSDVTFQFLERPKSRIFPQL  204
               +Q ++ P        QFL+   S +FPQL
Sbjct  562  G--EQDEVKP--------QFLDGSTS-LFPQL  582

>SPRG_02199
Length=1007

 Score = 38.9 bits (89),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 31/72 (43%), Gaps = 11/72 (15%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQ  177
            Q CP+C+D  + P +T C H+ C  C+   L         CP+C   V    L       
Sbjct  765  QECPVCLDVPQSPVLTPCAHLLCHECVRAALDTAPV----CPVCRADVGLDQL-------  813

Query  178  LQIPPRVGSDVT  189
            + I P   +DVT
Sbjct  814  IPITPPERADVT  825

>PHYSO_494439
Length=101

 Score = 35.8 bits (81),  Expect = 0.12, Method: Composition-based stats.
 Identities = 23/75 (31%), Positives = 35/75 (47%), Gaps = 8/75 (11%)

Query  99   LTEWSL--VEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWR  156
            +  W+L  +E+V+  + A     C IC+ ++  P    C H FC  CI R L +      
Sbjct  1    MAPWTLARLERVVEGFSAQ--LQCAICLCAYDNPVSLPCNHCFCEECIHRALELK----A  54

Query  157  RCPMCFESVQKGHLR  171
             CP+C    +K  LR
Sbjct  55   VCPICKTPAKKRRLR  69

>H257_08184
Length=173

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             A +   C IC D+F  P +T CGH FC  C+  + S   +    CP+C
Sbjct  4    SATSAVECAICYDTFYFPFVTSCGHAFCHQCLTDWTS-GHRQSTSCPLC  51

>HYAP_09472
Length=639

 Score = 38.5 bits (88),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  265  CAICQEVFTNATEATCCGQIFCKECIERWVSERSS----CPMCREAI  307

>CCA26695
Length=297

 Score = 38.1 bits (87),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 7/56 (13%)

Query  107  QVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCF  162
            + L+  DA     C IC   F+    T CGHIFC  C L       K++R+   CF
Sbjct  218  EYLVSDDADEQFACTICRQPFQDAVKTICGHIFCEKCAL-------KHFRKTSRCF  266

>CCA23479
Length=297

 Score = 38.1 bits (87),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 7/56 (13%)

Query  107  QVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCF  162
            + L+  DA     C IC   F+    T CGHIFC  C L       K++R+   CF
Sbjct  218  EYLVSDDADEQFACTICRQPFQDAVKTICGHIFCEKCAL-------KHFRKTSRCF  266

>PHALS_00658
Length=397

 Score = 38.5 bits (88),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYL  148
            CP+C      P +T  G +FC+PCI RY+
Sbjct  329  CPLCKKKRVNPAMTSSGFVFCYPCIYRYV  357

>PYIR_22040
Length=457

 Score = 38.5 bits (88),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 27/66 (41%), Gaps = 1/66 (2%)

Query  99   LTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRC  158
            + EW          +  N   C IC D F  P +  C H FC  C+ +YL     +   C
Sbjct  1    MGEWEWPAHCEELREMENLLRCQICGDFFHGPVLLPCSHAFCSECVRKYLQTKGAHG-CC  59

Query  159  PMCFES  164
            P C ++
Sbjct  60   PECKQA  65

>PYAR_21305
Length=373

 Score = 38.1 bits (87),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +TCP+C+      +++ CGH     CI R++    K    CP+C E V
Sbjct  127  ETCPVCLADDVDTQLSNCGHRVHAKCIKRWIQSGSK----CPVCREVV  170

>PHALS_13047
Length=594

 Score = 38.5 bits (88),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  224  CAICQEVFTNATEATCCGQIFCKDCIERWVSERGS----CPMCREAI  266

>PYVX_16734
Length=277

 Score = 38.1 bits (87),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query  120  CPICMDSFRVPKI-TKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            CPIC+++FR P + T CG  FC  C+   L   D     CP+C   +  G
Sbjct  12   CPICLETFREPMLATCCGQSFCRSCLDAALRRCDA----CPVCRAPLLAG  57

>SDRG_10961
Length=1005

 Score = 38.5 bits (88),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 31/72 (43%), Gaps = 11/72 (15%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQ  177
            Q CP+C+D  + P +T C H+ C  C+   L         CP+C   V    L       
Sbjct  763  QECPVCLDVPQSPVLTPCAHLLCHECVRAALETAPV----CPVCRADVGLDQL-------  811

Query  178  LQIPPRVGSDVT  189
            + I P   +DVT
Sbjct  812  IPITPPERADVT  823

>PYAP_15538
Length=443

 Score = 38.5 bits (88),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICMDSFRVPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +CPIC+ S     IT  C H FCW C+ +     +  +  CPMC
Sbjct  184  SCPICLQSEVKSAITLSCKHTFCWSCLSK---AVEHRFHSCPMC  224

>PYVX_23721
Length=610

 Score = 38.5 bits (88),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSFR-VPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  238  CAICQEVFTGATEATCCGQIFCKDCIERWVSERGS----CPMCRENI  280

>PPTG_05556
Length=489

 Score = 38.5 bits (88),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (48%), Gaps = 1/42 (2%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC D F  P +  C H FC  C+ R+L     +   CP C
Sbjct  33   CQICGDFFHGPVLLPCSHTFCSACVRRFLQSKGAHG-CCPSC  73

>PYAP_19047
Length=514

 Score = 38.1 bits (87),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (51%), Gaps = 5/53 (9%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +A +P  C IC +S  VP    C H+FC  C++ +        R CP+C  ++
Sbjct  440  EAGSPD-CSICYESMAVPVKLSCSHMFCEECVMEWFDRE----RSCPLCRAAI  487

>PHALS_11589
Length=338

 Score = 38.1 bits (87),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query  132  ITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQL  178
            I+KCGH FC  CI R      +    CP C +SV+K  L+   +++L
Sbjct  36   ISKCGHRFCDHCIKREFQHQREIA--CPACQKSVKKSQLQDKTIEEL  80

>PITG_06725
Length=765

 Score = 38.5 bits (88),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query  119  TCPICMDSFRVP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            TC  CM  F  P  +  CGH +C  C+ +  S+       C MC  SV+K
Sbjct  660  TCLQCMQLFTEPMTLAPCGHTYCAACLAKCGSLEAPSSIACNMCEPSVKK  709

>PHYSO_358215
Length=368

 Score = 38.1 bits (87),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 21/46 (46%), Gaps = 4/46 (9%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            CPIC +    P  T C H FC  C+ R+L         CP C + +
Sbjct  168  CPICCEDLTDPFTTACRHTFCTVCLFRWLETKST----CPACRQPI  209

>PYIR_15591
Length=446

 Score = 38.1 bits (87),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query  118  QTCPICMDSFRVPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q C IC++  R   +   CGH+F   CIL+ L +  +    CP+C     + HL
Sbjct  10   QECHICLEELRQDLVACPCGHVFHHACILQALQVNTQ----CPICRRFAAESHL  59

>SPRG_10141
Length=385

 Score = 38.1 bits (87),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 28/58 (48%), Gaps = 4/58 (7%)

Query  115  ANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLS---MTDKYWRRCPMCFESVQKGH  169
              PQ C IC+    V K  +CGH+F   C+ +        DK W +C +C + V + H
Sbjct  295  GEPQVCAICLAPLCVAKQLECGHVFHLGCLRQCFQEQMRLDKPW-QCALCRKLVARAH  351

>SDRG_00360
Length=531

 Score = 38.1 bits (87),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 54/135 (40%), Gaps = 16/135 (12%)

Query  109  LLWYDAANPQTCPICMDSFRVP---KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +L    A    C IC++   +     ++ CGH FC  CI  YL+         P CF + 
Sbjct  155  MLGLGMAETSYCQICLEYVDIASTVALSVCGHRFCADCIHGYLANKIADGLIAPKCFFAD  214

Query  166  QKGHLRSVQLQQLQIPPRVGSDV-----TFQFLE-RPKSRIFPQLRVLPSTQLTDD----  215
              GH     +    +   V ++V      F+F++    +R  P   +L      DD    
Sbjct  215  SDGHPCEAVIPPSDVQALVSTEVFEKYEKFKFIKAHADARECPHCHLLQVGNGPDDPHMD  274

Query  216  ---CTESSAFTHSSS  227
               C ES  +THS++
Sbjct  275  CMQCGESFCYTHSNA  289

>PPTG_11751
Length=834

 Score = 38.1 bits (87),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 25/52 (48%), Gaps = 4/52 (8%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            C IC+ ++  P    C H FC  CI R L +  +    CP+C    +K  LR
Sbjct  48   CAICLCAYDNPVSLPCNHCFCEECIHRALELKAQ----CPICKTPAKKRRLR  95

>PHYKE_7837
Length=1447

 Score = 38.5 bits (88),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  120   CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             C +C D  +   I+KC H+FC  CI   L   +   R+CP C
Sbjct  1141  CSVCQDRRKDVIISKCFHMFCKECIENNLKSRN---RKCPTC  1179

>H257_04593
Length=247

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 41/91 (45%), Gaps = 11/91 (12%)

Query  116  NPQ-TCPICMDSFRVP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSV  173
            NP   C +C   FR P  I +C H FC  CI +Y+        +CP+C        L   
Sbjct  12   NPHFICTLCHGYFRQPYTIRECIHTFCKSCIFKYI--VSGVGNQCPICQLEFGTYPLSGT  69

Query  174  QLQQLQIPPRVGSDVTFQFLERPKSRIFPQL  204
            + +    PP++  D   + L +   ++FPQL
Sbjct  70   KTK----PPQIVQDHVMEGLVK---KLFPQL  93

>PYIW_15735
Length=408

 Score = 38.1 bits (87),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/90 (26%), Positives = 40/90 (44%), Gaps = 8/90 (9%)

Query  104  LVEQVLLWYDAANPQTCPICMDSFRVPK---ITKCGHIFCWPCILRYLSMTDKYWRRCPM  160
            L+   L+    ++ + C IC+D+  V      T CGH F W C+    S     + +CP 
Sbjct  190  LLAGALIEGKDSHAEECAICLDTMDVGHAIYTTACGHSFHWSCLKEIQSSDSSNYDKCPS  249

Query  161  CFESVQKGHLRSVQLQQLQIPPRVGSDVTF  190
            C     +  +  +Q+++    PRV +   F
Sbjct  250  C-----RATMTEMQVKKQCDHPRVRAGHRF  274

>H310_12571
Length=784

 Score = 38.1 bits (87),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 51/119 (43%), Gaps = 23/119 (19%)

Query  96   VESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYW  155
            ++SL + +LV  VLL    +   +CPIC+     P    C H FCW C+ +  +      
Sbjct  174  LDSLVQ-ALVAPVLL---PSLDASCPICLYPHTSPVTLGCHHTFCWSCLAKAAAHHIH--  227

Query  156  RRCPMCFESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIFPQLRVLPSTQLTD  214
              CP+C         R VQ     I PR   D     L +    +F QL+   S+Q T+
Sbjct  228  -ACPLC---------REVQ----SIDPR---DYEIDGLVKRFGNLFTQLQFELSSQPTE  269

>PYAR_16668
Length=448

 Score = 38.1 bits (87),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (56%), Gaps = 6/45 (13%)

Query  119  TCPICMDSFRVPKIT-KCGHIFCWPCILRYLSMTDKY-WRRCPMC  161
            +CPIC+ +     IT  C H FCW C    LSM  ++ +  CPMC
Sbjct  200  SCPICLQNEVKSAITLSCKHTFCWSC----LSMAAEHRFHSCPMC  240

>PHYSO_317996
Length=1057

 Score = 38.1 bits (87),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query  103  SLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            S++ QV    D    Q CPIC+D  +   +T C H+ C  C+    S+ +     CP+C
Sbjct  766  SVIAQV---EDGLESQECPICLDPPQNAVLTPCAHVLCDQCLRD--SLANDPENGCPVC  819

>PHYSO_516036
Length=157

 Score = 36.6 bits (83),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 5/50 (10%)

Query  120  CPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKG  168
            CPIC+ SF  P +   CG  FC  C+   L   D     CPMC   +  G
Sbjct  9    CPICLGSFERPVLASCCGQSFCRSCLDGALRQVDA----CPMCRSPLLSG  54

>PYAP_23336
Length=562

 Score = 38.1 bits (87),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSFR-VPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  198  CAICQEVFTGATEATCCGQIFCKDCIERWVSERGS----CPMCRENI  240

>PYU1_G003426
Length=492

 Score = 37.7 bits (86),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQK  167
            C +CMD+ R      CGHI      L  +   D Y   CP+C  ++Q+
Sbjct  438  CVVCMDAERDAICVPCGHIAGCHTCLSAIKQQDPYRASCPICRTTIQR  485

>PYAP_13092
Length=277

 Score = 37.4 bits (85),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (52%), Gaps = 4/54 (7%)

Query  120  CPICMDSFRVPKITK-CGHIFCWPCI---LRYLSMTDKYWRRCPMCFESVQKGH  169
            CPIC+     P + K C H++C+ C+   +R LS+       CP+C  +   G+
Sbjct  58   CPICLHDLDDPVMLKGCHHVYCYACVASWVRNLSLHGARTPTCPLCKRAFTAGY  111

>PITG_22857
Length=1036

 Score = 38.1 bits (87),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (51%), Gaps = 5/59 (8%)

Query  103  SLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            S++ QV    D  + Q CPIC+D  +   +T C H+ C  C+    S+ +     CP+C
Sbjct  757  SVIAQV---EDGLDSQECPICLDPPQNAVLTPCAHVLCDQCLRD--SLGNDPDNGCPVC  810

>SDRG_04070
Length=185

 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 5/44 (11%)

Query  120  CPICMDSF--RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            CP+C+D+F   V +   C  +FC  C+   L+   +  RRCP+C
Sbjct  56   CPVCLDTFAGAVVECNACAQVFCESCLQACLT---RQSRRCPLC  96

>PHALS_01600
Length=470

 Score = 37.7 bits (86),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 36/83 (43%), Gaps = 13/83 (16%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRR----CPMCFESVQKGHLRSVQL  175
            CP+C+D F       C H FC  CI          W R    CP C + V+   +R+  L
Sbjct  270  CPVCLDYFNSSATLPCSHTFCGLCI--------SSWFRNSLSCPECRDIVKTLPIRNRAL  321

Query  176  QQLQIPPRVGSDVTFQFLERPKS  198
             +L +   VG    ++ L R ++
Sbjct  322  DEL-VEGLVGQKEAYKSLIRRRA  343

>PHALS_11946
Length=492

 Score = 37.7 bits (86),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (48%), Gaps = 1/42 (2%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC D F  P +  C H FC  C+ R+L     +   CP C
Sbjct  31   CQICGDYFHGPVLLPCSHTFCSACVRRFLQSKGAHG-CCPSC  71

>PHYSO_454028
Length=840

 Score = 38.1 bits (87),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query  103  SLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            S++ QV    D    Q CPIC+D  +   +T C H+ C  C+    S+ +     CP+C
Sbjct  784  SVIAQV---EDGLESQECPICLDPPQNAVLTPCAHVLCDQCLRD--SLANDPENGCPVC  837

>PYVX_17168
Length=274

 Score = 37.4 bits (85),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 25/55 (45%), Gaps = 6/55 (11%)

Query  112  YDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQ  166
            Y+A     C +CMD      +  CGHIFC  C+ R           CP+C + ++
Sbjct  218  YEAQKALRCAVCMDRGVDRVLVPCGHIFCGVCVDRV------APNGCPVCRQPIE  266

>CCA15199
Length=522

 Score = 37.7 bits (86),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 21/105 (20%)

Query  70   QIEYLHANYRFVIAPLDPECIVPTWDVESLTEWSLVE-QVLLWYDAANPQTCPICMDSFR  128
            Q+E L   Y+  +  +DP C+    DV   +    ++  + L +D      CPIC+  F 
Sbjct  361  QLEIL--KYKKPVKSVDPACVHHNKDVSVSSHVGSIQIPICLNFDE---DVCPICLVEFE  415

Query  129  ----VPKITKCGHIFCWPCILRYLSMTDKYWRR---CPMCFESVQ  166
                V K+  C HIF  PCI       D++ RR   CPMC + V+
Sbjct  416  EEENVRKL-NCTHIFHVPCI-------DEWLRRNVTCPMCKDIVE  452

>PHYSO_441337
Length=313

 Score = 37.4 bits (85),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 25/63 (40%), Gaps = 1/63 (2%)

Query  99   LTEWSLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRC  158
            + EW          +  N   C IC D F  P +  C H FC  C+ R++  +      C
Sbjct  10   MDEWEWPANCKAQREMENHLRCQICGDFFHGPVLLPCSHTFCSACVRRFM-QSKGTNACC  68

Query  159  PMC  161
            P C
Sbjct  69   PQC  71

>PITG_02789
Length=315

 Score = 37.4 bits (85),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (48%), Gaps = 1/42 (2%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            C IC D F  P +  C H FC  C+ R+L     +   CP C
Sbjct  31   CQICGDFFHGPVLLPCSHTFCSACVRRFLQSKGAHG-CCPSC  71

>SPRG_20626
Length=215

 Score = 37.0 bits (84),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 4/44 (9%)

Query  119  TCPICMDSFR-VPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             C +C   FR V  +++C H FC  C+LR+L       RRCP+C
Sbjct  20   VCSLCYGYFRDVHTLSECLHSFCKSCLLRHLHGGS---RRCPIC  60

>H257_03456
Length=501

 Score = 37.7 bits (86),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 19/69 (28%), Positives = 28/69 (41%), Gaps = 5/69 (7%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRS  172
            +A +P+ C IC D+   P    C H+FC  C+  +        R CP+C   V      S
Sbjct  407  EAGSPE-CSICYDAMHAPVQLACAHMFCEECVAEWFDRE----RSCPLCRADVDAAPSSS  461

Query  173  VQLQQLQIP  181
                   +P
Sbjct  462  TSTTSPPVP  470

>PYAR_25105
Length=437

 Score = 37.7 bits (86),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (52%), Gaps = 4/46 (9%)

Query  116  NPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            +PQ C +C +  R     KCGHI C PC   +  M +  +  CP+C
Sbjct  372  DPQ-CFVCYEITRKAYAAKCGHICCMPC---WQKMENDGFSSCPVC  413

>CCA19978
Length=538

 Score = 37.7 bits (86),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSF-RVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  177  CAICQEVFTSATEATCCGQIFCKECIERWVSERGS----CPMCRENI  219

>PITG_03761
Length=431

 Score = 37.4 bits (85),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 28/54 (52%), Gaps = 5/54 (9%)

Query  118  QTCPICMDSFRVPKITK-CGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
            Q C IC++  R   +   CGH+F   C+++ L    ++ ++CP+C  S     L
Sbjct  7    QECHICLEDLRSNLVAAPCGHVFHHACVIQAL----QFNKQCPICRRSTYDADL  56

>PYIW_13128
Length=425

 Score = 37.4 bits (85),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  119  TCPICMDSFRVPKIT-KCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            TCPIC+   R   +  +C H FC  CI + L + +   R CP C
Sbjct  81   TCPICLGVIRSTMVVMECLHRFCGECIQKSLRLGN---RECPSC  121

>PYIR_13224
Length=858

 Score = 37.7 bits (86),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (54%), Gaps = 9/63 (14%)

Query  116  NPQTCPICMDSFRVPK-----ITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHL  170
             P  C IC+D+  +         KCGH+F   CI R++ +T K    CP+C  +V+K  +
Sbjct  138  QPTECTICIDACTISGPHRLVALKCGHLFGKVCIERWV-LTRKA---CPICNFAVRKPDI  193

Query  171  RSV  173
            R++
Sbjct  194  RAL  196

 Score = 36.6 bits (83),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (47%), Gaps = 9/62 (15%)

Query  115  ANPQTCPICMDSFRVPK-----ITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGH  169
            A P  C IC D+  +         KCGH+F   CI R++       + CP C  +V+K  
Sbjct  385  AQPTECTICYDACMISGRHRLVALKCGHLFGKKCIERWVLER----KSCPNCNVAVKKAD  440

Query  170  LR  171
            +R
Sbjct  441  IR  442

>PYAP_17815
Length=261

 Score = 37.0 bits (84),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query  120  CPICMDSFRVP---KITKCGHIFCWPCILRYLSMTDKYWRRCPMCF-ESVQKGHLRSVQL  175
            CP+C D   +     +  CGH FC  CI  YL +        PMCF E V+    R+V +
Sbjct  44   CPVCFDLVPIESTVALRACGHRFCRACIAGYLEVKICDGEVFPMCFHEEVEARRGRTVSV  103

Query  176  QQL  178
            ++L
Sbjct  104  EKL  106

>CCI49016
Length=539

 Score = 37.7 bits (86),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  120  CPICMDSFR-VPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            C IC + F    + T CG IFC  CI R++S        CPMC E++
Sbjct  178  CAICQEVFTGATEATCCGQIFCKECIERWVSERGS----CPMCRENI  220

>HYAP_09739
Length=159

 Score = 36.2 bits (82),  Expect = 0.25, Method: Composition-based stats.
 Identities = 18/52 (35%), Positives = 23/52 (44%), Gaps = 4/52 (8%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLR  171
            C IC+ ++  P    C H FC  CI R L +       CP+C     K  LR
Sbjct  30   CAICLCAYENPVSLPCNHSFCEECIHRALELKT----LCPICKTPANKRRLR  77

>PITG_01038
Length=352

 Score = 37.4 bits (85),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 21/46 (46%), Gaps = 3/46 (7%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            CPIC         T CGH FC  C+ +  S   +    CPMC  S+
Sbjct  308  CPICFIQTDNSITTACGHTFCSACVAKLRSRGHEL---CPMCRSSL  350

>H310_01980
Length=479

 Score = 37.4 bits (85),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (47%), Gaps = 4/47 (9%)

Query  120  CPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQ  166
            C IC D+ + P   +C H+FC  CI  +        R CP+C   V 
Sbjct  412  CSICYDTMQTPVQLQCAHLFCEECIAEWFDRE----RSCPLCRADVH  454

>PYIR_25281
Length=356

 Score = 37.4 bits (85),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 19/43 (44%), Gaps = 4/43 (9%)

Query  119  TCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
             C IC   FR    T CGH FC  C L++   T     RC  C
Sbjct  251  ACTICRGPFRNAIETICGHFFCEACALKHFKKTS----RCFNC  289

>SPRG_21099
Length=119

 Score = 35.0 bits (79),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 7/75 (9%)

Query  91   VPTWDVESLTEWSLVEQVLLWYDAANPQTCPICMDSFRVPK----ITKCGHIFCWPCILR  146
            V T    + T      +V L  D    + CPIC+D F          +CGH F + C+L 
Sbjct  24   VATEAKAAATPQETTHKVTLLMDQ---EECPICLDEFESLGQSIFTGECGHKFHFTCLLE  80

Query  147  YLSMTDKYWRRCPMC  161
             ++  +    +CP+C
Sbjct  81   NVNHDEANATKCPIC  95

>PYAP_15145
Length=381

 Score = 37.4 bits (85),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  118  QTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +TCP+C+      +++ CGH     CI R++    K    CP+C E V
Sbjct  116  ETCPVCLTDDVDTQLSNCGHRVHAKCIKRWIQSGSK----CPVCREPV  159

>PHYRA_79594
Length=1068

 Score = 37.4 bits (85),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query  103  SLVEQVLLWYDAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYLSMTDKYWRRCPMC  161
            S++ QV    D    Q CPIC+D  +   +T C H+ C  C+    S+ +     CP+C
Sbjct  781  SVIAQV---EDGLESQECPICLDPPQHAVLTPCAHVLCDQCLRD--SLGNDPENGCPVC  834

>SPRG_11364
Length=420

 Score = 37.0 bits (84),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 52/135 (39%), Gaps = 16/135 (12%)

Query  109  LLWYDAANPQTCPICMDSFRVP---KITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESV  165
            +L    A    C IC++   V     ++ CGH FC  CI  YL+         P CF + 
Sbjct  43   MLGLGMAETSYCQICLEYVDVASTVALSVCGHRFCADCIHGYLASKISDGLVAPKCFFAD  102

Query  166  QKGHLRSVQLQQLQIPPRVGSDV-----TFQFLE-RPKSRIFPQLRVLPSTQLTDD----  215
              G      +    I   V +DV      F F++    +R  P   VL      DD    
Sbjct  103  GDGRPCEALIPPSDIQALVSTDVFEKYEKFNFIKAHAGARECPHCHVLQVGNGPDDPHMD  162

Query  216  ---CTESSAFTHSSS  227
               C E+  +THS++
Sbjct  163  CTQCGEAFCYTHSNA  177

>PYIR_17889
Length=860

 Score = 37.4 bits (85),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%)

Query  113  DAANPQTCPICMDSFRVPKITKCGHIFCWPCILRYL-SMTDKYWRRCPMC  161
            D    + C IC +    P + KCG +FC  C+  ++ S+       CP C
Sbjct  574  DGDQERACTICHEDMEDPVMAKCGDVFCRECVKEFIESLPMGAEATCPAC  623

>H310_06619
Length=248

 Score = 36.6 bits (83),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 11/102 (11%)

Query  105  VEQVLLWYDAANPQ-TCPICMDSFRVP-KITKCGHIFCWPCILRYLSMTDKYWRRCPMCF  162
            + ++L+     NP   C +C   FR P  I +C H FC  CI +Y+        +CP+C 
Sbjct  1    MHKLLVNTSELNPHFVCTLCDGYFRQPYTIRECIHTFCKSCIFKYI--VSGVSNQCPICQ  58

Query  163  ESVQKGHLRSVQLQQLQIPPRVGSDVTFQFLERPKSRIFPQL  204
                   L   + +    PP++  D   + L R   ++FP L
Sbjct  59   LEFGTYPLSGTKTK----PPQIVQDHVMEGLVR---KLFPHL  93

Lambda      K        H        a         alpha
   0.318    0.131    0.398    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 47422841709

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40