Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_138281598237337317890.0
PHYRA_847311598237137510996e-149
PPTG_101851598236336110856e-147
PHALS_051941598236335910613e-143
PHYKE_108191598234435610368e-140
PHYCA_123086159822712608925e-119
PYIR_22643159824023558803e-115
PYU1_G001972159824003648733e-114
PYIW_17753159823983398621e-112
PYVX_14608159823853488532e-111
PYAR_24297159823863498523e-111
PYAP_16572159824133548544e-111
PHYSO_471886159822462498374e-111
PITG_20313159822462518262e-109
PITG_20630161722462518262e-109
H257_07371161723513568023e-104
H310_07576161723513557945e-103
CCA18901161723733357941e-102
CCI45129161723723417862e-101
SDRG_05001161723463607815e-101
SPRG_12487161723463587781e-100
CCI45130159822482576961e-89
CCI451281617018312677434e-87
PYU1_G008337151514142984971e-57
PYU1_G008336836514062984881e-56
PYIR_23853151514202544812e-55
SDRG_12928151513412534743e-55
PYVX_16559836513762964774e-55
SPRG_06805151513412554692e-54
PYVX_16542151513882974713e-54
PHYCA_533347836514172534673e-53
PPTG_17622151513952984636e-53
PHYCA_543819151514462984651e-52
PHYRA_83397151513842984601e-52
PHYRA_9659388456132974713e-52
PHYSO_552775151513953414583e-52
PYIR_21123836513881444531e-51
PITG_19056151513902984243e-47
PYAR_21138151514553354101e-44
PYAR_21139836513572944005e-44
PYIW_28078167629108782775e-29
PYIW_26705836512302162061e-17
PYIW_27182151512762212011e-16
PYU1_G00182891031858790.66
PPTG_017665904669978780.97
CCA193581625868249761.9
PYAR_21141884513921712.4
PPTG_075472045310859702.8
PYIR_2332991043256724.5
PYAP_184371515145121724.8
PHYKE_68832637875110716.8
PYIR_20390531552582709.6
PYIW_2132691051760709.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_13828

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HYAP_13828                                                            693     0.0   
PHYRA_84731                                                           427     6e-149
PPTG_10185                                                            422     6e-147
PHALS_05194                                                           413     3e-143
PHYKE_10819                                                           403     8e-140
PHYCA_123086                                                          348     5e-119
PYIR_22643                                                            343     3e-115
PYU1_G001972                                                          340     3e-114
PYIW_17753                                                            336     1e-112
PYVX_14608                                                            333     2e-111
PYAR_24297                                                            332     3e-111
PYAP_16572                                                            333     4e-111
PHYSO_471886                                                          327     4e-111
PITG_20313                                                            322     2e-109
PITG_20630                                                            322     2e-109
H257_07371                                                            313     3e-104
H310_07576                                                            310     5e-103
CCA18901                                                              310     1e-102
CCI45129                                                              307     2e-101
SDRG_05001                                                            305     5e-101
SPRG_12487                                                            304     1e-100
CCI45130                                                              272     1e-89 
CCI45128                                                              290     4e-87 
PYU1_G008337                                                          196     1e-57 
PYU1_G008336                                                          192     1e-56 
PYIR_23853                                                            189     2e-55 
SDRG_12928                                                            187     3e-55 
PYVX_16559                                                            188     4e-55 
SPRG_06805                                                            185     2e-54 
PYVX_16542                                                            186     3e-54 
PHYCA_533347                                                          184     3e-53 
PPTG_17622                                                            182     6e-53 
PHYCA_543819                                                          183     1e-52 
PHYRA_83397                                                           181     1e-52 
PHYRA_96593                                                           186     3e-52 
PHYSO_552775                                                          181     3e-52 
PYIR_21123                                                            179     1e-51 
PITG_19056                                                            167     3e-47 
PYAR_21138                                                            162     1e-44 
PYAR_21139                                                            158     5e-44 
PYIW_28078                                                            111     5e-29 
PYIW_26705                                                            84.0    1e-17 
PYIW_27182                                                            82.0    1e-16 
PYU1_G001828                                                          35.0    0.66  
PPTG_01766                                                            34.7    0.97  
CCA19358                                                              33.9    1.9   
PYAR_21141                                                            32.0    2.4   
PPTG_07547                                                            31.6    2.8   
PYIR_23329                                                            32.3    4.5   
PYAP_18437                                                            32.3    4.8   
PHYKE_6883                                                            32.0    6.8   
PYIR_20390                                                            31.6    9.6   
PYIW_21326                                                            31.6    9.9   

>HYAP_13828
Length=373

 Score = 693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%), Gaps = 0/373 (0%)

Query  1    MAECspltspssqrqlqslqDYGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEETQHLA  60
            MAECSPLTSPSSQRQLQSLQDYGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEETQHLA
Sbjct  1    MAECSPLTSPSSQRQLQSLQDYGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEETQHLA  60

Query  61   ASSLGSTLPVLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYS  120
            ASSLGSTLPVLAAINASLSANVTLALVKIYAAWTSNSLAVLSSLVDSILDLTSQALFWYS
Sbjct  61   ASSLGSTLPVLAAINASLSANVTLALVKIYAAWTSNSLAVLSSLVDSILDLTSQALFWYS  120

Query  121  DKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCD  180
            DKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCD
Sbjct  121  DKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCD  180

Query  181  SSQARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHC  240
            SSQARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHC
Sbjct  181  SSQARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHC  240

Query  241  HSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRT  300
            HSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRT
Sbjct  241  HSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRT  300

Query  301  DIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNY  360
            DIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNY
Sbjct  301  DIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNY  360

Query  361  DEHKDPTIRRDSA  373
            DEHKDPTIRRDSA
Sbjct  361  DEHKDPTIRRDSA  373

>PHYRA_84731
Length=371

 Score = 427 bits (1099),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 264/375 (70%), Positives = 288/375 (77%), Gaps = 8/375 (2%)

Query  1    MAECspltspssqrqlqslqDYGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKE---ETQ  57
            MAE S LTS   QR  Q+   YGSLT+T T   SKV ERY RSQVSHAFLLKKE   E Q
Sbjct  1    MAESSSLTSQQVQRSPQTPNGYGSLTVTTTPGGSKVDERYRRSQVSHAFLLKKEADVEAQ  60

Query  58   HLAASSLGSTLPVLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALF  117
            HLA+ S   TL V  AIN SL+ANV LALVKIYAA+TS SLAVLSSLVDSILDLTSQALF
Sbjct  61   HLASPS-AFTLRVQVAINVSLAANVALALVKIYAAFTSGSLAVLSSLVDSILDLTSQALF  119

Query  118  WYSDKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAA  177
            WYSDK MHTPSV+YPAGRRRLEPIAVI+SATLMGMA      Q   A  +  + H     
Sbjct  120  WYSDKRMHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFNGHQRELN  179

Query  178  RCDSSQARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFA  237
                + A  +V +    ++  A      +I+  +       QDHRNDVFSNT+A+ AAFA
Sbjct  180  ISTFTVAVLLVAI----VIKLALWYVCAKIAAHSPSADALAQDHRNDVFSNTVAVAAAFA  235

Query  238  THCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPM  297
             H HS+ WY DS+GA+VISVYIAVSWLATGKEQVERLVGLQA QEFIDQIRLLGDVHHPM
Sbjct  236  AHWHSNLWYFDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPM  295

Query  298  MRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLE  357
            MRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISL+LQ KVEELD VERAFVHVDYLE
Sbjct  296  MRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDQVERAFVHVDYLE  355

Query  358  RNYDEHKDPTIRRDS  372
            RNYDEHKDPT+RRDS
Sbjct  356  RNYDEHKDPTLRRDS  370

>PPTG_10185
Length=363

 Score = 422 bits (1085),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 252/361 (70%), Positives = 279/361 (77%), Gaps = 22/361 (6%)

Query  22   YGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKE---ETQHLAASSLGSTLPVLAAINASL  78
            YG+LT+TPT   +K  +RY RSQVSHAFLLKKE   E Q LA+ S  + L V  AINASL
Sbjct  14   YGTLTITPTLGSTKADDRYRRSQVSHAFLLKKEADVEEQRLASPS-NAILRVQVAINASL  72

Query  79   SANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRL  138
            +ANV LA+VKIYAA+TS SLAVLSSLVDSILDLTSQALFWYSDK MHTPSV+YPAGRRRL
Sbjct  73   AANVALAIVKIYAAFTSGSLAVLSSLVDSILDLTSQALFWYSDKRMHTPSVKYPAGRRRL  132

Query  139  EPIAVIVSATLMGMAG-----SCRGAQWQAARG--RHLDFHDGRAARCDSSQARAMVRVP  191
            EPIAVI+SATLMGMA          A  +  +G  R LDF            +  M+ + 
Sbjct  133  EPIAVIISATLMGMAAIEVIQQSVEALVKGFKGHQRELDF-----------SSFTMIVLL  181

Query  192  RCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIG  251
               ++         +I+  +       QDHRNDVFSN++A+ AAFA H HS+ WYLDSIG
Sbjct  182  VAIVIKLLLWHICTKIASHSPSADALAQDHRNDVFSNSVAVAAAFAAHWHSNLWYLDSIG  241

Query  252  AVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNN  311
            A+VISVYIAVSWLATGKEQVERLVGLQA QEFIDQIRLLGDVHHPMMRTDIVRAYHFGNN
Sbjct  242  AIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNN  301

Query  312  YLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRD  371
            YLVEMEVILPEDMCVKDAHDISL+LQ KVE LDNVERAFVHVDYLERNYDEHKDPTIRRD
Sbjct  302  YLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPTIRRD  361

Query  372  S  372
            S
Sbjct  362  S  362

>PHALS_05194
Length=363

 Score = 413 bits (1061),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/359 (68%), Positives = 270/359 (75%), Gaps = 16/359 (4%)

Query  22   YGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEE---TQHLAASSLGSTLPVLAAINASL  78
            YG+ T+  T  +SKV+ RY RSQVSHAFLLKKEE    QHL++ S  + L V  AINASL
Sbjct  14   YGTHTINSTPKNSKVSGRYCRSQVSHAFLLKKEEDAEVQHLSSPS-SAALRVQVAINASL  72

Query  79   SANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRL  138
            +ANV L +VKIYAA TS SLAVLSSLVDSILDLTSQALFWYSDK MHTPSV+YPAGRRRL
Sbjct  73   AANVVLTIVKIYAALTSGSLAVLSSLVDSILDLTSQALFWYSDKRMHTPSVKYPAGRRRL  132

Query  139  EPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAMVR----VPRCY  194
            EPIAVI+SATLMGMA      Q   A  +  +   G     D S    +V     V + +
Sbjct  133  EPIAVIISATLMGMAAIEVIQQSVKALVKGFN---GHLREIDISSFTLIVLLVAIVVKLF  189

Query  195  LLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVV  254
            L       + H  S          QDHRNDV+SN +A+ AAF  H H S W LDSIGA+V
Sbjct  190  LWYICAKIASHSPSADA-----LAQDHRNDVYSNLVAVSAAFVAHKHPSLWCLDSIGAIV  244

Query  255  ISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLV  314
            ISVYIAVSWLATGKEQVERLVGLQA QEFID IR LGDVHHP+M+TDIVRAYHFGNNYLV
Sbjct  245  ISVYIAVSWLATGKEQVERLVGLQAEQEFIDHIRTLGDVHHPLMKTDIVRAYHFGNNYLV  304

Query  315  EMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
            EMEVILPEDMCVK+AHDISL+LQ KVE LDNVERAFVHVDYLERNYDEHKDPT+RRDS+
Sbjct  305  EMEVILPEDMCVKEAHDISLSLQIKVEGLDNVERAFVHVDYLERNYDEHKDPTLRRDSS  363

>PHYKE_10819
Length=344

 Score = 403 bits (1036),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 236/356 (66%), Positives = 262/356 (74%), Gaps = 35/356 (10%)

Query  21   DYGSLTL-TPTQSDSKVAERYHRSQVSHAFLLKKE---ETQHLAASSLGSTLPVLAAINA  76
            DYGS+ + T T   +KV ERY RSQVSHAFLLKKE   E QH+  S   STL V  AIN 
Sbjct  19   DYGSIIISTTTPGGTKVDERYRRSQVSHAFLLKKEADIEEQHMT-SPTSSTLRVQVAINV  77

Query  77   SLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRR  136
            SL ANV LA+VK YAA  S SLAVLSSLVDSILDLTSQ LFWYSDK MHTPSV+YPAGRR
Sbjct  78   SLIANVVLAIVKTYAACMSGSLAVLSSLVDSILDLTSQLLFWYSDKRMHTPSVKYPAGRR  137

Query  137  RLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAMVRVPRCYLL  196
            RLEP+AVI+SATLMGMA      Q   +  + L+ H  +      + A  +V +      
Sbjct  138  RLEPVAVIISATLMGMAAIEVIQQAVESLVKGLNGHQRQLDISTFTMAVLLVAIV-----  192

Query  197  PDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVIS  256
               +L                       V  NT+A+ AAFA H HS+ WYLDS+GA+VIS
Sbjct  193  --VKL-----------------------VLCNTVAVGAAFAAHWHSNLWYLDSVGAIVIS  227

Query  257  VYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEM  316
            VYIAVSWLATGKEQVERLVGLQA+QEFID+IRLLGD+HHPMMRTDIVRAYHFGNNYLVEM
Sbjct  228  VYIAVSWLATGKEQVERLVGLQASQEFIDEIRLLGDIHHPMMRTDIVRAYHFGNNYLVEM  287

Query  317  EVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDS  372
            EVILPEDMCVKDAHDISL+LQ KVE LDNVERAFVHVDYLERNYDEHKDPT+RRDS
Sbjct  288  EVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPTLRRDS  343

>PHYCA_123086
Length=271

 Score = 348 bits (892),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 184/260 (71%), Positives = 203/260 (78%), Gaps = 4/260 (2%)

Query  114  QALFWYSDKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHD  173
            QALFWYSDK MHTPSV+YPAGRRRLEPIAVI+SATLMGMA      Q   A  +  + H 
Sbjct  15   QALFWYSDKRMHTPSVQYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFNGHQ  74

Query  174  GRAARCDSSQARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIV  233
                R     A  M+ +    ++         +I+  +       QDHRNDVFSNT+A+ 
Sbjct  75   ----RELEISAFTMLVLLVAIVIKLILWYFCAKIASHSPSADALAQDHRNDVFSNTVAVA  130

Query  234  AAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDV  293
            AAFA H HSS WYLDS+GA+VISVYIAVSWLATGKEQVERLVGLQA QEFIDQIRLLGDV
Sbjct  131  AAFAAHWHSSLWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDV  190

Query  294  HHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHV  353
            HHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISL+LQ KVEELDNVERAFVHV
Sbjct  191  HHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHV  250

Query  354  DYLERNYDEHKDPTIRRDSA  373
            DYLERNYDEHKDPT+RR+ +
Sbjct  251  DYLERNYDEHKDPTLRRNDS  270

>PYIR_22643
Length=402

 Score = 343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 211/355 (59%), Positives = 249/355 (70%), Gaps = 14/355 (4%)

Query  21   DYGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEETQ-HLAASSLGSTLPVLAAINASLS  79
            +Y S  L P Q D+       RSQV+H+ L K+ E +  L   S  ++L V  AINASL 
Sbjct  59   NYDSPQLVPQQRDT-----VRRSQVAHSLLHKQSELEAQLIPPS--ASLRVQLAINASLV  111

Query  80   ANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLE  139
             NV LA+ K+YAA TS SLAVLSSLVDSILDLTSQALFWYSDK MHTPSV+YPAGRRRLE
Sbjct  112  INVLLAIAKVYAAATSGSLAVLSSLVDSILDLTSQALFWYSDKRMHTPSVKYPAGRRRLE  171

Query  140  PIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAMVR-VPRCYLLPD  198
            PIAVI+SATLMGMA        Q +    +    G     + +    ++  V  C  L  
Sbjct  172  PIAVIISATLMGMAAI---EVMQKSVETLVAGFKGNLPDLNMTLITIVILCVAICVKLVL  228

Query  199  ARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVY  258
              + SR  I+  +       QDHRNDVFSN +A+V +   H     WYLDSIG ++IS+Y
Sbjct  229  WYICSR--IATNSPSADALAQDHRNDVFSNVVAVVTSALAHWQRDLWYLDSIGGILISMY  286

Query  259  IAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEV  318
            IA+SWLATGKEQVE+LVGLQA  +FI+QI  L D+HHP+M++DIVRAYHFGNNYLVE+EV
Sbjct  287  IALSWLATGKEQVEKLVGLQADPDFINQIYGLADLHHPLMKSDIVRAYHFGNNYLVELEV  346

Query  319  ILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
            ILPE MCVK+AHDISL LQ KVE LD VERAFVHVDY  R+YDEHKDPTIRRDSA
Sbjct  347  ILPEQMCVKEAHDISLALQDKVEALDCVERAFVHVDYAPRDYDEHKDPTIRRDSA  401

>PYU1_G001972
Length=400

 Score = 340 bits (873),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 211/364 (58%), Positives = 248/364 (68%), Gaps = 20/364 (5%)

Query  22   YGSLTLTPTQSDSKVAERY---------HRSQVSHAFLLKKE--ETQHLAASSLGSTLPV  70
            YG++ L    ++S  A+ +          RSQV+HA L K+   E Q + AS+   +  V
Sbjct  44   YGAIPLARDTAESSDADDFAALIPREPARRSQVAHALLHKQNDLEAQQIPASA---SHRV  100

Query  71   LAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVE  130
              AINASL  NV LA  K+YAA +S SLAVLSSLVDSILDLTSQ LFWYSDK MHTPSV 
Sbjct  101  QLAINASLVINVMLATAKLYAAISSGSLAVLSSLVDSILDLTSQVLFWYSDKRMHTPSVR  160

Query  131  YPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAMVR-  189
            YPAGRRRLEPIAVI+SATLMGMA        Q +    +    G     + S    ++  
Sbjct  161  YPAGRRRLEPIAVIISATLMGMAAV---EVIQKSTETLIAGTKGNLPDLNMSALTILILC  217

Query  190  VPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDS  249
            V  C  L    + SR  I+  +       QDHRNDVFSN +A++ +   H     WYLDS
Sbjct  218  VAICVKLVLWFICSR--IAKNSPSADALAQDHRNDVFSNAVAVLTSVIAHYQRDLWYLDS  275

Query  250  IGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFG  309
            IG ++IS+YIA+SWLATGKEQVE+L GLQA   FID+I  L DVHHP++R+DIVRAYHFG
Sbjct  276  IGGILISLYIALSWLATGKEQVEKLAGLQADSAFIDEIYELVDVHHPLLRSDIVRAYHFG  335

Query  310  NNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIR  369
            NNYLVE+EVILPE MCVKDAHDISL LQHKVE LD VERAFVHVDY  R+YDEHKDPTIR
Sbjct  336  NNYLVELEVILPETMCVKDAHDISLALQHKVEALDAVERAFVHVDYAPRDYDEHKDPTIR  395

Query  370  RDSA  373
            RDSA
Sbjct  396  RDSA  399

>PYIW_17753
Length=398

 Score = 336 bits (862),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 206/339 (61%), Positives = 242/339 (71%), Gaps = 19/339 (6%)

Query  42   RSQVSHAFLLKKE--ETQHLAASSLGSTLPVLAAINASLSANVTLALVKIYAAWtsnsla  99
            RSQV+H+ L K+   E Q + AS+   +L V  AINASL+ NV LA+ K YAA TS SLA
Sbjct  71   RSQVAHSLLHKQNDLEAQLIPASA---SLRVQLAINASLAINVVLAVAKTYAAVTSGSLA  127

Query  100  vlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAG----S  155
            VLSSLVDSILDLTSQ LFWYSDK MHTPSV+YPAGRRRLEPIAVI+SATLMGMA      
Sbjct  128  VLSSLVDSILDLTSQGLFWYSDKRMHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVMQ  187

Query  156  CRGAQWQAARGRHL-DFHDGRAARCDSSQARAMVRVPRCYLLPDARLRSRHQISVTNDFG  214
              G    A    HL D +        ++    ++ V  C  L    + SR  I+  +   
Sbjct  188  KSGETLVAGVNGHLPDLNM-------TTSTIVVLCVAICVKLVLWYICSR--IAKNSPSA  238

Query  215  LHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERL  274
                QDHRNDVFSN +A+V +   H     WYLDS+G +VIS+YIA+SWLATGKEQVE+L
Sbjct  239  DALAQDHRNDVFSNVVAVVTSVLAHWQRQLWYLDSVGGIVISLYIALSWLATGKEQVEKL  298

Query  275  VGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISL  334
            VGL+A  +FI QI  L D+HHP+M++DIVRAYHFGNNYLVE+EVILPE MCV++AHDISL
Sbjct  299  VGLKADPDFIAQIHGLVDLHHPLMKSDIVRAYHFGNNYLVELEVILPEQMCVREAHDISL  358

Query  335  NLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
             LQ KVE LD VERAFVHVDY  R+YDEHKDPTIRRDSA
Sbjct  359  ALQDKVEALDCVERAFVHVDYASRDYDEHKDPTIRRDSA  397

>PYVX_14608
Length=385

 Score = 333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 199/348 (57%), Positives = 237/348 (68%), Gaps = 12/348 (3%)

Query  38   ERYHRSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSANVTLALVKIYAAWtsns  97
            E    S ++HAF     + +  A +    +  V  AINASL  N+ LA+ K YAA +S S
Sbjct  38   EXXXXSPLAHAFFPHTNDLETRADAPPSMSRKVQLAINASLGVNILLAIAKTYAALSSGS  97

Query  98   lavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCR  157
            LAVLSSLVDS+LDL SQALFWYSDK MHT  V+YPAGRRRLEPIAVI+SATLMGM G C 
Sbjct  98   LAVLSSLVDSVLDLASQALFWYSDKRMHTRDVKYPAGRRRLEPIAVIISATLMGMTGECV  157

Query  158  GA-----QWQAA------RGRHLDFHDGRAARCDSSQARAMVRVPRCYLLPDARLRSRHQ  206
             +     QW  A      +         +    D + +   + V    ++    L    +
Sbjct  158  PSLSLLTQWVLAAIEVIQKSVETLVMGWKGTLPDMNISIITLAVLLAAIITKLVLWYICR  217

Query  207  ISVTNDFGLHCL-QDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLA  265
            +  T       L QDHRNDV+SN+IAI+AA   + H + WYLDS GA+VISVYIAVSWL 
Sbjct  218  LISTQSPSADALAQDHRNDVYSNSIAIIAACLANWHKNLWYLDSAGAIVISVYIAVSWLE  277

Query  266  TGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMC  325
            TGKEQVERLVGLQA+QEFID+IR L D HH +M+ DIVRAYHFGNNYLVE+EVILPE M 
Sbjct  278  TGKEQVERLVGLQASQEFIDEIRKLADTHHSLMKADIVRAYHFGNNYLVEIEVILPESMR  337

Query  326  VKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
            V++AHDISL+LQ  VEELD VERAFVHVDYL R+YDEHKD TIRRDS+
Sbjct  338  VREAHDISLSLQKAVEELDTVERAFVHVDYLPRDYDEHKDTTIRRDSS  385

>PYAR_24297
Length=386

 Score = 332 bits (852),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 244/349 (70%), Gaps = 11/349 (3%)

Query  27   LTPTQSDSKVAERYHRSQVSHAFLLKKE--ETQHLAASSLGSTLPVLAAINASLSANVTL  84
            L    + +K + R  RSQV+HA L  +   E QH+A ++   +  V  AI ASL  NV L
Sbjct  45   LRDADAGNKGSRRDRRSQVAHALLRNQSATELQHMAPAA---SAKVQTAIRASLVINVIL  101

Query  85   ALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEPIAVI  144
            A+ K YAA+ S SLAVLSSLVDSILDLTSQ LFWYSDKHMHTP+V YPAGRRRLEPIAV+
Sbjct  102  AVAKTYAAFASGSLAVLSSLVDSILDLTSQWLFWYSDKHMHTPNVNYPAGRRRLEPIAVV  161

Query  145  VSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAMVRVPRCYL-LPDARLRS  203
            +SATLMGMA        Q +    +  ++G     D +     V V    + L    + +
Sbjct  162  ISATLMGMAAI---EVVQKSIETLVTGYNGSLPDLDMTPLTIGVLVFAIAIKLVLWSICA  218

Query  204  RHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSW  263
            R  I+  +       QDHRNDVFSN++A+  +   H     WY DS+GA+ ISVYI  SW
Sbjct  219  R--IAANSSSADALAQDHRNDVFSNSVAVTTSLIAHYRRDLWYTDSLGAIAISVYIGFSW  276

Query  264  LATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPED  323
            LATGKEQVERL+GL A  +FI++IR L D+HHP+M++DIVRAYHFGNNYLVE+EVILP  
Sbjct  277  LATGKEQVERLIGLGAEPDFIERIRALVDLHHPLMQSDIVRAYHFGNNYLVELEVILPAT  336

Query  324  MCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDS  372
            MCV++AHDISL LQ+KVEELDNVERAFVHVDYL R+YDEHKDPTIRRDS
Sbjct  337  MCVREAHDISLALQNKVEELDNVERAFVHVDYLARDYDEHKDPTIRRDS  385

>PYAP_16572
Length=413

 Score = 333 bits (854),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 202/354 (57%), Positives = 244/354 (69%), Gaps = 23/354 (6%)

Query  37   AERYHRSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSANVT-------------  83
            A R  RSQV+HA L K+ +T+ L + +  ++  V  AI ASL  NV              
Sbjct  65   ARRNRRSQVAHALLHKQSDTE-LQSMAPATSAKVQTAIRASLVINVVRDRDTADDESKGC  123

Query  84   ---LALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEP  140
               LA+ K YAA  S SLAVLSSLVDSILDLTSQ LFWYSDKHMHTP+V YPAGRRRLEP
Sbjct  124  DDILAIAKTYAAIASGSLAVLSSLVDSILDLTSQWLFWYSDKHMHTPNVNYPAGRRRLEP  183

Query  141  IAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAMVRV-PRCYLLPDA  199
            IA+I+SATLMGMA        Q +    +    G     D +     V +   C  +   
Sbjct  184  IALIISATLMGMAAI---EVVQKSIETLVSGFAGSLPDLDMTPFTVGVLLFAICIKIVLW  240

Query  200  RLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYI  259
             + +R  IS  +       QDHRNDVFSNT+A+  +  +H     WY+DSIGA+ ISVYI
Sbjct  241  WICAR--ISTNSSSADALAQDHRNDVFSNTVAVSTSLLSHWKRDLWYVDSIGAIAISVYI  298

Query  260  AVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVI  319
            A SWLATGKEQVERL+GL+A  +FI+QIR L D+HHP+M++DI+RAYHFGNNYLVE+EVI
Sbjct  299  AFSWLATGKEQVERLIGLRADPDFIEQIRELTDLHHPLMKSDIIRAYHFGNNYLVELEVI  358

Query  320  LPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
            LP DMCV++AHDISL LQ+KVEELDNVERAFVHVDYL R+YDEHKDPT+RRDS+
Sbjct  359  LPADMCVREAHDISLALQNKVEELDNVERAFVHVDYLSRDYDEHKDPTLRRDSS  412

>PHYSO_471886
Length=246

 Score = 327 bits (837),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 193/249 (78%), Gaps = 4/249 (2%)

Query  124  MHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQ  183
            MHTPSV+YPAGRRRLEPIAVI+SATLMGMA      Q   A  +  + H  R     +  
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQ-RVLEISNFT  59

Query  184  ARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSS  243
               ++      L   A      +I+  +       QDHRNDVFSNT+A+ AAFA H HSS
Sbjct  60   MVVLLVAMVVKL---ALWYVCAKIASHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSS  116

Query  244  FWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIV  303
             WYLDS+GA+VISVYIAVSWLATGKEQVERLVGLQA QEFIDQIRLLGDVHHPMMRTDIV
Sbjct  117  LWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIV  176

Query  304  RAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            RAYHFGNNYLVEMEVILPEDMCVKDAHDISL+LQ KVEELDNVERAFVHVDYLERNYDEH
Sbjct  177  RAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEH  236

Query  364  KDPTIRRDS  372
            KDPTIRRDS
Sbjct  237  KDPTIRRDS  245

>PITG_20313
Length=246

 Score = 322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 193/251 (77%), Gaps = 8/251 (3%)

Query  124  MHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQ  183
            MHTPSV+YPAGRRRLEPIAVI+SATLMGMA      Q   A  + L  H         + 
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGLKGHQRELEITSFTV  60

Query  184  ARAMVRVPRCYLL--PDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCH  241
               +V +    LL    A++ S H  S          QDHRNDVFSN +A+ AAFA H H
Sbjct  61   IVLLVAIVVKLLLWYICAKIAS-HSPSADA-----LAQDHRNDVFSNFVAVAAAFAAHWH  114

Query  242  SSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTD  301
            SS WYLDS+GA+VISVYIAVSWLATGKEQVERLVGLQA QEFIDQIR+LGDVHHPMMRTD
Sbjct  115  SSLWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRVLGDVHHPMMRTD  174

Query  302  IVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYD  361
            IVRAYHFGNNYLVEMEVILPEDMCVKDAHDISL+LQ KVE LDNVERAFVHVDYLERNYD
Sbjct  175  IVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYD  234

Query  362  EHKDPTIRRDS  372
            EHKDPT+RRDS
Sbjct  235  EHKDPTVRRDS  245

>PITG_20630
Length=246

 Score = 322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 193/251 (77%), Gaps = 8/251 (3%)

Query  124  MHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQ  183
            MHTPSV+YPAGRRRLEPIAVI+SATLMGMA      Q   A    L  H         + 
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVEGLKGHQRELEITSFTV  60

Query  184  ARAMVRVPRCYLL--PDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCH  241
               +V +    LL    A++ S H  S          QDHRNDVFSN++A+ AAFA H H
Sbjct  61   IVLLVAIVVKLLLWYICAKIAS-HSPSADA-----LAQDHRNDVFSNSVAVAAAFAAHWH  114

Query  242  SSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTD  301
            SS WYLDS+GA+VISVYIAVSWLATGKEQVERLVGLQA QEFIDQIR+LGDVHHPMMRTD
Sbjct  115  SSLWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRVLGDVHHPMMRTD  174

Query  302  IVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYD  361
            IVRAYHFGNNYLVEMEVILPEDMCVKDAHDISL+LQ KVE LDNVERAFVHVDYLERNYD
Sbjct  175  IVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYD  234

Query  362  EHKDPTIRRDS  372
            EHKDPT+RRDS
Sbjct  235  EHKDPTVRRDS  245

>H257_07371
Length=351

 Score = 313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 240/356 (67%), Gaps = 18/356 (5%)

Query  22   YGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSAN  81
            YG+++L   ++  + + +  RS V+H+ +L++E  +        S   V  AI +S+  N
Sbjct  8    YGAVSLDIKKAH-ETSNKPARSAVAHSLILQQEAGEARCIPEAASQ-KVQLAITSSIIIN  65

Query  82   VTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEPI  141
            V LA+ K YAA TS SLAVLSSLVDSILDLTSQ LFW+SD++MHTP+ +YPAGRRRLEPI
Sbjct  66   VILAIAKTYAAITSGSLAVLSSLVDSILDLTSQGLFWFSDRYMHTPNAKYPAGRRRLEPI  125

Query  142  AVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAMVRVPRCYLLPDARL  201
            AV+VSATLMGMA        Q +    ++   G+    D S       +P   +L  A +
Sbjct  126  AVVVSATLMGMAAL---EVVQKSVTTLIEGFGGQLPELDMS-------IPTVAVLGIAII  175

Query  202  RSRH------QISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVI  255
                      QI+  +       QDHRNDVFSN +A+  +   H +S  WY D IGA+ I
Sbjct  176  VKLMLWFLCGQIAYVSPSAAALAQDHRNDVFSNAVAVTTSLVAHYNSELWYFDPIGAIAI  235

Query  256  SVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVE  315
            S+YI +SW+ATGKEQVERLVGLQA Q+FID++R + D HHP +++DI+RAYHFGNN+LVE
Sbjct  236  SIYITLSWVATGKEQVERLVGLQADQDFIDRVRTIADAHHPKLQSDIIRAYHFGNNFLVE  295

Query  316  MEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRD  371
            +EV+LP+DM V+++HDISL LQ KVE LD VERAFVHVDY  R+YDEHKDPT R D
Sbjct  296  LEVVLPKDMSVQESHDISLALQIKVEALDEVERAFVHVDYQSRDYDEHKDPTARLD  351

>H310_07576
Length=351

 Score = 310 bits (794),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 240/355 (68%), Gaps = 16/355 (5%)

Query  22   YGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSAN  81
            YG+++L   ++  + + ++ RS VSH+ +L++E  +        S   V  AI +S+  N
Sbjct  8    YGAVSLDIKKAH-EASTKHTRSAVSHSLILQQEAGEARCLPEAASQ-KVQLAITSSIVIN  65

Query  82   VTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEPI  141
            V LA+ K YAA +S SLAVLSSLVDSILDLTSQALFW+SD++MHTP+ +YPAGRRRLEPI
Sbjct  66   VLLAIAKTYAAVSSGSLAVLSSLVDSILDLTSQALFWFSDRYMHTPNEKYPAGRRRLEPI  125

Query  142  AVIVSATLMGMAGSCRGAQWQAAR-----GRHLDFHDGRAARCDSSQARAMVRVPRCYLL  196
            AV+VSATLMGMA S    Q          G HL   D              V++   ++ 
Sbjct  126  AVVVSATLMGMA-SLEVVQKSVTTLIEGFGGHLPELDMSILTIAVLGVAITVKLMLWFIC  184

Query  197  PDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVIS  256
                     QI+  +       QDHRNDVFSN +A+  +   H +S  WY D IGA+ IS
Sbjct  185  G--------QIAYVSPSAAALAQDHRNDVFSNLVAVSTSLMAHYYSGLWYFDPIGAIAIS  236

Query  257  VYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEM  316
            +YI +SW+ATGKEQVERLVGLQA ++FI+++R + D HHP +++DI+RAYHFGNN+LVE+
Sbjct  237  IYITLSWVATGKEQVERLVGLQADEDFIERVRAIADAHHPKLQSDIIRAYHFGNNFLVEL  296

Query  317  EVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRD  371
            EV+LP+DM V+++HDISL LQ KVE LD VERAFVHVDY  R+YDEHKDPT+R D
Sbjct  297  EVVLPKDMSVQESHDISLALQIKVEALDEVERAFVHVDYQSRDYDEHKDPTVRLD  351

>CCA18901
Length=373

 Score = 310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 232/335 (69%), Gaps = 11/335 (3%)

Query  42   RSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSANVTLALVKIYAAWtsnslavl  101
            RSQ++H+ L+ K+  + +      ++  V + I ASL AN+ LA  K+YAA  S SLAVL
Sbjct  45   RSQIAHS-LIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKLYAAINSGSLAVL  103

Query  102  sslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQW  161
            SSLVDSILDLTSQ LFW+SDK MHTPS +YPAGRRRLEPI VI+SATLMGMA        
Sbjct  104  SSLVDSILDLTSQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAAL---EVI  160

Query  162  QAARGRHLDFHDGRAARCDSSQ---ARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCL  218
            Q A    +  ++G       +Q   A  +  +    +L     R    I +T+       
Sbjct  161  QKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFR----IGLTSPTARAIA  216

Query  219  QDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQ  278
            QDHRNDV SN+ A++ +     H++ WY+DS+GA++IS+YIA+SWLATG EQV+RLVGLQ
Sbjct  217  QDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQ  276

Query  279  ATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQH  338
            A   FID++R   + HHP M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDISL+LQ 
Sbjct  277  ADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQR  336

Query  339  KVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
            K+EE DNVERAFVHVDYL R YDEHKDPT+RR ++
Sbjct  337  KIEEFDNVERAFVHVDYLARGYDEHKDPTLRRSTS  371

>CCI45129
Length=372

 Score = 307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 235/341 (69%), Gaps = 23/341 (7%)

Query  42   RSQVSHAFLLKK--EETQHLAASSLGSTLPVLAAINASLSANVTLALVKIYAAWtsnsla  99
            RSQ++H+ + K+  EE Q + A++   +  V + I AS  AN+ LA  K+YAA +S SL+
Sbjct  44   RSQIAHSLIHKQNGEEVQMIPAAT---SRHVGSIIRASFIANILLACGKLYAAISSGSLS  100

Query  100  vlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGA  159
            VLSSLVDSILDLTSQ LFW+SDK MHTPS  YPAGRRRLEPIAVI+SATLMGMA      
Sbjct  101  VLSSLVDSILDLTSQGLFWFSDKRMHTPSSRYPAGRRRLEPIAVIISATLMGMAAL---E  157

Query  160  QWQAARGRHLDFHDGRAARCDSSQARAMV-------RVPRCYLLPDARLRSRHQISVTND  212
              Q A    +  ++G     + +Q    V       +    YL         ++I +T+ 
Sbjct  158  VIQKAVETLIIGYEGTLPSINMTQLTIAVLLFAISTKTILWYLC--------YRIGLTSP  209

Query  213  FGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVE  272
                  QDHRNDV SN  A++ +  T  H + WY+DS+GA++IS+YIA+SWLATG EQV+
Sbjct  210  TAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDSVGAILISLYIAISWLATGSEQVQ  269

Query  273  RLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDI  332
            RLVGLQA   FI+++R   + HHP M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDI
Sbjct  270  RLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDI  329

Query  333  SLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
            SL+LQ K+EE D+VERAFVHVDYL R YDEHKDPT+RR ++
Sbjct  330  SLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPTLRRSTS  370

>SDRG_05001
Length=346

 Score = 305 bits (781),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 239/360 (66%), Gaps = 25/360 (7%)

Query  21   DYGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSA  80
            DYGS+ L   Q      +R  RS V+H+ LL +++   +      ++  V  AI+AS+  
Sbjct  5    DYGSVALDIKQ------DRPARSAVAHS-LLHQQDANEVRCLPQATSQRVQLAISASIVI  57

Query  81   NVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEP  140
            N+ LA+ K YAA  S SLAVLSSLVDSILDLTSQ LFW++D++MHTPS +YPAGRRRLEP
Sbjct  58   NIILAIAKTYAAVVSGSLAVLSSLVDSILDLTSQGLFWFTDRYMHTPSPDYPAGRRRLEP  117

Query  141  IAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSS-------QARAMVRVPRC  193
            IAV+VSATLMGMA S    Q   A    ++  +G     D S           +V++   
Sbjct  118  IAVVVSATLMGMA-SLEVVQKSIAT--LIEGFNGHVPELDMSILTIAVLAVAIVVKLILW  174

Query  194  YLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAV  253
            +L          QI+  +       QDHRNDVFSN +A+  +   H +   WYLD IGA+
Sbjct  175  FLCA--------QIAHVSPSAAALAQDHRNDVFSNGVAVTTSMIAHYNIDAWYLDPIGAI  226

Query  254  VISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYL  313
             IS+YI  SWL TGKEQV+RLVG+QA ++FI +I  + D HHP M++DIVRAYHFGNN+L
Sbjct  227  CISIYITWSWLETGKEQVDRLVGIQADEDFIQRIHAIADSHHPDMQSDIVRAYHFGNNFL  286

Query  314  VEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
            VE+EV++P+ M V DAHDISL LQ KVEELD VERAFVHVDY  R+YDEHKDPTIR+DS+
Sbjct  287  VELEVVMPKSMTVGDAHDISLALQKKVEELDAVERAFVHVDYESRDYDEHKDPTIRKDSS  346

>SPRG_12487
Length=346

 Score = 304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 236/358 (66%), Gaps = 21/358 (6%)

Query  21   DYGSLTLTPTQSDSKVAERYHRSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSA  80
            +YGS+ L   Q      +R  RS V+H+ LL +++   +      ++  V  AI+AS+  
Sbjct  5    EYGSVALDIKQ------DRPARSAVAHS-LLHQQDANEVRCLPQATSQRVQLAISASIVI  57

Query  81   NVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPSVEYPAGRRRLEP  140
            N+ LA+ K YAA  S SLAVLSSLVDSILDLTSQ LFW++D++MHTPS +YPAGRRRLEP
Sbjct  58   NIILAIAKTYAAVVSGSLAVLSSLVDSILDLTSQGLFWFTDRYMHTPSPDYPAGRRRLEP  117

Query  141  IAVIVSATLMGMAGSCRGAQWQAAR-----GRHLDFHDGRAARCDSSQARAMVRVPRCYL  195
            IAV+VSATLMGMA S    Q   A        HL   D             +V++   +L
Sbjct  118  IAVVVSATLMGMA-SLEVVQKSIATLIEGFNGHLPELDMSILTIAVLAIAIVVKLILWFL  176

Query  196  LPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVI  255
                      QI+  +       QDHRNDVFSN +A+  +   H +   WYLD IGA+ I
Sbjct  177  CA--------QIAHVSPSAAALAQDHRNDVFSNAVAVTTSMIAHYNVEMWYLDPIGAICI  228

Query  256  SVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVE  315
            S+YI  SWL TGKEQV+RLVG+QA ++FI +I  + D HHP M++DIVRAYHFGNN+LVE
Sbjct  229  SIYITWSWLETGKEQVDRLVGIQADEDFIARIDGIADTHHPDMQSDIVRAYHFGNNFLVE  288

Query  316  MEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373
            +EVI+P+ M V DAHDISL LQ KVEELD VERAFVHVDY  R+YDEHKDPTIR+DS+
Sbjct  289  LEVIMPKSMTVGDAHDISLALQKKVEELDAVERAFVHVDYESRDYDEHKDPTIRKDSS  346

>CCI45130
Length=248

 Score = 272 bits (696),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 175/257 (68%), Gaps = 18/257 (7%)

Query  124  MHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQ  183
            MHTPS  YPAGRRRLEPIAVI+SATLMGMA        Q A    +  ++G     + +Q
Sbjct  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAAL---EVIQKAVETLIIGYEGTLPSINMTQ  57

Query  184  ARAMV-------RVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAF  236
                V       +    YL         ++I +T+       QDHRNDV SN  A++ + 
Sbjct  58   LTIAVLLFAISTKTILWYLC--------YRIGLTSPTAKALAQDHRNDVLSNIAAVITSL  109

Query  237  ATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHP  296
             T  H + WY+DS+GA++IS+YIA+SWLATG EQV+RLVGLQA   FI+++R   + HHP
Sbjct  110  TTKVHENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHP  169

Query  297  MMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYL  356
             M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDISL+LQ K+EE D+VERAFVHVDYL
Sbjct  170  QMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYL  229

Query  357  ERNYDEHKDPTIRRDSA  373
             R YDEHKDPT+RR ++
Sbjct  230  ARGYDEHKDPTLRRSTS  246

>CCI45128
Length=1831

 Score = 290 bits (743),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 183/267 (69%), Gaps = 18/267 (7%)

Query  114   QALFWYSDKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHD  173
             Q LFW+SDK MHTPS  YPAGRRRLEPIAVI+SATLMGMA        Q A    +  ++
Sbjct  1574  QGLFWFSDKRMHTPSSRYPAGRRRLEPIAVIISATLMGMAAL---EVIQKAVETLIIGYE  1630

Query  174   GRAARCDSSQARAMV-------RVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVF  226
             G     + +Q    V       +    YL         ++I +T+       QDHRNDV 
Sbjct  1631  GTLPSINMTQLTIAVLLFAISTKTILWYLC--------YRIGLTSPTAKALAQDHRNDVL  1682

Query  227   SNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQ  286
             SN  A++ +  T  H + WY+DS+GA++IS+YIA+SWLATG EQV+RLVGLQA   FI++
Sbjct  1683  SNIAAVITSLTTKVHENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEK  1742

Query  287   IRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNV  346
             +R   + HHP M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDISL+LQ K+EE D+V
Sbjct  1743  LRDFTNNHHPQMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSV  1802

Query  347   ERAFVHVDYLERNYDEHKDPTIRRDSA  373
             ERAFVHVDYL R YDEHKDPT+RR ++
Sbjct  1803  ERAFVHVDYLARGYDEHKDPTLRRSTS  1829

>PYU1_G008337
Length=414

 Score = 196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/298 (41%), Positives = 175/298 (59%), Gaps = 7/298 (2%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V   + +SL  N+ + LV    A  S+SLA+LS+LV++++DL  Q L WY+         
Sbjct  65   VAMVLKSSLITNICIVLVMTSVAIASHSLALLSALVENMVDLFVQGLLWYAGTRSGKKQD  124

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLD-FHDGRAARCDSSQARA  186
              +YPAG  R EP+A+IV+A++M +         Q    + +D F  G+      S A  
Sbjct  125  YAKYPAGTSRFEPVAIIVAASIMVLVSVVF---IQEGVTKLVDGFAHGQPEAPKLSAAAV  181

Query  187  MVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQD-HRNDVFSNTIAIVAAFATHCHSSFW  245
            ++      +       SR  +  T    +  +QD +RND  SN  AI+A   +      W
Sbjct  182  VIVTLAVLVKIGLIFYSRWVLKFTFSASVEAIQDDNRNDTISNAFAIIAYIISSVDEGLW  241

Query  246  YLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRA  305
            Y+D  GA++I ++I  +W   GKEQV +LVG+ A++EF+ +++ L   HHP M  DI+RA
Sbjct  242  YVDPAGAILIFLFIMFAWGKMGKEQVAQLVGVCASEEFMTEVKELCASHHPSMSLDIMRA  301

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            YHFG+ YLVE+EV++P DM VK AHDI+L LQ KVE L++VERAFVHVDY  R+YDEH
Sbjct  302  YHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKSRDYDEH  359

>PYU1_G008336
Length=406

 Score = 192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/298 (41%), Positives = 172/298 (58%), Gaps = 7/298 (2%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V   + +SL  N+ + LV    A  S SLA+LS+LV++++DL  Q L WY+         
Sbjct  49   VAMVLKSSLITNICIVLVMTSVAIGSRSLALLSTLVENMVDLFVQGLLWYAGTRSGKKQD  108

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLD-FHDGRAARCDSSQARA  186
              +YPAG  R EP+A+IV++++M +         Q    + +D F  G       S    
Sbjct  109  YAKYPAGTSRFEPVAIIVASSIMVLVSVTF---IQEGVTKLVDGFAHGNPESPKLSTIAI  165

Query  187  MVRVPRCYLLPDARLRSRHQISVTNDFGLHCL-QDHRNDVFSNTIAIVAAFATHCHSSFW  245
            ++      +       S   I  T     H +  D+RNDV SN+ AI A   +      W
Sbjct  166  VLSSTIVVIKIGLVAYSYWTIKRTYSAAAHAIGDDNRNDVVSNSFAICAYIISSSDEDLW  225

Query  246  YLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRA  305
            Y+D++GA+VI + I  +W   GKEQV +LVG+ A++EF+ +++ L   HHP M  DI+RA
Sbjct  226  YVDALGAIVIFLLIMFAWAKMGKEQVAQLVGVSASEEFMTEVKELCASHHPTMSLDIMRA  285

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            YHFG+ YLVE+EV++P DM VK AHDI+L LQ KVE L++VERAFVHVDY  R+YDEH
Sbjct  286  YHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKSRDYDEH  343

>PYIR_23853
Length=420

 Score = 189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/254 (41%), Positives = 148/254 (58%), Gaps = 7/254 (3%)

Query  114  QALFWYSDKHMHTPS--VEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDF  171
            Q L WY+           +YPAG  R EP+A+IV++++M +         Q    + +D 
Sbjct  108  QGLLWYAGTRSGKKQDYAKYPAGTSRFEPVAIIVASSIMVLVSVVF---IQEGVTKLVDG  164

Query  172  HDGRAARCDSSQARAMVRVPRCYLLPDARL-RSRHQISVTNDFGLHCLQD-HRNDVFSNT  229
                        A A++ V    L+    +  SR  ++ T    +  +QD +RND  SN 
Sbjct  165  LAHGQPEAPKLSATAVIIVCLAVLVKIGLIFYSRWVLTFTYSASVEAIQDDNRNDTISNA  224

Query  230  IAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRL  289
             AI+A   +      WY+D  GA++I ++I  +W   GKEQV +LVG+ A++EF+ +++ 
Sbjct  225  FAIIAYIISSVDEDLWYVDPAGAILIFLFIMFAWGKMGKEQVAQLVGVCASKEFMAEVKE  284

Query  290  LGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERA  349
            L   HHP M  DI+RAYHFG+ YLVE+EV++P DM VK AHDI+L LQ KVE L++VERA
Sbjct  285  LCSHHHPSMALDIIRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERA  344

Query  350  FVHVDYLERNYDEH  363
            FVHVDY  R+YDEH
Sbjct  345  FVHVDYKARDYDEH  358

>SDRG_12928
Length=341

 Score = 187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 145/253 (57%), Gaps = 5/253 (2%)

Query  114  QALFWYSD-KHMHTPSV-EYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDF  171
            Q L WY++ +  + P + ++PAG  R EPI V++SAT+M +        ++++   H  F
Sbjct  50   QGLLWYANYQASNAPDMAKFPAGTSRFEPILVVLSATIMSVISVI--VIYESSMRLHDGF  107

Query  172  HDGRAARCDSSQARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQ-DHRNDVFSNTI  230
              G       S    ++      +     + +   + +T    +  +Q D+ ND  SN  
Sbjct  108  ASGEPDGAVMSTTAIVICSCAVAIKIGLVIYAGFALRITQSSSVKAIQQDNINDTVSNAF  167

Query  231  AIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLL  290
            AI+         S WY+D  GA++I + I V W+ T KEQV +LVG+ A+ +FID ++ L
Sbjct  168  AIIVYAIAASDPSLWYIDPAGAILIFLAILVIWVRTAKEQVLQLVGVSASPDFIDVVKEL  227

Query  291  GDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAF  350
             D HH     DI+RAYHFGN YLVE+EV+ P  M VK AHDISL LQ K+E+LD+VERAF
Sbjct  228  CDNHHASFALDIIRAYHFGNKYLVELEVVAPATMTVKQAHDISLQLQFKIEQLDDVERAF  287

Query  351  VHVDYLERNYDEH  363
            VHVDY  R YDEH
Sbjct  288  VHVDYQTRAYDEH  300

>PYVX_16559
Length=376

 Score = 188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 173/296 (58%), Gaps = 15/296 (5%)

Query  74   INASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS--VEY  131
            +  SL  NVT+ L     A+ + SLA+LS+LV++++DL  Q L WY+           +Y
Sbjct  23   LKTSLGLNVTIVLTMAAVAFAAGSLALLSALVENMIDLFVQGLLWYAGTRSGKKQDYAKY  82

Query  132  PAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQ----ARAM  187
            PAG  R EP+A+IV+A++M +        +    G      D  A    ++     + A+
Sbjct  83   PAGTSRFEPVAIIVAASIMVLVAVF----FIQESGXXXXXDDFEAPDLSAAAIVIVSLAV  138

Query  188  VRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYL  247
            V            L+S +  +V     +H  QD+ ND  SN+IA++A        S WY+
Sbjct  139  VSKIGLIFYSGWILKSTYSAAVE---AIH--QDNINDTMSNSIAVIAYIIAAVKPSAWYV  193

Query  248  DSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYH  307
            D  GA++I VYI  SW    KEQV++LVG+ A +EFI +++ L   HHP+M  DIVRAYH
Sbjct  194  DPAGAMLIFVYIMYSWGKMAKEQVQQLVGVSADEEFIQEVKDLCARHHPLMALDIVRAYH  253

Query  308  FGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            FGN YLVE+EV++P DM VK AHDI+L LQ KVE L+ VERAFVHVDY  R+YDEH
Sbjct  254  FGNKYLVELEVVVPGDMSVKMAHDIALQLQFKVENLEPVERAFVHVDYRSRDYDEH  309

>SPRG_06805
Length=341

 Score = 185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/255 (41%), Positives = 147/255 (58%), Gaps = 9/255 (4%)

Query  114  QALFWYSD-KHMHTPSV-EYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDF  171
            Q L WY++ +  + P + ++PAG  R EPI V++SAT+M +        ++++   H  F
Sbjct  50   QGLLWYANYQASNAPDMAKFPAGTSRFEPILVVLSATIMSVISVI--VIYESSMRLHDGF  107

Query  172  HDGRAARCDSSQARAMVRVPRCYLLPDARL--RSRHQISVTNDFGLHCLQ-DHRNDVFSN  228
              G       S A   + +  C +     L   +   + +T    +  +Q D+ ND  SN
Sbjct  108  ASGEPDVAVMSTAA--IAICSCAIAIKVGLVIYAGFALRLTQSSSVKAIQQDNINDTVSN  165

Query  229  TIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIR  288
              AIV         S WY+D  GA++I + I V W+ T KEQV +LVG+ A+ +FID ++
Sbjct  166  AFAIVVYVIAASDPSLWYIDPAGAILIFLAILVIWVRTAKEQVLQLVGVSASPDFIDVVK  225

Query  289  LLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVER  348
             L + HH     DI+RAYHFGN YLVE+EV+ P  M VK AHDISL LQ K+E+L++VER
Sbjct  226  ELCENHHASFALDIIRAYHFGNKYLVELEVVAPATMTVKQAHDISLQLQFKIEQLEDVER  285

Query  349  AFVHVDYLERNYDEH  363
            AFVHVDY  R YDEH
Sbjct  286  AFVHVDYQTRAYDEH  300

>PYVX_16542
Length=388

 Score = 186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 175/297 (59%), Gaps = 13/297 (4%)

Query  74   INASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS--VEY  131
            + ASL  N+ + L     A  S+SLA+LS+LV++++DL  Q L WY+           +Y
Sbjct  25   LKASLGTNIVIVLTMATVAIASHSLALLSALVENMVDLFVQGLLWYAGTRSGKKQDYAKY  84

Query  132  PAGRRRLEPIAVIVSATLMGMAGS--CRGAQWQAARGR-HLDFH--DGRAARCDSSQARA  186
            PAG  R EP+A+IV+A++M +A     + +  +   G  H DF   D   A         
Sbjct  85   PAGTSRFEPVAIIVAASIMVLAAVYFIQESVTKIFNGLVHDDFEAPDLSVAAIVIVVLAV  144

Query  187  MVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWY  246
            + ++   +      L+S    +V     +H  QD+ ND  SN+IAI A        S WY
Sbjct  145  VTKIGLVFY-SGWILKSTFSAAVE---AIH--QDNINDTMSNSIAIAAYIVAAVKPSAWY  198

Query  247  LDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAY  306
            +D  GA++I VYI  SW    KEQV++LVG+ A +EFI +++ L   HHP+M  DIVRAY
Sbjct  199  VDPAGAMLIFVYIMYSWGKMAKEQVQQLVGVSADEEFIQEVKDLCARHHPLMALDIVRAY  258

Query  307  HFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            HFGN YLVE+EV++P DM VK AHDI+L LQ KVE LD VERAFVHVDY  R+YDEH
Sbjct  259  HFGNKYLVELEVVVPGDMSVKMAHDIALQLQFKVENLDQVERAFVHVDYQSRDYDEH  315

>PHYCA_533347
Length=417

 Score = 184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 148/253 (58%), Gaps = 5/253 (2%)

Query  114  QALFWYSDKHMHTPS--VEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDF  171
            Q L WY+           +YPAG  R EP+A+IV+A++M +A S    Q ++AR     F
Sbjct  94   QGLLWYAGTRSGKKQDYAKYPAGTSRFEPVAIIVAASVMVLA-SIVFIQ-ESARKLIDGF  151

Query  172  HDGRAARCDSSQARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCL-QDHRNDVFSNTI  230
              G       S A  ++ V    +     + S   +  T    +  + QD+ ND  SN+ 
Sbjct  152  TSGEPEAPSLSTAAIVIVVTAVIVKIGLMIYSAWILKSTFSAAVEAIHQDNLNDTISNSF  211

Query  231  AIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLL  290
            AI A       S  WY+D  GA++I +YI VSW     EQV +LVG+ A+++F+ Q++ L
Sbjct  212  AIAAYIVAAVESEAWYVDPAGAILIFIYIMVSWGKMAWEQVTQLVGVCASEDFVLQVKEL  271

Query  291  GDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAF  350
               HHP M  DIVRAYHFG+ YLVE+EV++P +M VKDAHDI+L LQ KVE LD VERAF
Sbjct  272  SRHHHPSMTLDIVRAYHFGSKYLVELEVVVPAEMSVKDAHDIALQLQFKVENLDEVERAF  331

Query  351  VHVDYLERNYDEH  363
            VHVDY  R+YDEH
Sbjct  332  VHVDYQSRDYDEH  344

>PPTG_17622
Length=395

 Score = 182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 119/298 (40%), Positives = 175/298 (59%), Gaps = 7/298 (2%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V   + ASL+ N+ + +V    A  SNSLA++S+LV++++DL  Q L WY+         
Sbjct  40   VAVVLKASLTTNIVIVIVMTSVAIASNSLALISALVENMVDLFVQGLLWYAGTRSGKKQD  99

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSC--RGAQWQAARGRHLDFHDGRAARCDSSQAR  185
              +YPAG  R EP+A+IV+A++M +A       A  +   G   D  +       +    
Sbjct  100  YAKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAAQKLVDGFSSDEPEAPNLSAAAIAIA  159

Query  186  AMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFW  245
                V +  L+  +    +  +SV  +  +H  QD+ ND+ SN+ A+ A          W
Sbjct  160  VTAVVVKIGLMFYSAWILKSTVSVAVE-AIH--QDNFNDMLSNSFAVAAYIVAAVEPKAW  216

Query  246  YLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRA  305
            Y+D  GA++I VYI V+W     EQ+ +LVG+ A++EFI++++ L   HHP M  DIVRA
Sbjct  217  YVDPAGAIIIFVYIMVAWGKMAWEQITQLVGVCASEEFIEEVKELCSRHHPSMELDIVRA  276

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            YHFG+ YLVE+EV++P +M VK AHDI+L +Q KVE L+ VERAFVHVDY  R+YDEH
Sbjct  277  YHFGSKYLVELEVVVPGEMSVKLAHDIALQVQFKVENLEEVERAFVHVDYQARDYDEH  334

>PHYCA_543819
Length=446

 Score = 183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/298 (41%), Positives = 176/298 (59%), Gaps = 7/298 (2%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V   + ASL+ N+ + +V    A  SNSLA++S+LV++++DL  Q L WY+         
Sbjct  91   VAVVLKASLTTNIIIVIVMTSVAIASNSLALISALVENMVDLFVQGLLWYAGTRSGKKQD  150

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSC--RGAQWQAARGRHLDFHDGRAARCDSSQAR  185
              +YPAG  R EP+A+IV+A++M +A       A  +   G   D  +       +    
Sbjct  151  YAKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAVQKLIDGFSSDEPEAPNLSAAAIAIA  210

Query  186  AMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFW  245
                V +  L+  +    +  +SV  +  +H  QD+ ND+ SN+ A+ A          W
Sbjct  211  VTAVVVKIGLMFYSAWILKSTVSVAVE-AIH--QDNFNDMLSNSFAVAAYIVAAVEPKAW  267

Query  246  YLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRA  305
            Y+D  GA++I VYI VSW     EQV +LVG+ A++EFI +++ L + HHP M+ DIVRA
Sbjct  268  YVDPAGAIIIFVYIMVSWGKMAWEQVTQLVGVCASEEFIGEVKDLCNRHHPSMKLDIVRA  327

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            YHFG+ YLVE+EV++P +M VK AHDI+L +Q KVE L+ VERAFVHVDY  R+YDEH
Sbjct  328  YHFGSKYLVELEVVVPGEMSVKLAHDIALQMQFKVENLEEVERAFVHVDYQSRDYDEH  385

>PHYRA_83397
Length=384

 Score = 181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/298 (40%), Positives = 177/298 (59%), Gaps = 7/298 (2%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V   + ASLS N+ + ++    A +SNSLA++S+LV++++DL  Q L WY+         
Sbjct  29   VAVVLKASLSTNIIIVIIMTSVAISSNSLALISALVENMVDLFVQGLLWYAGTRSGKKQD  88

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSC--RGAQWQAARGRHLDFHDGRAARCDSSQAR  185
              +YPAG  R EP+A+IV+A++M +A       A  + A G   D  +       +    
Sbjct  89   YAKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAVVKLADGFSSDEPEAPNLSAAAIAIA  148

Query  186  AMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFW  245
                V +  L+  +    +  +S   +  +H  QD+ ND+ SN+ A+ A       S  W
Sbjct  149  VTAVVVKIGLMFYSAWILKTTVSAAVE-AIH--QDNFNDMLSNSFAVAAYIVAAVESEAW  205

Query  246  YLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRA  305
            Y+D  GA++I VYI V+W     EQ+ +LVG+ A ++FI++++ L   HHP M  DIVRA
Sbjct  206  YVDPAGAIIIFVYIMVAWGKMAWEQITQLVGVCANEDFIEEVKELCRQHHPSMELDIVRA  265

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            YHFG+ YLVE+EV++P +M VK AHDI+L +Q KVE+L+ VERAFVHVDY  R+YDEH
Sbjct  266  YHFGSKYLVELEVVVPGEMSVKLAHDIALQMQFKVEKLEEVERAFVHVDYQARDYDEH  323

>PHYRA_96593
Length=613

 Score = 186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 176/297 (59%), Gaps = 5/297 (2%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V   + ASLS N+ + +     A  S+SLA++S+LV++++DL  Q L WY+         
Sbjct  281  VAVVLKASLSTNIIIVISMTSIAIASHSLALISALVENMVDLFVQGLLWYAGTRSGKKQD  340

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAM  187
              +YPAG  R EP+A+IV+A++M +A S    Q ++AR     F  G       S A  +
Sbjct  341  YAKYPAGTSRFEPVAIIVAASVMVLA-SIVFIQ-ESARKLIDGFTSGEPEAPILSTAAIV  398

Query  188  VRVPRCYLLPDARLRSRHQISVTNDFGLHCL-QDHRNDVFSNTIAIVAAFATHCHSSFWY  246
            + V    +     L S   +  T    +  + QD+ ND  SN+ A+ A   +   S  WY
Sbjct  399  IVVMAVVVKIGLMLYSAWILKSTFSAAVEAIHQDNLNDTISNSFAVAAYIVSAVESEAWY  458

Query  247  LDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAY  306
            +D  GA++I +YI VSW     EQV +LVG+ A+++F+ +++ L   HHP M  DIVRAY
Sbjct  459  VDPAGAILIFLYIMVSWGKMAWEQVTQLVGVCASEDFVQEVKELCSHHHPSMVLDIVRAY  518

Query  307  HFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            HFG+ YLVE+EV++P +M VK AHDI+L LQ KVE L+ VERAFVHVDY  R+YDEH
Sbjct  519  HFGSKYLVELEVVVPAEMSVKAAHDIALQLQFKVENLEEVERAFVHVDYQSRDYDEH  575

>PHYSO_552775
Length=395

 Score = 181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 128/341 (38%), Positives = 190/341 (56%), Gaps = 19/341 (6%)

Query  27   LTPTQSDSKVAERYHRSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSANVTLAL  86
            ++PT S  + A   H + +    L  +E   H+A             + ASL  N+ + +
Sbjct  9    MSPTTSSPRKALSAHFATLQRV-LRGEEPLDHVAV-----------VLKASLCTNILIVI  56

Query  87   VKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS--VEYPAGRRRLEPIAVI  144
            V    A  SNSLA++S+LV++++DL  Q L WY+           +YPAG  R EP+A+I
Sbjct  57   VMTSVAIASNSLALISALVENMVDLFVQGLLWYAGTRSGKKQDYAKYPAGTSRFEPVAII  116

Query  145  VSATLMGMAGSC--RGAQWQAARGRHLDFHDGRAARCDSSQARAMVRVPRCYLLPDARLR  202
            V+A++M +A     + A  +   G   D  +       +        V +  L+  +   
Sbjct  117  VAASVMVLASIVFIQEAVKKLVDGFSSDEPEAPHLSAAAIAIAVTAVVVKIGLMFYSAWI  176

Query  203  SRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVS  262
             +  +SV  +  +H  QD+ ND  SN+ A+ A          WY+D  GA++I VYI V+
Sbjct  177  LKSTVSVAVE-AIH--QDNLNDTLSNSFAVAAYIIAAVEPKAWYVDPAGAILIFVYIMVA  233

Query  263  WLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPE  322
            W     EQV +LVG+ A++EFI++++ L + HHP M  DIVRAYHFG+ YLVE+EV++P 
Sbjct  234  WGKMAWEQVTQLVGVCASEEFIEEVKDLCNRHHPSMSLDIVRAYHFGSKYLVELEVVVPG  293

Query  323  DMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            +M VK AHDI+L +Q KVE L+ VERAFVHVDY  R+YDEH
Sbjct  294  EMSVKLAHDIALQMQFKVENLEEVERAFVHVDYQARDYDEH  334

>PYIR_21123
Length=388

 Score = 179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 108/144 (75%), Gaps = 0/144 (0%)

Query  220  DHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQA  279
            D+RNDVFSN+ AI A   +  +   WY+D+ GA+V+ ++I V+W   GK+QV +LVG+ A
Sbjct  182  DNRNDVFSNSFAIAAYIISSANEDLWYVDACGAIVVFLFIMVAWAKMGKDQVAQLVGVSA  241

Query  280  TQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHK  339
             +EF+ +++ L   HHP M  DI+RAYHFG+ YLVE+EV++P DM VK AHDI+L LQ K
Sbjct  242  NEEFMTEVKELCSHHHPSMALDIIRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFK  301

Query  340  VEELDNVERAFVHVDYLERNYDEH  363
            VE L++VERAFVHVDY  R+YDEH
Sbjct  302  VENLEDVERAFVHVDYKARDYDEH  325

>PITG_19056
Length=390

 Score = 167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 174/298 (58%), Gaps = 8/298 (3%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V   + ASL+ N+ + +V    A TSNSLA++S+LV++++DL  Q L WY+         
Sbjct  37   VAVVLKASLTTNIIIVIVMTSVAITSNSLALISALVENMVDLFVQGLLWYAGTRSGKKQD  96

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSC--RGAQWQAARGRHLDFHDGRAARCDSSQAR  185
              +YPAG    +  A+IV+A++M +A     + A  +   G   D  +       +    
Sbjct  97   YAKYPAGTSPCQR-AIIVAASVMVLASIVFIQEAVTKLVDGFSSDEPEAPVLSAAAIAIA  155

Query  186  AMVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFW  245
            A   + +  L+  +    +  +SV  +  +H  QD+ ND+ SN+ A+ A          W
Sbjct  156  ATAVIVKIGLMFYSAWILKSTVSVAVE-AIH--QDNFNDMLSNSFAVAAYIVAAVEPKAW  212

Query  246  YLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRA  305
            Y+D  GA++I VYI V+W     EQ+ +LVG+ A++EFI +++ L   HHP M  DIVRA
Sbjct  213  YVDPAGAIIIFVYIMVAWGKMAWEQITQLVGVCASEEFIKEVKELCSRHHPSMELDIVRA  272

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            YHFG+ YLVE+EV++P +M VK AHDI+L +Q KVE L+ VERAFVHVDY  R+YDEH
Sbjct  273  YHFGSKYLVELEVVVPGEMSVKLAHDIALQVQFKVENLEEVERAFVHVDYQARDYDEH  330

>PYAR_21138
Length=455

 Score = 162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 182/335 (54%), Gaps = 47/335 (14%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V AA+  SL  N+ + L     A  S SLA+LS+LV++++DL  Q L  Y+         
Sbjct  49   VAAALKLSLGTNIMIVLTMTAVAIGSKSLALLSTLVENMIDLFVQGLLAYAGTRSGKKQD  108

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAM  187
              ++PAG  R EP+AVIV++++M           + ++  +  F  G  A+ D +    +
Sbjct  109  YAKFPAGTSRFEPVAVIVASSVM--VVVSIVFIQEGSKKLYDGFAHGNPAKPDLTVEALI  166

Query  188  VR----VPRCYLLPDARLRSRHQISVTNDFGLHCLQD-HRNDVFSNTIAIVAAFATHCHS  242
            +       + +L+    L SR  +   +   +  +QD +RNDV SN+ AI+A      + 
Sbjct  167  ISGLSITTKIFLM----LYSRWVLKSHSSVAVEAIQDDNRNDVLSNSFAIIAYIIASANE  222

Query  243  SFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIR--------------  288
              WY+D  GA+ + ++I V+W   GKEQV +LVG+ A+ EFID+++              
Sbjct  223  KLWYVDPAGAIAVFLFIMVAWARMGKEQVMQLVGVTASAEFIDEVKELCRSHNAKLSLDI  282

Query  289  --------------LLGDV------HHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKD  328
                           +G+V      H+  +  DIVRAYHFG+ YLVE+EV++P DM V+D
Sbjct  283  EQVMQLVGVTASEEFIGEVKQLCNSHNNKLSLDIVRAYHFGSKYLVEVEVVVPGDMTVQD  342

Query  329  AHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            AHDI+L LQ KVE+L++VERAFVHVDY  R YDEH
Sbjct  343  AHDIALQLQFKVEQLEDVERAFVHVDYKAREYDEH  377

>PYAR_21139
Length=357

 Score = 158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 160/294 (54%), Gaps = 40/294 (14%)

Query  72   AAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS--V  129
            A +  S++ N+ + L     A  S SLA+LS+LV++++DL  Q L  Y+          V
Sbjct  45   AVLKLSVATNILIVLTMTAVAVASKSLALLSTLVENMVDLVVQGLLAYAGTRAGAKQDYV  104

Query  130  EYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQARAMVR  189
             +PAG  RLEP+AV+V+++ M M  S    Q + A+  +  F  G   +           
Sbjct  105  RFPAGTSRLEPVAVVVASSTM-MVLSVVFIQ-EGAKKLYDGFVHGDPVK-----------  151

Query  190  VPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAFATHCHSSFWYLDS  249
                   P   + + HQ                 D+   T+  +   + +   + WY+D 
Sbjct  152  -------PHLTVEAIHQ-----------------DLL-GTVLPLDPQSPYISRNLWYVDP  186

Query  250  IGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFG  309
             GA+VI + I V+W   GKEQV +LVG+ A  EFIDQ++ L   H   +  DI+RAYHFG
Sbjct  187  AGAIVIFLLIMVAWGRMGKEQVMQLVGVAANDEFIDQVKQLCRGHDANLSLDILRAYHFG  246

Query  310  NNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
              YLVE+EVI+P DM V+DAHDI+L LQ KVE+L++VERAFVHVDY  R YDEH
Sbjct  247  TKYLVELEVIVPGDMAVQDAHDIALRLQFKVEKLEDVERAFVHVDYQAREYDEH  300

>PYIW_28078
Length=108

 Score = 111 bits (277),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)

Query  286  QIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDN  345
            +++ L   HHP M  DI RAYHFG+ YLVE+EV++P DM VK AHDI+L LQ KVE LD+
Sbjct  3    EVKELASGHHPSMSLDITRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLDD  62

Query  346  VERAFVHVDYLERNYDEH  363
            VERAFVHVDY  R+YDEH
Sbjct  63   VERAFVHVDYKARDYDEH  80

>PYIW_26705
Length=230

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 114/216 (53%), Gaps = 8/216 (4%)

Query  74   INASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS---VE  130
            + +SL  N+ + LV    A  S SLA+LS+LV++++DL  Q+L WY+            +
Sbjct  17   LKSSLFTNICIVLVMTTIAIASKSLALLSTLVENMVDLFVQSLLWYAGTRGGGKKQDYAK  76

Query  131  YPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLD-FHDGRAARCDSSQARAMVR  189
            YPAG  R EP+A+IV++++M +         Q    + ++ F  G       S A  ++ 
Sbjct  77   YPAGTSRFEPVAIIVASSVMVLVAITF---IQEGVTKLVNGFAHGNPEAPKLSTAAVVLS  133

Query  190  VPRCYLLPDARLRSRHQISVTNDFGLHCL-QDHRNDVFSNTIAIVAAFATHCHSSFWYLD  248
                 +       S   I  T     H +  D+RNDVFSN+ AI A   +  +   WY+D
Sbjct  134  SSIVVIKIGLSAYSYWTIKRTYSAAAHAIGDDNRNDVFSNSFAIAAYIISSANEDLWYVD  193

Query  249  SIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFI  284
            + GA+++ ++I  +W   GK+QV +LVG++A++EF+
Sbjct  194  ACGAILVFLFIMFAWAKMGKDQVAQLVGVRASEEFM  229

>PYIW_27182
Length=276

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 115/221 (52%), Gaps = 7/221 (3%)

Query  70   VLAAINASLSANVTLALVKIYAAWtsnslavlsslvdsildltsQALFWYSDKHMHTPS-  128
            V   +  SL+ N+ + LV    A  S+SLA+LS+LV++++DL  Q L WY+         
Sbjct  59   VAGVLQTSLTTNIVIVLVMTSVAIASHSLALLSALVENMVDLFVQGLLWYAGTRSGKKQD  118

Query  129  -VEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLD-FHDGRAARCDSSQARA  186
              +YPAG  R EP+A+IV+A++M +         Q    + +D    G+      S A  
Sbjct  119  YAKYPAGTSRFEPVAIIVAASIMVLVSVVF---IQEGVTKLVDGLAHGQPEAPKLSAAAV  175

Query  187  MVRVPRCYLLPDARLRSRHQISVTNDFGLHCLQD-HRNDVFSNTIAIVAAFATHCHSSFW  245
            ++ V    +       +R  ++ T    +  + D +RND  SN  AIVA   +  +   W
Sbjct  176  VIVVLAVLVKIGLIFYARWVLTFTYSASVEAIMDDNRNDTISNAFAIVAYIISSVNEDLW  235

Query  246  YLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQ  286
            Y+D  GA++I ++I  +W   GKEQV +LVG+ A++EF+ +
Sbjct  236  YVDPAGAILIFLFIMFAWGKMGKEQVAQLVGVCASEEFMTE  276

>PYU1_G001828
Length=318

 Score = 35.0 bits (79),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 15/58 (26%), Positives = 33/58 (57%), Gaps = 0/58 (0%)

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEH  363
            Y  G   +V++ +++  D+ V DAH ++   +  +EE+  +  A +H++ L+ + DE 
Sbjct  259  YINGCGTVVDVAIVVHPDLKVGDAHSVAKRARKAIEEISYISEADIHLELLDNDNDEE  316

>PPTG_01766
Length=699

 Score = 34.7 bits (78),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query  253  VVISVYIAVSWLATGKEQV----ERL-VGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYH  307
            V+ S  +AV WL   +  V    +RL    + TQ+F+D+I+L+  + HP +   I  A+ 
Sbjct  451  VIGSGSVAVVWLVRYRSSVLLASKRLREDTECTQDFVDEIKLVSKLDHPNIVAFIGTAWT  510

Query  308  FGNNYLVEMEVILPEDMC  325
             G +     E++   D+C
Sbjct  511  TGPDLQALFELVENGDLC  528

>CCA19358
Length=682

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query  258  YIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAY  306
            YIAV  L   K        LQ  QEFI +I+L   +HHP + T I  AY
Sbjct  446  YIAVKRLLQNKTHT-----LQEAQEFIAEIQLTASLHHPNIVTFIGVAY  489

>PYAR_21141
Length=139

 Score = 32.0 bits (71),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 18/21 (86%), Gaps = 0/21 (0%)

Query  130  EYPAGRRRLEPIAVIVSATLM  150
            ++PAG  R EP+AVIV++++M
Sbjct  75   KFPAGTSRFEPVAVIVASSIM  95

>PPTG_07547
Length=108

 Score = 31.6 bits (70),  Expect = 2.8, Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 1/59 (2%)

Query  277  LQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLN  335
            ++  Q+F + +R L ++      T +     F  N++  M  + PE MCV   H  S+N
Sbjct  50   MEVLQDFSESLRNLANIFRDA-DTKLTSCITFQTNHMRPMTRLFPEVMCVDATHGTSIN  107

>PYIR_23329
Length=432

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 32/56 (57%), Gaps = 0/56 (0%)

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYD  361
            Y  G+  +V++ +++  D+ V DAH ++   +  +E +  V  A +H++ L+ + D
Sbjct  372  YINGSGTVVDVAIVVHPDLKVGDAHSVAKRARKAIEAVPYVSEADIHLELLDEDMD  427

>PYAP_18437
Length=451

 Score = 32.3 bits (72),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 18/21 (86%), Gaps = 0/21 (0%)

Query  130  EYPAGRRRLEPIAVIVSATLM  150
            ++PAG  R EP+AVIV++++M
Sbjct  338  KFPAGTSRFEPVAVIVASSIM  358

>PHYKE_6883
Length=875

 Score = 32.0 bits (71),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 48/110 (44%), Gaps = 22/110 (20%)

Query  270  QVERLVGLQATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGN-------NYLVEMEVILPE  322
            +VE L G +A  E   +   +GD      R D+   +H G         Y++EM  IL E
Sbjct  422  EVEELFG-KAVNEVTQKSGGMGDFSALDFRADL--EHHKGQLADEMSRRYMIEMRQILNE  478

Query  323  DMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKDPTIRRDS  372
                       ++L+ K  EL+ +   F   DYL RN    KD  +R++S
Sbjct  479  -----------VDLEVKSMELEKLGDVFTD-DYLHRNQQLEKDAGVRKES  516

>PYIR_20390
Length=525

 Score = 31.6 bits (70),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 39/82 (48%), Gaps = 8/82 (10%)

Query  125  HTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQA  184
            H P+V +  G   LE IA+   A ++G AG+ R   +   + R L   D     C SS A
Sbjct  314  HLPAVRWVGGVE-LELIAIATGARILGRAGTVREVAFGTTKERMLVIED-----CASSDA  367

Query  185  -RAMVRVPRCYLLPDARLRSRH  205
               +VR     ++ +A+ RS H
Sbjct  368  ITVLVRGGNKMIVEEAK-RSLH  388

>PYIW_21326
Length=517

 Score = 31.6 bits (70),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 34/60 (57%), Gaps = 4/60 (7%)

Query  306  YHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYLERNYDEHKD  365
            Y  G+  +V++ +++  D+ V DAH ++   +  +E +  V  A +H++ L    DE+++
Sbjct  458  YLNGSGTVVDVAIVVHPDLKVGDAHSVAKRARKAIEAISYVSEADIHLELL----DEYRE  513

Lambda      K        H        a         alpha
   0.323    0.133    0.404    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 25135002624

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40