Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_085026526178784181e-54
PYIR_156521492940132632.3
PHYCA_510336134841749623.5
H257_04638276275636614.4
PHYKE_4680134849149614.6
H310_102001305449076614.7
PYIW_2453116445666934614.8
PYVX_183872227151675615.6
PPTG_00713134849249606.0
PYIR_208442230294246616.1
PYAR_14102262696751606.3
H310_0433514613847842606.5
PYU1_G0123758498242441607.2
HYAP_07545134848947607.2
PHYRA_820038207449047607.2
PPTG_051834702940353599.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_08502

Length=78
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HYAP_08502                                                            165     1e-54
PYIR_15652                                                            28.9    2.3  
PHYCA_510336                                                          28.5    3.5  
H257_04638                                                            28.1    4.4  
PHYKE_4680                                                            28.1    4.6  
H310_10200                                                            28.1    4.7  
PYIW_24531                                                            28.1    4.8  
PYVX_18387                                                            28.1    5.6  
PPTG_00713                                                            27.7    6.0  
PYIR_20844                                                            28.1    6.1  
PYAR_14102                                                            27.7    6.3  
H310_04335                                                            27.7    6.5  
PYU1_G012375                                                          27.7    7.2  
HYAP_07545                                                            27.7    7.2  
PHYRA_82003                                                           27.7    7.2  
PPTG_05183                                                            27.3    9.9  

>HYAP_08502
Length=78

 Score = 165 bits (418),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)

Query  1   MHCKGYSKPTIGIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEAAR  60
           MHCKGYSKPTIGIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEAAR
Sbjct  1   MHCKGYSKPTIGIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEAAR  60

Query  61  PGQNRYGCSVGGVHSSPA  78
           PGQNRYGCSVGGVHSSPA
Sbjct  61  PGQNRYGCSVGGVHSSPA  78

>PYIR_15652
Length=401

 Score = 28.9 bits (63),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  18   SDFEKLLERIEKQQFQQQDRTEPYIPLMLLGD  49
            +  E L + I + + QQQD + P +P++L GD
Sbjct  244  AQLEMLTKTISELRVQQQDSSSPELPVLLCGD  275

>PHYCA_510336
Length=417

 Score = 28.5 bits (62),  Expect = 3.5, Method: Composition-based stats.
 Identities = 18/49 (37%), Positives = 24/49 (49%), Gaps = 7/49 (14%)

Query  10   TIGIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEA  58
            T GIP     F + L+RIEKQ  +         P + LG +S+Y  G A
Sbjct  357  TNGIPQYHVGFAQTLQRIEKQAARSA-------PGLFLGGNSFYGIGLA  398

>H257_04638
Length=756

 Score = 28.1 bits (61),  Expect = 4.4, Method: Composition-based stats.
 Identities = 15/36 (42%), Positives = 18/36 (50%), Gaps = 0/36 (0%)

Query  42  IPLMLLGDSSWYECGEAARPGQNRYGCSVGGVHSSP  77
           I L +L   S  + GE ARP   R+GC   G  S P
Sbjct  36  IQLAMLETCSHTKLGEFARPFSVRFGCKTTGGGSHP  71

>PHYKE_4680
Length=491

 Score = 28.1 bits (61),  Expect = 4.6, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 24/49 (49%), Gaps = 7/49 (14%)

Query  10   TIGIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEA  58
            T GIP     F + LERIEKQ  +         P + LG +S+Y  G A
Sbjct  431  TNGIPQYHVGFGQTLERIEKQAARSA-------PGLYLGGNSFYGIGLA  472

>H310_10200
Length=490

 Score = 28.1 bits (61),  Expect = 4.7, Method: Composition-based stats.
 Identities = 25/76 (33%), Positives = 36/76 (47%), Gaps = 17/76 (22%)

Query  5    GYSKPTIGIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEAARPGQN  64
            GY +P+I     DSD  K   + +K +  QQD   P      L + S      AA+ G  
Sbjct  180  GYGRPSI-----DSDQPK---KKKKPRSVQQDHQIP------LANFSERALAFAAKHGHV  225

Query  65   ---RYGCSVGGVHSSP  77
               +Y C+VGG+ +SP
Sbjct  226  DVVKYICTVGGITTSP  241

>PYIW_24531
Length=669

 Score = 28.1 bits (61),  Expect = 4.8, Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 0/34 (0%)

Query  13   IPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLML  46
            IP R SDF  +  R       +QD   PY P++L
Sbjct  373  IPRRASDFADVFMRSAVHDAMRQDLHGPYDPVLL  406

>PYVX_18387
Length=1516

 Score = 28.1 bits (61),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 5/75 (7%)

Query  7    SKPTIGIPSRD-SDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYEC----GEAARP  61
            ++PT+ IP R     E+ L +++KQ+F++  R +  +  +  GD +  +     G   + 
Sbjct  332  TRPTLRIPERKLGAAEQRLAQLDKQRFEKNQRIKSVMVNLEFGDDTAEQRLGTEGGGKKS  391

Query  62   GQNRYGCSVGGVHSS  76
               R   ++G VH S
Sbjct  392  KDTRVVKNIGYVHHS  406

>PPTG_00713
Length=492

 Score = 27.7 bits (60),  Expect = 6.0, Method: Composition-based stats.
 Identities = 18/49 (37%), Positives = 24/49 (49%), Gaps = 7/49 (14%)

Query  10   TIGIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEA  58
            T GIP     F + L+RIEKQ  +         P + LG +S+Y  G A
Sbjct  432  TNGIPQYHVGFGQTLQRIEKQAARNT-------PGLFLGGNSFYGIGLA  473

>PYIR_20844
Length=2942

 Score = 28.1 bits (61),  Expect = 6.1, Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query  21    EKLLERIEKQQFQQQDRTEPYIPL------MLLGDSSWYECGEAAR  60
             E  LER  + + + Q++   ++ +      MLL  S W +C E AR
Sbjct  2095  ETRLERTSRGELESQEKLSLWVEIQGVMKSMLLMFSDWQQCAEKAR  2140

>PYAR_14102
Length=967

 Score = 27.7 bits (60),  Expect = 6.3, Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 26/51 (51%), Gaps = 8/51 (16%)

Query  5    GYSKPT----IGIPSRDSDFEKLLERIEK-QQFQQQDR---TEPYIPLMLL  47
            G++ P     IG+PS  S FE    R+ K QQ  Q  R     P +PL+++
Sbjct  593  GFAGPKGFYDIGLPSHKSLFEIFALRVAKVQQLAQTKRELDETPRVPLLVM  643

>H310_04335
Length=478

 Score = 27.7 bits (60),  Expect = 6.5, Method: Composition-based stats.
 Identities = 13/42 (31%), Positives = 20/42 (48%), Gaps = 1/42 (2%)

Query  37   RTEPYIPLMLLGDSSWYECGEAARPGQNRYGCSVGGVHSSPA  78
            R    IP+   G++  Y+C   A PGQ +    +G  H + A
Sbjct  308  RKANIIPVFANGNAG-YKCSTVASPGQGKLTFGIGATHKTDA  348

>PYU1_G012375
Length=424

 Score = 27.7 bits (60),  Expect = 7.2, Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 0/41 (0%)

Query  15   SRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYEC  55
            SR S  + L ER   + F+++ R EP +  + L   SW  C
Sbjct  161  SRLSALQYLEERGWTRDFEKEFRGEPQMTPLTLAAGSWEAC  201

>HYAP_07545
Length=489

 Score = 27.7 bits (60),  Expect = 7.2, Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 7/47 (15%)

Query  12   GIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEA  58
            GIP  +  F + L+RIEKQ  +        +P + LG +S+Y  G A
Sbjct  431  GIPQYNVGFGQTLQRIEKQAAR-------CVPGLYLGGNSFYGIGLA  470

>PHYRA_82003
Length=490

 Score = 27.7 bits (60),  Expect = 7.2, Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (49%), Gaps = 7/47 (15%)

Query  12   GIPSRDSDFEKLLERIEKQQFQQQDRTEPYIPLMLLGDSSWYECGEA  58
            GIP     F + L+RIEKQ  +         P + LG +S+Y  G A
Sbjct  432  GIPQYHVGFAQTLQRIEKQAARSA-------PGLFLGGNSFYGIGLA  471

>PPTG_05183
Length=403

 Score = 27.3 bits (59),  Expect = 9.9, Method: Composition-based stats.
 Identities = 18/53 (34%), Positives = 31/53 (58%), Gaps = 6/53 (11%)

Query  5    GYSKPTIGIPSRDSDFEKLL-ERIEKQQFQQQDRTE---PYIPL--MLLGDSS  51
            G+S     +P+ D+D++KL+ E  E  Q  QQ +++   PY+ L  ++ GD S
Sbjct  245  GFSGDLDTVPNSDADWDKLIQEHPESSQELQQLKSKGGFPYVELCSLIAGDKS  297

Lambda      K        H        a         alpha
   0.316    0.135    0.426    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3349237668

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40