Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_051931617122822812075e-170
PHYSO_5388861617122822811675e-164
PITG_206291617122822811651e-163
PPTG_101841617122822811651e-163
PHYCA_1228181617122922911477e-161
PHYKE_108181617123023011382e-159
PYVX_146271617122923010982e-153
PYIR_170331617123222510931e-152
PYIW_177511617122422810894e-152
PYU1_G0019711617122222610713e-149
PYAR_171301617122722710687e-149
PYAP_165861617125325310083e-139
PHYRA_8473016170194321510981e-137
HYAP_07162161711942289312e-128
CCI46337161712292288961e-122
CCA17366161712282278761e-119
H310_01462161712252298482e-115
SDRG_06607161712202298394e-114
SPRG_05306161712202298386e-114
HYAP_07161161701881787922e-107
H257_00325161712402447885e-106
PYIR_266328668121279810.13
PYIW_2766816706413840730.76
SPRG_1477813022419031676.0
SPRG_1472913018450033696.1
PPTG_000601781829847679.3
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_05193

Length=228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHALS_05193                                                           469     5e-170
PHYSO_538886                                                          454     5e-164
PITG_20629                                                            453     1e-163
PPTG_10184                                                            453     1e-163
PHYCA_122818                                                          446     7e-161
PHYKE_10818                                                           442     2e-159
PYVX_14627                                                            427     2e-153
PYIR_17033                                                            425     1e-152
PYIW_17751                                                            424     4e-152
PYU1_G001971                                                          417     3e-149
PYAR_17130                                                            416     7e-149
PYAP_16586                                                            392     3e-139
PHYRA_84730                                                           427     1e-137
HYAP_07162                                                            363     2e-128
CCI46337                                                              349     1e-122
CCA17366                                                              342     1e-119
H310_01462                                                            331     2e-115
SDRG_06607                                                            327     4e-114
SPRG_05306                                                            327     6e-114
HYAP_07161                                                            309     2e-107
H257_00325                                                            308     5e-106
PYIR_26632                                                            35.8    0.13  
PYIW_27668                                                            32.7    0.76  
SPRG_14778                                                            30.4    6.0   
SPRG_14729                                                            31.2    6.1   
PPTG_00060                                                            30.4    9.3   

>PHALS_05193
Length=228

 Score = 469 bits (1207),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 228/228 (100%), Positives = 228/228 (100%), Gaps = 0/228 (0%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH
Sbjct  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI
Sbjct  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
            GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS
Sbjct  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228

>PHYSO_538886
Length=228

 Score = 454 bits (1167),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 219/228 (96%), Positives = 225/228 (99%), Gaps = 0/228 (0%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPV PELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDA VH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAERLWVWKYS+GQEKF+MDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDK+EKE+
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
             AGDMR+SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228

>PITG_20629
Length=228

 Score = 453 bits (1165),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 219/228 (96%), Positives = 224/228 (98%), Gaps = 0/228 (0%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPV PELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDA VH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAERLWVWKYS+GQEKF+MDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDK+EKEI
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEI  180

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
             AGDMR+SLAR+RSSSVDLSDNDPTPSAIHIL TIDEDGLGLSSWWTS
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWWTS  228

>PPTG_10184
Length=228

 Score = 453 bits (1165),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 218/228 (96%), Positives = 224/228 (98%), Gaps = 0/228 (0%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MF LTRISDVIPV PELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDA VH
Sbjct  1    MFALTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAERLWVWKYS+GQEKF+MDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDK+EKE+
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
             AGDMR+SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228

>PHYCA_122818
Length=229

 Score = 446 bits (1147),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 216/229 (94%), Positives = 224/229 (98%), Gaps = 1/229 (0%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPV PELFDADYTQVL+EE+DRKYANKVIADVGLCITLYDFVSIGDA VH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEVDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKG-IQATTTEATDKSEKE  179
            DTAERLWVWKYS+GQEKF+MDLHEEIRFRVTNINFTRVTKTAKG IQATTTEATDK+EKE
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGSIQATTTEATDKAEKE  180

Query  180  IGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
              AGDMR+SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS
Sbjct  181  TSAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  229

>PHYKE_10818
Length=230

 Score = 442 bits (1138),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 214/230 (93%), Positives = 224/230 (97%), Gaps = 2/230 (1%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPV PELFDADYTQVL+EEIDRKYANKVI+DVGLCITLYDFVSIGDA VH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVISDVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKE-  179
            D+AERLWVWKYS+GQEKF+MDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDK+E E 
Sbjct  121  DSAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAENEG  180

Query  180  -IGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
             + AGDMR+SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS
Sbjct  181  VVTAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  230

>PYVX_14627
Length=229

 Score = 427 bits (1098),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 208/230 (90%), Positives = 220/230 (96%), Gaps = 3/230 (1%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTR+SDVIPV PELFDADYTQVL+EEIDRKYANKVIADVGLCITL+DFV IGDA +H
Sbjct  1    MFVLTRLSDVIPVAPELFDADYTQVLVEEIDRKYANKVIADVGLCITLHDFVHIGDAFIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            D+AERLWVWKYSD QEKF+MDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDK E++ 
Sbjct  121  DSAERLWVWKYSDSQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDK-EQDG  179

Query  181  GA--GDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
            GA  GDMR SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGL+SWW +
Sbjct  180  GAKNGDMRESLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWWVN  229

>PYIR_17033
Length=232

 Score = 425 bits (1093),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 216/225 (96%), Gaps = 1/225 (0%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPV PELFDADYT+VL+EEIDRKYANKVIADVGLCIT+YDFV IGDA VH
Sbjct  1    MFVLTRISDVIPVSPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAERLWVWKYS+GQEKF+MD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DK+    
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTATGIQATTTEASDKAATS-  179

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSW  225
             AGDMR+SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGL+SW
Sbjct  180  AAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSW  224

>PYIW_17751
Length=224

 Score = 424 bits (1089),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 218/228 (96%), Gaps = 4/228 (2%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTR+SDVIPV PELFDADYT+VL+EEIDRKYANKV+ADVGLCIT+YDFV IGDA VH
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVVADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAERLWVWKYS+GQEKF+MD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DK+E   
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTATGIQATTTEASDKAE---  177

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
             A D+R+SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGL+SWW +
Sbjct  178  -ASDLRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWWVN  224

>PYU1_G001971
Length=222

 Score = 417 bits (1071),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 201/226 (89%), Positives = 213/226 (94%), Gaps = 6/226 (3%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTR+SDVIPV PELFDADYT+VL+EEIDRKYANKVIADVGLCIT+YDFV IGDA VH
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAERLWVWKYS+GQEKF+MD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DK+  E 
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASE-  179

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226
                  +SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW
Sbjct  180  -----GQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220

>PYAR_17130
Length=227

 Score = 416 bits (1068),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 197/227 (87%), Positives = 214/227 (94%), Gaps = 0/227 (0%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPV P+LF+ DY +VL+EEIDRKYANKVIADVGLC+++YDFV IGDA VH
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFR+VVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAERLWVWKYS+G EKF+MDLHEEIRFRVTNINFTRVTKTA GIQATTTEA+DK+E   
Sbjct  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWT  227
             AGDMR+SLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGLSSWWT
Sbjct  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWWT  227

>PYAP_16586
Length=253

 Score = 392 bits (1008),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/253 (77%), Positives = 213/253 (84%), Gaps = 26/253 (10%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPV P+LF+ DY +VL+EEIDRKYANKVIADVGLC+++YDFV IGDA VH
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCLSIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQV------------EFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDII  108
            P+DGTSHSQV            EFR+VVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDII
Sbjct  61   PADGTSHSQVKRDGSTDARGVVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDII  120

Query  109  IPSYALQTPSYFDTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAK-----  163
            IPSYA+QTPSYFDTAERLWVWKYS+G EKF+MDLHEEIRFRVT+INFTRVTKTA      
Sbjct  121  IPSYAMQTPSYFDTAERLWVWKYSEGNEKFYMDLHEEIRFRVTSINFTRVTKTAHGGWYV  180

Query  164  ---------GIQATTTEATDKSEKEIGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGT  214
                     GIQATTTEA++K+E    AGDMR+SL R RS+SVDLSD+DPTPSAIHILGT
Sbjct  181  DADGVVGGVGIQATTTEASEKTEGTANAGDMRQSLTRGRSASVDLSDSDPTPSAIHILGT  240

Query  215  IDEDGLGLSSWWT  227
            IDEDGLGLSSWWT
Sbjct  241  IDEDGLGLSSWWT  253

>PHYRA_84730
Length=1943

 Score = 427 bits (1098),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/215 (92%), Positives = 210/215 (98%), Gaps = 0/215 (0%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVIPV PELFDADYTQVL+EEIDRKYANKV+ADVGLCITLYDFVSIGDA+VH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVLADVGLCITLYDFVSIGDAYVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGR+VSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRVVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            D AERLWVWKYS+GQEKF+MDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDK+EKE+
Sbjct  121  DAAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTI  215
             AGDMR+SLAR+RSSSVDLSDNDPTPSAIHIL  +
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILARL  215

>HYAP_07162
Length=194

 Score = 363 bits (931),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 188/228 (82%), Gaps = 34/228 (15%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTR+SDVIPV P LFDADYTQVLIEEIDRKYANKVIADVGLC+TLYDFV IGDA VH
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHS VEFR++VFRPFVGEVLKGRIV CT+EHIRVSMDFVQDIIIPSYALQTPSY+
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DTAE+LWVWKYSDGQEKF+MDLHEEIRFRVTNINFTRVTKTAK                 
Sbjct  121  DTAEKLWVWKYSDGQEKFYMDLHEEIRFRVTNINFTRVTKTAK-----------------  163

Query  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS  228
                             DLSDNDPTPSAIHILG+IDEDGLGLSSWWTS
Sbjct  164  -----------------DLSDNDPTPSAIHILGSIDEDGLGLSSWWTS  194

>CCI46337
Length=229

 Score = 349 bits (896),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 199/228 (87%), Gaps = 5/228 (2%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTRISDVI + P LFD DYT+VL EEIDRKY NKVIADVGLCI++YDF++IGDA +H
Sbjct  1    MFVLTRISDVIAIHPMLFDGDYTKVLKEEIDRKYCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PS+G SH+QVEFR++VFRPF+GEVLKG+I+SC E HIR++M+F+QDI+IPSYALQTPS+F
Sbjct  61   PSEGDSHTQVEFRMIVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180
            DT ERLWVW ++D  EKF MDL+EEIRFRVTN+NFT+V KTAKG+QATT+E+T+K +K  
Sbjct  121  DTYERLWVWTFTDSAEKFHMDLNEEIRFRVTNVNFTQVHKTAKGMQATTSESTEKKDK--  178

Query  181  GAGDMRRSL--ARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226
             A   R +L   R+R SSVDLSD+DPTPSA+ ILGTIDEDGLGL+SWW
Sbjct  179  -ASLKRGNLDDKRRRLSSVDLSDSDPTPSAMQILGTIDEDGLGLTSWW  225

>CCA17366
Length=228

 Score = 342 bits (876),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 196/227 (86%), Gaps = 3/227 (1%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVL RISDVI + P LFD DYT+VL EEID+K+ NKVIADVGLCI++YDF++IGDA +H
Sbjct  1    MFVLARISDVIAIHPMLFDGDYTRVLKEEIDKKFCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PS+G SH+QVEFR+VVFRPF+GEVLKG+I+SC E HIR++M+F+QDI+IPSYALQTPS+F
Sbjct  61   PSEGDSHTQVEFRMVVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKE-  179
            DT ERLWVW +++  EKF MDL+EE+RFRVTN+NFT+V KTAKG+QATT E+TDK  K  
Sbjct  121  DTYERLWVWTFTESGEKFHMDLNEEVRFRVTNVNFTQVHKTAKGMQATTIESTDKDGKST  180

Query  180  IGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226
            +  G++     ++R SSVDLSDNDPTPSA+ ILGTIDEDGLGL+SWW
Sbjct  181  LKGGNIDDR--KRRLSSVDLSDNDPTPSAMQILGTIDEDGLGLTSWW  225

>H310_01462
Length=225

 Score = 331 bits (848),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 187/229 (82%), Gaps = 10/229 (4%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVL R++DVI V PELF ADY+ VLIEEIDRKYANKVIADVGLCIT YDF+ IGDA+VH
Sbjct  1    MFVLCRVADVIQVAPELFSADYSSVLIEEIDRKYANKVIADVGLCITHYDFIEIGDAYVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH+ V FR+VVFRPF+GE+LKG+I++CTEEHIRVSM+F+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIINCTEEHIRVSMEFMQDIIIPSYAMQNPSFF  120

Query  121  DTAERLWVWKY---SDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSE  177
            D  ERLW WK+    D Q+ ++M L+EE+RFRVTNINFTRV KTA G+QA T  A  K +
Sbjct  121  DKTERLWEWKFPGREDDQDPYYMYLNEEVRFRVTNINFTRVLKTANGMQAVTEAADTKPD  180

Query  178  KEIGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226
            K         +  R+RSSSVDLSD DP P+A+ I+GTIDEDGLGLSSWW
Sbjct  181  KS-------ENPTRRRSSSVDLSDTDPKPAALQIIGTIDEDGLGLSSWW  222

>SDRG_06607
Length=220

 Score = 327 bits (839),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 191/229 (83%), Gaps = 15/229 (7%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVL RI+DVI + PELF  DY+ VL EEIDRKYANKVIADVGLCITLYDF+ IGDA++H
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH++V FR+VVF+PF+GEVLKG+I+SCTEEHIRVSMDFVQDIIIPSYA+QTPS+F
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DTAERLWVWKY---SDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSE  177
            D  ERLW WK+    D Q+ ++M LHEEIRFRVTNINFTRVTKTAKGIQAT TEA     
Sbjct  121  DKNERLWEWKFPGKEDEQDPYYMYLHEEIRFRVTNINFTRVTKTAKGIQATVTEAA----  176

Query  178  KEIGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226
                      + +R+RSSSVDLS++DP PSA+ I+GTIDEDGLGLSSWW
Sbjct  177  --------DSASSRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWW  217

>SPRG_05306
Length=220

 Score = 327 bits (838),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 191/229 (83%), Gaps = 15/229 (7%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVL RI+DVI + PELF  DY+ VL EEIDRKYANKVIADVGLCITLYDF+ IGDA++H
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH++V FR+VVF+PF+GEVLKG+I+SCTEEHIRVSMDFVQDIIIPSYA+QTPS+F
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DTAERLWVWKY---SDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSE  177
            D  ERLW WK+    D Q+ ++M LHEE+RFRVTNINFTRVTKTAKGIQAT TEA     
Sbjct  121  DKNERLWEWKFPGKEDEQDPYYMYLHEEVRFRVTNINFTRVTKTAKGIQATVTEAA----  176

Query  178  KEIGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226
                      + +R+RSSSVDLS++DP PSA+ I+GTIDEDGLGLSSWW
Sbjct  177  --------DSASSRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWW  217

>HYAP_07161
Length=188

 Score = 309 bits (792),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 158/178 (89%), Gaps = 14/178 (8%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVLTR+SDVIPV P LFDADYTQVLIEEIDRKYANKVIADVGLC+TLYDFV IGDA VH
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHS VEFR++VFRPFVGEVLKGRIV CT+EHIRVSMDFVQDIIIPSYALQTPSY+
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DTAERLWVWKYSDGQ--------------EKFFMDLHEEIRFRVTNINFTRVTKTAKG  164
            DTAE+LWVWKYSDGQ              EKF+MDLHEEIRFRVTNINFTRVTKTAKG
Sbjct  121  DTAEKLWVWKYSDGQGEGVPQTWSRCLAVEKFYMDLHEEIRFRVTNINFTRVTKTAKG  178

>H257_00325
Length=240

 Score = 308 bits (788),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 191/244 (78%), Gaps = 25/244 (10%)

Query  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
            MFVL R++DVI V PELF +DY+ VLIEEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH+ V FR+VVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120

Query  121  DTAERLWVWKYS------------------DGQEKFFMDLHEEIRFRVTNINFTRVTKTA  162
            D  ERLW WK+                   D Q+ ++M L+EEIRFRVTNINFTRV KTA
Sbjct  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180

Query  163  KGIQATTTEATDKSEKEIGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGL  222
            KG+QA  T+ATD         D   + +R+RSSSVDLSD+DP P+A+ I+GTIDEDGLGL
Sbjct  181  KGMQA-VTDATDSKP------DKHEAPSRRRSSSVDLSDSDPKPAALQIIGTIDEDGLGL  233

Query  223  SSWW  226
            SSWW
Sbjct  234  SSWW  237

>PYIR_26632
Length=212

 Score = 35.8 bits (81),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 41/79 (52%), Gaps = 6/79 (8%)

Query  2   FVLTR-ISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60
           +VL R  S ++P E  + D D+  +L+EE   + A KVI  V    T  DFV  G   V 
Sbjct  12  YVLLRSTSKIVPCESVVTDVDHPLLLLEEALSRVAMKVIEIV----TPNDFVCEGVCTVK  67

Query  61  PSDGTSHSQVEFRLV-VFR  78
            S G S S+  F L+ VFR
Sbjct  68  SSCGVSISEDGFALLQVFR  86

>PYIW_27668
Length=138

 Score = 32.7 bits (73),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 26/40 (65%), Gaps = 3/40 (8%)

Query  83   EVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPS--YF  120
            E+ K    + +++H+ ++MDF Q++  PS A +TPS  YF
Sbjct  26   ELYKNEFAAVSDDHVVLTMDFAQNLTTPS-AAETPSEWYF  64

>SPRG_14778
Length=190

 Score = 30.4 bits (67),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 1/31 (3%)

Query  15  PELFDAD-YTQVLIEEIDRKYANKVIADVGL  44
           P+  DA  + QV +EEIDR+Y + V+A + L
Sbjct  62  PDALDAKHWPQVCVEEIDRRYTSTVLAALPL  92

>SPRG_14729
Length=500

 Score = 31.2 bits (69),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 1/33 (3%)

Query  13  VEPELFDAD-YTQVLIEEIDRKYANKVIADVGL  44
           V P+  DA  + QV +EEIDR+Y + V+A + L
Sbjct  46  VTPDALDAKHWPQVCVEEIDRRYTSIVLAALPL  78

>PPTG_00060
Length=298

 Score = 30.4 bits (67),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 10/47 (21%)

Query  86   KGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYFDTAERLWVWKYS  132
            K  + S +E+H  + MDF Q++ +PS A  TPS          W+YS
Sbjct  161  KKDLASVSEDHAVIVMDFSQNLTLPSVA-STPSQ---------WEYS  197

Lambda      K        H        a         alpha
   0.320    0.135    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11574829044

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40