Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_08497111501007100752900.0
PHYCA_570034111501011101249160.0
PHYSO_560347111501010101348920.0
PPTG_09255111501008101248840.0
PITG_13745111501008101248670.0
PHALS_11566111501009101248380.0
PHYRA_8167811150975100946930.0
PYVX_13921111501041104544750.0
PYU1_G005966111501030103444660.0
PYIW_14752111501031103644590.0
PYIR_15175111501030103344570.0
PYAP_248831115098099840410.0
CCA179911115096599038200.0
CCI4083111150116398036200.0
SDRG_14094111501003104433060.0
H310_11729111501002104632480.0
H257_1278711150968103432110.0
SPRG_03282111501004104532100.0
PHYKE_64071115093463229780.0
PYAR_247791115069969626930.0
PYAR_2437410571032532612422e-162
PYAP_197456156725108840.74
PYIR_167906156744122821.3
PYAP_13607481027038791.8
SPRG_1363913724917962762.5
SPRG_1487013028824662782.6
H310_1052314050926264782.6
PYAP_2293179041059163792.9
PHALS_11598136771421111793.6
SPRG_1951913376114855734.8
CCA20583329736544764.9
SDRG_1014613376122043754.9
PYVX_16007966009043704.9
PYAP_25178535528681765.0
PYAP_21787154352046766.3
H257_0392513993329062756.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_08497

Length=1007
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HYAP_08497                                                            2042    0.0   
PHYCA_570034                                                          1898    0.0   
PHYSO_560347                                                          1889    0.0   
PPTG_09255                                                            1885    0.0   
PITG_13745                                                            1879    0.0   
PHALS_11566                                                           1868    0.0   
PHYRA_81678                                                           1812    0.0   
PYVX_13921                                                            1728    0.0   
PYU1_G005966                                                          1724    0.0   
PYIW_14752                                                            1722    0.0   
PYIR_15175                                                            1721    0.0   
PYAP_24883                                                            1561    0.0   
CCA17991                                                              1476    0.0   
CCI40831                                                              1399    0.0   
SDRG_14094                                                            1278    0.0   
H310_11729                                                            1255    0.0   
H257_12787                                                            1241    0.0   
SPRG_03282                                                            1241    0.0   
PHYKE_6407                                                            1151    0.0   
PYAR_24779                                                            1041    0.0   
PYAR_24374                                                            483     2e-162
PYAP_19745                                                            37.0    0.74  
PYIR_16790                                                            36.2    1.3   
PYAP_13607                                                            35.0    1.8   
SPRG_13639                                                            33.9    2.5   
SPRG_14870                                                            34.7    2.6   
H310_10523                                                            34.7    2.6   
PYAP_22931                                                            35.0    2.9   
PHALS_11598                                                           35.0    3.6   
SPRG_19519                                                            32.7    4.8   
CCA20583                                                              33.9    4.9   
SDRG_10146                                                            33.5    4.9   
PYVX_16007                                                            31.6    4.9   
PYAP_25178                                                            33.9    5.0   
PYAP_21787                                                            33.9    6.3   
H257_03925                                                            33.5    6.8   

>HYAP_08497
Length=1007

 Score = 2042 bits (5290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1007/1007 (100%), Positives = 1007/1007 (100%), Gaps = 0/1007 (0%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEEPTGKSTAVVR  120
             AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEEPTGKSTAVVR
Sbjct  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEEPTGKSTAVVR  120

Query  121   FWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFRSDLK  180
             FWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFRSDLK
Sbjct  121   FWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFRSDLK  180

Query  181   RRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDPALVKS  240
             RRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDPALVKS
Sbjct  181   RRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDPALVKS  240

Query  241   VGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFEGEKKY  300
             VGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFEGEKKY
Sbjct  241   VGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFEGEKKY  300

Query  301   LHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNSRTADA  360
             LHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNSRTADA
Sbjct  301   LHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNSRTADA  360

Query  361   RFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSS  420
             RFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSS
Sbjct  361   RFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSS  420

Query  421   NYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYL  480
             NYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYL
Sbjct  421   NYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYL  480

Query  481   EALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDASDLALK  540
             EALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDASDLALK
Sbjct  481   EALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDASDLALK  540

Query  541   DGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsedsaals  600
             DGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVDSEDSAALS
Sbjct  541   DGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVDSEDSAALS  600

Query  601   esekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVPEDPSL  660
             ESEKERVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVPEDPSL
Sbjct  601   ESEKERVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVPEDPSL  660

Query  661   KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGGRSVEE  720
             KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGGRSVEE
Sbjct  661   KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGGRSVEE  720

Query  721   KEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSI  780
             KEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSI
Sbjct  721   KEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSI  780

Query  781   LEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIPPLQVV  840
             LEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIPPLQVV
Sbjct  781   LEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIPPLQVV  840

Query  841   QVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQMKEEIAQLSSRAVVF  900
             QVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFRSDTKQMKEEIAQLSSRAVVF
Sbjct  841   QVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFRSDTKQMKEEIAQLSSRAVVF  900

Query  901   QATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGN  960
             QATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGN
Sbjct  901   QATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGN  960

Query  961   HEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             HEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  961   HEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007

>PHYCA_570034
Length=1011

 Score = 1898 bits (4916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 949/1012 (94%), Positives = 975/1012 (96%), Gaps = 6/1012 (1%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADG+VHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEE-----PTGKS  115
             AHELFVSHVVMMKRSNVL TIGDGIDPRP+ELREQSKAIAEAGR PNAEE     PTGKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPEELREQSKAIAEAGRTPNAEEMYTSKPTGKS  120

Query  116   TAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  175
             TAVVRFWRTD QDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDL+QFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLTQFAVGLKNGAVILF  180

Query  176   RSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDP  235
             RSDLKRRTDRP HLLQPAGQYPVTGLSF SKPVTAT  HVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRTDRPPHLLQPAGQYPVTGLSFASKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  236   ALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFE  295
             ALVKS GGAAALPPRTTVLDERGVDVNCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDVNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  296   GEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNS  355
             GEK+YL FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASN+
Sbjct  301   GEKRYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  356   RTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  415
             R   ARFGLDEMEEVRHVVCEFGAIFVVSSMGH+YRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHIYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  416   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  475
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  476   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDAS  535
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK NGTK  +D+ 
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK-NGTKSGSDSG  539

Query  536   DLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsed  595
             DL  ++GG AANLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSED
Sbjct  540   DLTPRNGGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  599

Query  596   saalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVP  655
             SAALSESEKERVADALEYI+HLSFSEADSNLRKYGRTLVTH+PGP TELLKRLCTGK+VP
Sbjct  600   SAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHLPGPTTELLKRLCTGKFVP  659

Query  656   EDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGG  715
              +PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDD+GENG 
Sbjct  660   GNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDDGENGT  719

Query  716   RSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEEN  775
             RSVEEKEE+VLRILDNPRVKYDEDHALIHLQM GMKKGKRYLYNKLHMYHMLVQFHIEEN
Sbjct  720   RSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEEN  779

Query  776   DDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIP  835
             DDQSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT G+EW+EL+QLL LIDTN AIP
Sbjct  780   DDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIP  839

Query  836   PLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQMKEEIAQLSS  895
             PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAF+ DTKQMKEEI QLSS
Sbjct  840   PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEITQLSS  899

Query  896   RAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLE  955
             RAVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDRECI+CSMDHRHILGLKTQLE
Sbjct  900   RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLE  959

Query  956   QKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             QKAGNHEQFYNQLETAADGF+TIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  960   QKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1011

>PHYSO_560347
Length=1010

 Score = 1889 bits (4892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 945/1013 (93%), Positives = 971/1013 (96%), Gaps = 9/1013 (1%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADG+VHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEE-----PTGKS  115
             AHELFVSHVVMMKRSNVL TIGDGIDPR +ELREQSKAIAEAGR PNAEE     PTGKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNAEEMYTSKPTGKS  120

Query  116   TAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  175
             TAVVRFWRTD QDREGKPKLLQQIP+FAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  176   RSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDP  235
             +SDLKRR DRP  LLQPAGQYPVTGL+F SKPVTAT  HVFLYASTRRGLTCYHCSHDDP
Sbjct  181   KSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDP  240

Query  236   ALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFE  295
             ALVKS GGAAALPPRTTVLDERGVD+NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  296   GEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNS  355
             GEKKYL FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLA N+
Sbjct  301   GEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAPNA  360

Query  356   RTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  415
             R   ARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  416   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  475
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  476   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDAS  535
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT G    +D+ 
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKG---GSDSG  537

Query  536   DLALKDGGGAA-NLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdse  594
             DL  ++GG AA NLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSE
Sbjct  538   DLTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSE  597

Query  595   dsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYV  654
             DS ALS+SEKERVADALEYI+HLSFSEADSNLRKYGRTLVTHMPGP TELLKRLCTGK+V
Sbjct  598   DSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFV  657

Query  655   PEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG  714
             P +PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG
Sbjct  658   PGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG  717

Query  715   GRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEE  774
              RSVEEKEE+VLRILDNPRVKYDEDHALIHLQM GMKKGKRYLYNKLHMYHMLVQFHIEE
Sbjct  718   ARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEE  777

Query  775   NDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAI  834
             NDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSG+EW+EL+QLL LIDTN AI
Sbjct  778   NDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAI  837

Query  835   PPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQMKEEIAQLS  894
             PPLQVVQVLSQSRELPVSVIKQYVVNQLA+DEKKIEEDEEKIKAF+SDTKQMKEEIAQLS
Sbjct  838   PPLQVVQVLSQSRELPVSVIKQYVVNQLANDEKKIEEDEEKIKAFKSDTKQMKEEIAQLS  897

Query  895   SRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQL  954
             SRAVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDRECI+CSMDHRHILGLKTQL
Sbjct  898   SRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQL  957

Query  955   EQKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             EQKAGNHEQFYNQLETAADGF+TIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  958   EQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1010

>PPTG_09255
Length=1008

 Score = 1885 bits (4884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 947/1012 (94%), Positives = 971/1012 (96%), Gaps = 9/1012 (1%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADG+VHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEE-----PTGKS  115
             AHELFVSHVVMMKRSNVL TIGDGIDPRPDELREQSKAIAEAGR+PNAEE     P+GKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPDELREQSKAIAEAGRSPNAEEMYTSKPSGKS  120

Query  116   TAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  175
             TAVVRFWRTD QDREGKPKLLQQIP+FAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  176   RSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDP  235
             RSDLKRR DRP HLLQPAGQYPVTGLSF SKPVTAT  HVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRADRPPHLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  236   ALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFE  295
             ALVKS GGAAALPPRTTVLDERGVD+NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  296   GEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNS  355
             GEKKYL FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASN+
Sbjct  301   GEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  356   RTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  415
             R   ARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  416   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  475
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  476   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDAS  535
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT   K D+D+ 
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT---KSDSDSG  537

Query  536   DLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsed  595
             DL  ++G  AANLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSED
Sbjct  538   DLTPRNGA-AANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  596

Query  596   saalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVP  655
             SAALSESEKERVADALEYI+HLSFSEADSNLRKYGRTLVTHMP P TELLKRLCTGK+VP
Sbjct  597   SAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVP  656

Query  656   EDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGG  715
              +PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDE E G 
Sbjct  657   GNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEEEGGT  716

Query  716   RSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEEN  775
             RSVEEKEE+VLRILDNPRVKYDEDHALIHLQM GMKKGKRYLYNKLHMYHMLVQFHIEEN
Sbjct  717   RSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEEN  776

Query  776   DDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIP  835
             DDQSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT G+EW+EL+QLL LIDTN AIP
Sbjct  777   DDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIP  836

Query  836   PLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQMKEEIAQLSS  895
             PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAF+ DTKQMKEEIAQLSS
Sbjct  837   PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSS  896

Query  896   RAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLE  955
             RAVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDRECI+CSMDHRHILGLKTQLE
Sbjct  897   RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLE  956

Query  956   QKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             QKAGNHEQFYNQLETAADGF+TIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  957   QKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008

>PITG_13745
Length=1008

 Score = 1879 bits (4867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 940/1012 (93%), Positives = 971/1012 (96%), Gaps = 9/1012 (1%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVD+TSMSANRGLICVGDADG+VHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEE-----PTGKS  115
             AHELFVSHVVMMKRSNVL TIGDGIDPR +ELREQSKAIAEAGRAPNAEE     P GKS
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNAEEMYTSKPAGKS  120

Query  116   TAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  175
             TAVVRFWRTD QDREGKPKLLQQIPIFAKKYPEEAVTAFA NDDLSQFAVGLKNGAVILF
Sbjct  121   TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVILF  180

Query  176   RSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDP  235
             RSDLKRRTDRP  LLQPAGQYPVTGLSF SKPVTAT  HVFLYASTRRGLTCYHCSHDDP
Sbjct  181   RSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP  240

Query  236   ALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFE  295
             ALVKS GGAAALPPRTTVLDERGVD+NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  296   GEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNS  355
             GEKK+L FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASN+
Sbjct  301   GEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA  360

Query  356   RTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  415
             R+  ARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  416   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  475
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  476   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDAS  535
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT   K D+D+ 
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT---KTDSDSG  537

Query  536   DLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsed  595
             +L  ++G   ANLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSED
Sbjct  538   ELTPRNGA-VANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  596

Query  596   saalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVP  655
             SAALSESEKERVADALEYI+HLSFSEADSNLRKYGRTLVTHMP P TELLKRLCTGK+VP
Sbjct  597   SAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVP  656

Query  656   EDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGG  715
              +PS+KSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG 
Sbjct  657   GNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGK  716

Query  716   RSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEEN  775
             RS+EEKEE+VLRILDNPRVKYDEDHALIHLQM GMK+GKRYLYNKLHMYHMLVQFHIEEN
Sbjct  717   RSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKRGKRYLYNKLHMYHMLVQFHIEEN  776

Query  776   DDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIP  835
             DDQSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGAT G+EW+EL+QLL LIDTN AIP
Sbjct  777   DDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIP  836

Query  836   PLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQMKEEIAQLSS  895
             PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAF++DTKQMK+EIAQLSS
Sbjct  837   PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKNDTKQMKDEIAQLSS  896

Query  896   RAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLE  955
             RAVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDRECI+CSMDHRHILGLKTQLE
Sbjct  897   RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLE  956

Query  956   QKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             QKAGNHEQFYNQLETAADGF+TIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  957   QKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1008

>PHALS_11566
Length=1009

 Score = 1868 bits (4838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 918/1012 (91%), Positives = 964/1012 (95%), Gaps = 8/1012 (1%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADG V+LANRS+EARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGSVYLANRSMEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEE-----PTGKS  115
             AHE+FVSHVVMMKRSNVL TIGDGIDPR +ELREQSK IAEAGRAPNAE+     PTGKS
Sbjct  61    AHEMFVSHVVMMKRSNVLVTIGDGIDPRSEELREQSKVIAEAGRAPNAEDMYTAKPTGKS  120

Query  116   TAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  175
             TA+VRFWRTD QDREGKPKL+QQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  121   TAIVRFWRTDQQDREGKPKLMQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  176   RSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDP  235
             RSDLKRR DRP HLLQPAGQYPVTGL+F SKPVT T  HVFLYAST RGLTCYHCSHDDP
Sbjct  181   RSDLKRRADRPPHLLQPAGQYPVTGLAFTSKPVTVTLSHVFLYASTGRGLTCYHCSHDDP  240

Query  236   ALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFE  295
             ALVKS GGAAALPPRTTVLDERGV++NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FE
Sbjct  241   ALVKSAGGAAALPPRTTVLDERGVEMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  296   GEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNS  355
             GEKK++ FFKHYL+VAH+DPRGRHQVNVYDLQNKFIAFNWTLTST+ KGP+RK PL+ N+
Sbjct  301   GEKKFVCFFKHYLIVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTSSKGPIRKAPLSLNA  360

Query  356   RTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  415
             R   ARFG+DEMEE+RHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361   RAPGARFGIDEMEEIRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  416   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  475
             LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421   LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  476   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDAS  535
             LTAYLEALHEKAFANAEHTTLLLNCYTKLKDV+KLDKFIQLDEVIDAKKT   K D ++ 
Sbjct  481   LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVQKLDKFIQLDEVIDAKKT---KTDRNSG  537

Query  536   DLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsed  595
             DL L++GG  ANLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSED
Sbjct  538   DLMLRNGGATANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  597

Query  596   saalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVP  655
             SAALSESEKERVADALEYI+HLSFSEADSNLRKYGRTLVTHMP P TELLKRLCTGK+VP
Sbjct  598   SAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVP  657

Query  656   EDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGG  715
              +PSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVET+SNTSIGNTLLEMVLSDDDEGENG 
Sbjct  658   SNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETISNTSIGNTLLEMVLSDDDEGENGL  717

Query  716   RSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEEN  775
             RSVEEKE++VLRILDNPRVKYDEDHALIHLQM  MKKGKRYLYNKLHMYHMLVQFHIEE+
Sbjct  718   RSVEEKEDAVLRILDNPRVKYDEDHALIHLQMHSMKKGKRYLYNKLHMYHMLVQFHIEES  777

Query  776   DDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIP  835
             DDQSILEEVRKHG+KDPNLWSLALKYFAERGPLPKGA  G+EW+EL+QLLVLIDTN AIP
Sbjct  778   DDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPKGAIDGEEWKELKQLLVLIDTNPAIP  837

Query  836   PLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQMKEEIAQLSS  895
             PLQVVQVLSQSRELPVSVIKQYVV+QLA+DEKKIEEDEEKIKAF+SDTKQMK+EIAQLSS
Sbjct  838   PLQVVQVLSQSRELPVSVIKQYVVSQLANDEKKIEEDEEKIKAFKSDTKQMKDEIAQLSS  897

Query  896   RAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLE  955
             RAVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDREC++CSMDHRHILGLK+QLE
Sbjct  898   RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECLTCSMDHRHILGLKSQLE  957

Query  956   QKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             QKAGNHEQFYNQLETA DGF+TIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  958   QKAGNHEQFYNQLETAVDGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1009

>PHYRA_81678
Length=975

 Score = 1812 bits (4693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 911/1009 (90%), Positives = 940/1009 (93%), Gaps = 36/1009 (4%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKEVLKDA+GPWMKGVDITSMSANRGLICVGDADG+VHLANRSLEARKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDASGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEEPTGKSTAVVR  120
             AHELFVSHVVMM  S                                  +PTGK+TAVVR
Sbjct  61    AHELFVSHVVMMYTS----------------------------------KPTGKTTAVVR  86

Query  121   FWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFRSDLK  180
             FWRTD QDREGKPKLLQQIP+FAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFRSDLK
Sbjct  87    FWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFRSDLK  146

Query  181   RRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDPALVKS  240
             RRTDRP HLLQPAGQYPVTGL F SKPVTAT  HVFLYASTRRGLTCYHCSHDDPALVKS
Sbjct  147   RRTDRPPHLLQPAGQYPVTGLEFTSKPVTATVAHVFLYASTRRGLTCYHCSHDDPALVKS  206

Query  241   VGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFEGEKKY  300
              GGAAALPPRTTVLDERGVD+NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FEGEKKY
Sbjct  207   AGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFEGEKKY  266

Query  301   LHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNSRTADA  360
             L FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASN+R   A
Sbjct  267   LRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNARAPGA  326

Query  361   RFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSS  420
             RFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSS
Sbjct  327   RFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSS  386

Query  421   NYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYL  480
             NYDVNSIIDIFRMYGDHLYQKGD+DGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYL
Sbjct  387   NYDVNSIIDIFRMYGDHLYQKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYL  446

Query  481   EALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDASDLALK  540
             EALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDA+K NGTK  +D+ D   +
Sbjct  447   EALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDARKANGTKSGSDSGDTTPR  506

Query  541   DGGG--AANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsedsaa  598
             +GGG  AANLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSEDS A
Sbjct  507   NGGGGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSVA  566

Query  599   lsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVPEDP  658
             LSE+EKERVADALEYI+HLSFSEADSNLRKYGRTLVTHMPGP TELLKRLCTGK+VP +P
Sbjct  567   LSENEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGPTTELLKRLCTGKFVPGNP  626

Query  659   SLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGGRSV  718
             SLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENG RS+
Sbjct  627   SLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGARSI  686

Query  719   EEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQ  778
             EEKEE+VLRILDNPRVKYDEDHALIHLQM GMKKGKRYLYNKLHMYHMLVQFHIEENDDQ
Sbjct  687   EEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQ  746

Query  779   SILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIPPLQ  838
             SILEEVRKHG+KD NLWSLALKYFAERGPLPKGATSG+EW+EL+QLL LIDTN AIPPLQ
Sbjct  747   SILEEVRKHGEKDLNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPLQ  806

Query  839   VVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQMKEEIAQLSSRAV  898
             VVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAF+ DTKQMKEEIAQLSSRAV
Sbjct  807   VVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSSRAV  866

Query  899   VFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLEQKA  958
             VFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDRECI+CSMDHRHILGLKTQLEQKA
Sbjct  867   VFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKA  926

Query  959   GNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             GNHEQFYNQLETAADGF+TIAEYFGKGIFKSNEVVLDEGSFETRFSAEF
Sbjct  927   GNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  975

>PYVX_13921
Length=1041

 Score = 1728 bits (4475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 869/1045 (83%), Positives = 939/1045 (90%), Gaps = 42/1045 (4%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMK-----------------GVDITSMSANRGLICVGDA  43
             MAQWRRFAFFDKEVLKDANGPWMK                 GVDITSMSANRG+ICVGDA
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKSLDANFFRRLVVPDAIQGVDITSMSANRGMICVGDA  60

Query  44    DGYVHLANRSLEARKFQAHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAG  103
             DG+VHLANR LEARKFQAHE FVSHVVMMKRSNVL T+GDGIDPR +EL+ QSKAIAEAG
Sbjct  61    DGFVHLANRQLEARKFQAHENFVSHVVMMKRSNVLVTVGDGIDPRSEELKAQSKAIAEAG  120

Query  104   RAPNAEE-----PTGKSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVND  158
             R+ NAEE      +GKSTAVVRFWRTD QDR+GKPKLLQQ+PIFAKKYPEEAVTAFAV+D
Sbjct  121   RSGNAEEMFTPKQSGKSTAVVRFWRTDQQDRDGKPKLLQQVPIFAKKYPEEAVTAFAVHD  180

Query  159   DLSQFAVGLKNGAVILFRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLY  218
             D+SQFAVGLKNGAVILFRSDLKRR+DRP HLLQPAGQYPVTGL+F SKP+TAT  HVFLY
Sbjct  181   DVSQFAVGLKNGAVILFRSDLKRRSDRPPHLLQPAGQYPVTGLAFTSKPITATVSHVFLY  240

Query  219   ASTRRGLTCYHCSHDDPALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTD  278
             ASTRRGLTCYHC+HDDPA+ K+  GAA +PPRT VLDERGVD++CSCVN+E E+AVGQTD
Sbjct  241   ASTRRGLTCYHCTHDDPAVTKA-AGAAGMPPRTVVLDERGVDMSCSCVNDEGELAVGQTD  299

Query  279   AVYFYTTEDRSVCFAFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLT  338
             AVYFYTTEDRSVCF FEGEKKYL FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLT
Sbjct  300   AVYFYTTEDRSVCFGFEGEKKYLSFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT  359

Query  339   STN--PKGPMRKPPLASNSRTA-------DARFGLDEMEEVRHVVCEFGAIFVVSSMGHV  389
             STN   KG  R+PPLA N+R          ARFGLDEMEE+RHVVCEFGAIFVVSS+GHV
Sbjct  360   STNSNAKGGARRPPLAPNARXXXXXXXXXGARFGLDEMEEIRHVVCEFGAIFVVSSVGHV  419

Query  390   YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLR  449
             YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLYQKGD+DGSLR
Sbjct  420   YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDFDGSLR  479

Query  450   QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK  509
             QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK
Sbjct  480   QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK  539

Query  510   LDKFIQLDEVIDAKKTNG-----TKIDNDASDLALKDGGGAANLNFDVETAISVLWENYP  564
             LDKFIQLDEVID+ K         K+   + +  L   G   N NFDVETAISVLWENYP
Sbjct  540   LDKFIQLDEVIDSSKKAADRNSIAKLPRSSDETGLD--GKRDNPNFDVETAISVLWENYP  597

Query  565   QHALTLARKHEEHSWYLKIQLGQISYVdsedsaalsesekeRVADALEYIQHLSFSEADS  624
             +HALTLA+K+EEHSWYLKIQL +ISYV+SEDS ALS+ EKERV DALEYI+HLSFSEADS
Sbjct  598   KHALTLAKKYEEHSWYLKIQLDRISYVESEDSVALSDHEKERVTDALEYIKHLSFSEADS  657

Query  625   NLRKYGRTLVTHMPGPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQY  684
             NLRKYGRTLVTH+PGP TELLK+LCTGK+VP + SLKSDPGDFLHLFVSHRAQLKEFLQY
Sbjct  658   NLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGNSSLKSDPGDFLHLFVSHRAQLKEFLQY  717

Query  685   IVEVETVSNTSIGNTLLEMVLSDDDEGENGG--RSVEEKEESVLRILDNPRVKYDEDHAL  742
             IVEVETV+NTSIGNTLLEMVLSDD E   G   R+  EKE++V+ ILDNPRVKYDEDHAL
Sbjct  718   IVEVETVTNTSIGNTLLEMVLSDDSEDAEGSAPRTDAEKEDAVMLILDNPRVKYDEDHAL  777

Query  743   IHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYF  802
             IHLQM GMKKGKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYF
Sbjct  778   IHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYF  837

Query  803   AERGPLPKGATSGKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSRELPVSVIKQYVVNQL  862
             AERGPLPKGATSG+EW+EL+QLL LIDTN  IPPLQVVQVLSQSRELPVSV+KQY+VNQL
Sbjct  838   AERGPLPKGATSGEEWKELKQLLALIDTNPVIPPLQVVQVLSQSRELPVSVVKQYIVNQL  897

Query  863   ASdekkieedeekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQ  922
             A+DE+KI EDEEKIKAF+ DTKQMKEEI+QLSS+AVVFQATKCDLC+HDLDLPAVHFMCQ
Sbjct  898   ANDERKIAEDEEKIKAFKGDTKQMKEEISQLSSKAVVFQATKCDLCNHDLDLPAVHFMCQ  957

Query  923   HSFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYF  982
             HSFHLNCISET+REC++CS+DHRHI+GLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYF
Sbjct  958   HSFHLNCISETERECMTCSLDHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYF  1017

Query  983   GKGIFKSNEVVLDEGSFETRFSAEF  1007
             GKGIFKSNEV  D+GSFETRFSAEF
Sbjct  1018  GKGIFKSNEVA-DDGSFETRFSAEF  1041

>PYU1_G005966
Length=1030

 Score = 1724 bits (4466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 861/1034 (83%), Positives = 928/1034 (90%), Gaps = 31/1034 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKD NG W+KGVDITSMSANRG+ICVGD DG++HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDGNGLWLKGVDITSMSANRGMICVGDGDGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEEP------TGK  114
             AHE FVSHVVMMKRSN+L +IGDGIDPR  ELR QSKA+A+AGR+ N+ E       TGK
Sbjct  61    AHENFVSHVVMMKRSNILVSIGDGIDPRSAELRAQSKAVADAGRSANSAEEMFASKQTGK  120

Query  115   STAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  174
             +TAVVR WRTD QDR+GKPKLLQQIP+FAKKYPEEAVTAFAVNDD+SQ AVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQLAVGLKNGAVIL  180

Query  175   FRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDD  234
             FR+DLKRR+DRP HLLQPAGQYPVTGL F SKPVT T  HVFLYASTRRGLTCYHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVFLYASTRRGLTCYHCTHDD  240

Query  235   PALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAF  294
             PALVKS  GA+ LPPRT VLDERGVD NCSCVN+E EIAVGQTDAVYFYTTEDRSVCF F
Sbjct  241   PALVKS-AGASGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  295   EGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  352
             EGEKKYLHFFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLT+T  KGP   RKPP+A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTSKGPAGGRKPPIA  359

Query  353   SNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  412
              NSR   ARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  360   PNSRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419

Query  413   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  472
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  473   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK--------  524
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE++D KK        
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIVDGKKNDLSGGDA  539

Query  525   ---TNGT--------KIDNDASDLALKDGGGAANLNFDVETAISVLWENYPQHALTLARK  573
                 NGT        K D+ A     + G G A LNFDVETAISVLWENYPQHALTLA+K
Sbjct  540   LSAVNGTGAAGDKLAKRDSSAGAETAQKGPGTAALNFDVETAISVLWENYPQHALTLAKK  599

Query  574   HEEHSWYLKIQLGQISYVdsedsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRTL  633
             HEEHSWYLKIQL +ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLRKYGRTL
Sbjct  600   HEEHSWYLKIQLDRISYVESEDSVALSTHEKERVADALEYIKHLSFSEADSNLRKYGRTL  659

Query  634   VTHMPGPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN  693
             VTH+P P TELLK+LCTGK+VP++  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN
Sbjct  660   VTHLPEPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN  719

Query  694   TSIGNTLLEMVLSDDDEGENGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKG  753
             TSIGNTLLEMVLS   E  +  R+ EE E++V+ ILDNPRVKYDEDHALIHLQMRG+KKG
Sbjct  720   TSIGNTLLEMVLS---ETADEKRTEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKG  776

Query  754   KRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGAT  813
             KRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAERGPLPKGAT
Sbjct  777   KRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGAT  836

Query  814   SGKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieede  873
             +G+EW EL+QLL LID+N  IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DEKKIEEDE
Sbjct  837   TGEEWRELKQLLALIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEEDE  896

Query  874   ekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISET  933
             EKIKAF+SDTKQMKEEI QLS +AVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISET
Sbjct  897   EKIKAFKSDTKQMKEEITQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET  956

Query  934   DRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVV  993
             +RECI+CSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGF+TIAEYFGKGIFKSNEV 
Sbjct  957   ERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVP  1016

Query  994   LDEGSFETRFSAEF  1007
             +D+GSF+ RFS EF
Sbjct  1017  IDDGSFDARFSNEF  1030

>PYIW_14752
Length=1031

 Score = 1722 bits (4459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 865/1036 (83%), Positives = 933/1036 (90%), Gaps = 34/1036 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDITSMSANRG+ICVGDADG++HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPN------AEEPTGK  114
             AHE FVSHVVMMKRSN+L +IGDG+D R +ELR QSKA+AEAGR+ N      A + TGK
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120

Query  115   STAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  174
             +TAVVR WRTD QDR+GKPKLLQQIP+FAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180

Query  175   FRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDD  234
             FR+DLKRR+DRP HLLQPAGQYPVTGL F SKPVT T+ HVFLYASTRRGLTCYHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240

Query  235   PALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAF  294
             PALVKS  G + LPPRT VLDERGVD NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF F
Sbjct  241   PALVKS-AGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  295   EGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  352
             EGEKKYLHFFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGSTGGRKLSVA  359

Query  353   SNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  412
              N+R   ARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419

Query  413   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  472
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  473   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK--------  524
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK        
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLL  539

Query  525   -TNGT-----KIDNDASD--LALKDGG----GAANLNFDVETAISVLWENYPQHALTLAR  572
               NG+     K+ +   D      DGG    GAA LNFD+ETAISVLWENYPQHALTLA+
Sbjct  540   IANGSSSGDRKVSHSGQDGLSGGADGGKKRAGAAALNFDIETAISVLWENYPQHALTLAK  599

Query  573   KHEEHSWYLKIQLGQISYVdsedsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRT  632
             KHEEHSWYLKIQL +ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLRKYGRT
Sbjct  600   KHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT  659

Query  633   LVTHMPGPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  692
             LVTH+PGP TELLK+LCTGK+VP +  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS
Sbjct  660   LVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  719

Query  693   NTSIGNTLLEMVLSDD-DEGENGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMK  751
             NTSIGNTLLEMVLS   DE     RS EE E++V+ ILDNPRVKYDEDHALIHLQMRG+K
Sbjct  720   NTSIGNTLLEMVLSGSADET----RSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVK  775

Query  752   KGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKG  811
             KGKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAERGPLPKG
Sbjct  776   KGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKG  835

Query  812   ATSGKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkiee  871
             ATSG+EW+EL+QLLVLID+N  IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DEKKIEE
Sbjct  836   ATSGEEWKELKQLLVLIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEE  895

Query  872   deekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCIS  931
             D+EKIKAF+SDTKQMKEEIAQL  +AVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCIS
Sbjct  896   DDEKIKAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCIS  955

Query  932   ETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNE  991
             ET+RECI+CSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGF+TIAEYFGKGIFKSNE
Sbjct  956   ETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNE  1015

Query  992   VVLDEGSFETRFSAEF  1007
             V +D+GSF+ RFSAEF
Sbjct  1016  VPVDDGSFDMRFSAEF  1031

>PYIR_15175
Length=1030

 Score = 1721 bits (4457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 865/1033 (84%), Positives = 937/1033 (91%), Gaps = 29/1033 (3%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDIT+MSANRG+ICVGDADG++HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITTMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEEP------TGK  114
             AHE FVSHVVMMKRSN+L +IGDGIDPR DELR QSKA+AEAGR+ N+ E       TGK
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGIDPRSDELRAQSKAVAEAGRSANSAEEMYASKQTGK  120

Query  115   STAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  174
             +TAVVR WRTD QDR+GKPKLLQQIP+FAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180

Query  175   FRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDD  234
             FR+DLKRR+DRP HLLQPAGQYPVTGL F SKPVT T  HV+LYASTRRGLT YHC+HDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVYLYASTRRGLTVYHCTHDD  240

Query  235   PALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAF  294
             PALVKS  GAA LPPRT VLDERGVD NCSCVN+E EIAVGQTDAVYFYTTEDRSVCF F
Sbjct  241   PALVKS-AGAAGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  295   EGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  352
             EGEKKYLHFFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLT+T  KGP+  RKPP+A
Sbjct  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGPVGGRKPPVA  359

Query  353   SNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  412
              N+R   ARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNL+SI
Sbjct  360   PNTRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLFSI  419

Query  413   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  472
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  473   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKT-------  525
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE++D KK+       
Sbjct  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEILDGKKSDLNGDLL  539

Query  526   ----NGTKIDNDA---SDLALKDGG----GAANLNFDVETAISVLWENYPQHALTLARKH  574
                 NGT  D  A     +   DGG    G A LNFDVETAISVLWENYPQHALTLA+KH
Sbjct  540   IANGNGTAGDKKAKQDGSVGGADGGKKGPGTAALNFDVETAISVLWENYPQHALTLAKKH  599

Query  575   EEHSWYLKIQLGQISYVdsedsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLV  634
             EEHSWYLKIQL +ISYV+SEDSAALS  EKERVADALEYI+HLSFSEADSNLRKYGRTLV
Sbjct  600   EEHSWYLKIQLDRISYVESEDSAALSAHEKERVADALEYIKHLSFSEADSNLRKYGRTLV  659

Query  635   THMPGPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT  694
             TH+PGP TELLK+LCTGK+VP++  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT
Sbjct  660   THLPGPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT  719

Query  695   SIGNTLLEMVLSDDDEGENGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGK  754
             SIGNTLLEMVLS    G+   RS EE E++V+ ILDNPRVKYDEDHALIHLQMRG+KKGK
Sbjct  720   SIGNTLLEMVLSG--SGDEEKRSEEETEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK  777

Query  755   RYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATS  814
             RYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAERGPLPKGATS
Sbjct  778   RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATS  837

Query  815   GKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedee  874
             G+EW+EL+QLLVLID N  IPPLQVVQVLSQSRELPV+V+KQY+VNQL +DEKKIEED+E
Sbjct  838   GEEWKELKQLLVLIDNNPVIPPLQVVQVLSQSRELPVAVLKQYIVNQLLNDEKKIEEDDE  897

Query  875   kikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETD  934
             KIKAF+SDTKQMKEEI+QLS +AVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISET+
Sbjct  898   KIKAFKSDTKQMKEEISQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE  957

Query  935   RECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVL  994
             RECI+CSMDHRHI+GLK+QLEQKAGNHEQF+NQLETAADGF+TIAEYFGKGIFKSNEV +
Sbjct  958   RECITCSMDHRHIMGLKSQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPV  1017

Query  995   DEGSFETRFSAEF  1007
             D+GSF+ RFS EF
Sbjct  1018  DDGSFDMRFSNEF  1030

>PYAP_24883
Length=980

 Score = 1561 bits (4041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/998 (79%), Positives = 870/998 (87%), Gaps = 39/998 (4%)

Query  31    MSANRGLICVGDADGYVHLANRSLEARKFQAHELFVSHVVMMKRSNVLATIGDGIDPRPD  90
             MSANRG++CVGDADG+VHLANR LEARKF+AHE FVSH+VMMKRSNVL TIGDGIDPR D
Sbjct  1     MSANRGMLCVGDADGFVHLANRQLEARKFRAHEHFVSHIVMMKRSNVLVTIGDGIDPRSD  60

Query  91    ELREQSKAIAEAGRAPNA--------------EEPTGKSTAVVRFWRTDLQDREGKPKLL  136
             ELREQS+AIAEAGRA  A                 +GKSTAVVR WRTD QDR+G+PKLL
Sbjct  61    ELREQSRAIAEAGRAAGAAGAGAATADDMFTRSADSGKSTAVVRIWRTDQQDRDGRPKLL  120

Query  137   QQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILFRSDLKRRTDRPSHLLQPAGQY  196
             QQ+P+FAKKYPEEAVTAFAV+DD+ QFAVGL+NGAVILFR DLKRR +RP  LLQPAGQ+
Sbjct  121   QQVPVFAKKYPEEAVTAFAVSDDIGQFAVGLRNGAVILFRIDLKRRAERPPQLLQPAGQF  180

Query  197   PVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDPALVKSVGGAAALPPRTTVLDE  256
             PVTGLSF SKP++ T  HVFLYASTRRGLTCYHC+HDDPALVK+  GAA LP RT VLDE
Sbjct  181   PVTGLSFTSKPISNTVAHVFLYASTRRGLTCYHCNHDDPALVKA-AGAAGLPSRTVVLDE  239

Query  257   RGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFEGEKKYLHFFKHYLLVAHIDPR  316
             RGVD +CSCVN+E EIAVGQ DAVYFY  EDRSVCF FEGEKKYL FFKHYLLVAH+DPR
Sbjct  240   RGVDHHCSCVNDEGEIAVGQVDAVYFYNNEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPR  299

Query  317   GRHQVNVYDLQNKFIAFNWTLTSTNPK-GPMRKPPLASNSRTADARFGLDEMEEVRHVVC  375
             GRHQVNVYDLQNKFIAFNW+LT T  + G MR+PPL +N+R   ARFGLD+MEE+RHVVC
Sbjct  300   GRHQVNVYDLQNKFIAFNWSLTQTASRNGGMRRPPLPTNNRAPGARFGLDDMEEIRHVVC  359

Query  376   EFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYG  435
                          VYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYG
Sbjct  360   ------------CVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG  407

Query  436   DHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  495
             DHLY+KGD+DGSLRQY RTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT
Sbjct  408   DHLYEKGDFDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  467

Query  496   LLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNG-TK-----IDNDASDLALKDGGGAANLN  549
             LLLNCYTKLKDVKKLD FIQLDE  D  K NG TK      +   S+    + GG   +N
Sbjct  468   LLLNCYTKLKDVKKLDNFIQLDENTD--KLNGETKGIAAVANGGTSNDKAHENGGKTGMN  525

Query  550   FDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsedsaalsesekeRVAD  609
             FD+ETAISVLWENYPQHAL LA+KHEEHSWYLKIQL +ISYV+SEDS  LS SE+ERVAD
Sbjct  526   FDIETAISVLWENYPQHALILAKKHEEHSWYLKIQLDRISYVESEDSVGLSASEQERVAD  585

Query  610   ALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKYVPEDPSLKSDPGDFLH  669
             ALEYIQHLSFSEAD+NLRKYGRTLVTH+PGP T+LLKRLCTGK+VP +PSLKSDP DFLH
Sbjct  586   ALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGKFVPGNPSLKSDPADFLH  645

Query  670   LFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEGENGGRSVEEKEESVLRIL  729
             LFVSHR QLKEFLQYIVEVETV+N  IGNTLLEMVLSDD + +    S  E+E++V+ IL
Sbjct  646   LFVSHREQLKEFLQYIVEVETVTNPLIGNTLLEMVLSDDGDTK---LSDAEREDAVMAIL  702

Query  730   DNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGD  789
             DNPRV+YDEDHALIHLQMRGMKKGKRYLYNKLH+YHMLVQFHIEENDDQ+I++EVRKHG+
Sbjct  703   DNPRVRYDEDHALIHLQMRGMKKGKRYLYNKLHLYHMLVQFHIEENDDQAIIDEVRKHGE  762

Query  790   KDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSREL  849
             KDPNLWSLALKYFAERGPLPKG  +G+EW++L+QLL LIDTN  IPPLQVV VLSQSREL
Sbjct  763   KDPNLWSLALKYFAERGPLPKGVKAGEEWKDLKQLLALIDTNPVIPPLQVVHVLSQSREL  822

Query  850   PVSVIKQYVVNQLASdekkieedeekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCS  909
             PVSV+KQY+VNQL SDEKKIEEDEEKIK +++DTKQMKEEIAQL+SRAVVFQATKC+LC+
Sbjct  823   PVSVVKQYIVNQLVSDEKKIEEDEEKIKTYKADTKQMKEEIAQLNSRAVVFQATKCELCN  882

Query  910   HDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLE  969
             HDLDLPAVHFMC+HSFHLNCISET+RECI+CS+DHRHI+GLKTQLEQKAGNHEQFYNQLE
Sbjct  883   HDLDLPAVHFMCKHSFHLNCISETERECITCSLDHRHIMGLKTQLEQKAGNHEQFYNQLE  942

Query  970   TAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             TAADGF TIAEYFGKGIFK++    D+ +F+ RFSAEF
Sbjct  943   TAADGFQTIAEYFGKGIFKTDIAAEDDSAFDARFSAEF  980

>CCA17991
Length=965

 Score = 1476 bits (3820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 722/990 (73%), Positives = 839/990 (85%), Gaps = 38/990 (4%)

Query  31    MSANRGLICVGDADGYVHLANRSLEARKFQAHELFVSHVVMMKRSNVLATIGDGIDPRPD  90
             MSANRGLIC GDA+GY+HL+N  LE RKFQAH  FVS +VMMKRSN+L ++GDGIDPRP 
Sbjct  1     MSANRGLICAGDAEGYIHLSNSQLEVRKFQAHNHFVSQIVMMKRSNILVSVGDGIDPRPS  60

Query  91    ELR-EQSKAIAEAGRAPNAEEPTGKSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEE  149
              +  E++     + +A    E    STA++R WRTD QDREGKPK+LQQI +FAK++PEE
Sbjct  61    MIHAEKADVDINSSKAAGDSE----STAMIRIWRTDQQDREGKPKMLQQIQVFAKRFPEE  116

Query  150   AVTAFAVNDDLSQFAVGLKNGAVILFRSDLKRRTDRPSH-LLQPAGQYPVTGLSFISKPV  208
             AVTAFAV+DD+SQ++VGLKNGAVIL+RSD + R +R    LLQPAGQ+PVTGL+F +KP+
Sbjct  117   AVTAFAVSDDVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGLAFTTKPI  176

Query  209   TATSVHVFLYASTRRGLTCYHCSHDDPALVKSVGGAAALPPRTTVLDERGVDVNCSCVNE  268
             T +  HVFLYASTRRGLTCYHC+ DD  +VK+VG A+ +PPR   LDERGVD +CSCVN+
Sbjct  177   TNSLNHVFLYASTRRGLTCYHCNQDDQYIVKAVG-ASRMPPRCVTLDERGVDFHCSCVND  235

Query  269   EDEIAVGQTDAVYFYTTEDRSVCFAFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQN  328
             + EIAVGQ DAVYFYTT+D+SVCFAF+GEKKYLHFFK YL+VAH+D RGRHQVNVYDLQN
Sbjct  236   DGEIAVGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVNVYDLQN  295

Query  329   KFIAFNWTLTSTNPKGPMRKPPLASNSR------TADARFGLDEMEEVRHVVCEFGAIFV  382
             KFIAFNWTLT + P         A+ +R         +RFGLD ME+++H+V EFG+IFV
Sbjct  296   KFIAFNWTLTHSVPSESSPNVSKATAARGKQSQPNPSSRFGLDRMEQIQHIVSEFGSIFV  355

Query  383   VSSMGHVYRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKG  442
             VSS GHVYRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLYQKG
Sbjct  356   VSSAGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGDHLYQKG  415

Query  443   DYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYT  502
             DYDGSLRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTLLLNC+T
Sbjct  416   DYDGSLRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTLLLNCFT  475

Query  503   KLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDASDLALKDGGGAANLNFDVETAISVLWEN  562
             KLKDVKKLD FIQL++   AK                   GG  +LNFDVETAISVLWE 
Sbjct  476   KLKDVKKLDAFIQLEDGNAAK------------------AGGQTSLNFDVETAISVLWEM  517

Query  563   YPQHALTLARKHEEHSWYLKIQLGQISYVdsedsaalsesekeRVADALEYIQHLSFSEA  622
             YPQHALTLARKHEEHSWYLKIQL QISYVDS+ S  LS +EKERV DALEYI+HLSF+EA
Sbjct  518   YPQHALTLARKHEEHSWYLKIQLDQISYVDSDGSTTLSSAEKERVIDALEYIKHLSFAEA  577

Query  623   DSNLRKYGRTLVTHMPGPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFL  682
             D+NLRKYGRTLVTH+PGP TELLKRLCTGK+VPE P LKSDP DFLHLFVSHRAQL+EFL
Sbjct  578   DANLRKYGRTLVTHLPGPTTELLKRLCTGKFVPEKPELKSDPADFLHLFVSHRAQLREFL  637

Query  683   QYIVEVETVSNTSIGNTLLEMVLSDDDEGENGGRSVEEKEESVLRILDNPRVKYDEDHAL  742
             QYIVEVET+++ SIGNTLLEMVL+D  EG     S + KE++V+ ILDNPRV+YDEDHAL
Sbjct  638   QYIVEVETITDPSIGNTLLEMVLTD--EGSEESPSADMKEDAVMAILDNPRVRYDEDHAL  695

Query  743   IHLQMRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYF  802
             IHLQM GM+KGKRYL+NKLHMYHMLVQ HIEE+DDQSI+EEVRKHGDKDPNLWSLALKYF
Sbjct  696   IHLQMHGMRKGKRYLFNKLHMYHMLVQHHIEEHDDQSIIEEVRKHGDKDPNLWSLALKYF  755

Query  803   AERGPLPK-----GATSGKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSRELPVSVIKQY  857
             AERGPLPK     G  S +EW+EL+QLL++IDTN  IPPLQVVQVLSQ+R+LP+SVIK Y
Sbjct  756   AERGPLPKYVSKSGNASNEEWKELRQLLIMIDTNPVIPPLQVVQVLSQARDLPLSVIKPY  815

Query  858   VVNQLASdekkieedeekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAV  917
             ++NQL+ +++ ++ DEEKI+AF++DT+QMKEEIAQL+S+A+VFQATKCDLC+HDLDLPAV
Sbjct  816   ILNQLSHNQELVDNDEEKIRAFKADTRQMKEEIAQLNSKAIVFQATKCDLCNHDLDLPAV  875

Query  918   HFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNT  977
             HFMCQHSFHLNCISETDREC++CS++HRHILGLKTQLEQKAGNHEQFYNQLET+ DGF T
Sbjct  876   HFMCQHSFHLNCISETDRECMTCSVEHRHILGLKTQLEQKAGNHEQFYNQLETSMDGFET  935

Query  978   IAEYFGKGIFKSNEVVLDEGSFETRFSAEF  1007
             IAEYFGKGIFK NE+ +D+ +F+ +   +F
Sbjct  936   IAEYFGKGIFKKNEIPVDDPTFDFQSGVDF  965

>CCI40831
Length=1163

 Score = 1399 bits (3620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/980 (71%), Positives = 819/980 (84%), Gaps = 47/980 (5%)

Query  40    VGDADGYVHLANRSLEARKFQAHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAI  99
             +GDAD  +H+ +      +F+AH     H VM KRSN+L ++GDGIDPR   +  +   +
Sbjct  219   MGDADD-LHIQS----DLQFRAH----GHRVM-KRSNILVSVGDGIDPRTSMIHAEKSDV  268

Query  100   AEAGRAPNAEEPTGKSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDD  159
                 R  +  +   +STA++R WRTD QDREGKPK+LQQI +FAK++PEEAVTAFAV+D+
Sbjct  269   DTTSRKGDTGD--SESTAMIRIWRTDQQDREGKPKMLQQIQVFAKRFPEEAVTAFAVSDE  326

Query  160   LSQFAVGLKNGAVILFRSDLKRRTDRPSH-LLQPAGQYPVTGLSFISKPVTATSVHVFLY  218
             +SQ++VGLKNGAVIL+RSD + R +R    LLQPAGQ+PVTGL+F +KP+  +  HVFLY
Sbjct  327   VSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGLAFTTKPINNSLNHVFLY  386

Query  219   ASTRRGLTCYHCSHDDPALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTD  278
             ASTRRGLTCYHC+ DD  +VK+VG    +PPR   LDERGVD  CSCVN+E EIAVGQ D
Sbjct  387   ASTRRGLTCYHCNQDDQYIVKAVG-TTGMPPRCVTLDERGVDFCCSCVNDEGEIAVGQPD  445

Query  279   AVYFYTTEDRSVCFAFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLT  338
             AVYFYTT+D+SVCFAF+GEKKYLHFFK YL+VAH+D RGRHQVNVYDLQNKFIAFNWTLT
Sbjct  446   AVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVNVYDLQNKFIAFNWTLT  505

Query  339   STNPK---GPMRKPPLASNSRT---ADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRL  392
              + P      + K  +A   ++     ARFGLD+ME+++H+V EFG+IFVVSS GHVYRL
Sbjct  506   HSVPSESSANVSKTMVARGKQSQPNPGARFGLDKMEQIQHIVSEFGSIFVVSSAGHVYRL  565

Query  393   SEKDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYV  452
             +EKDTTSKLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY 
Sbjct  566   TEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGDHLYQKGDYDGSLRQYT  625

Query  453   RTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDK  512
             RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTLLLNC+TKLKDVKKLD 
Sbjct  626   RTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTLLLNCFTKLKDVKKLDA  685

Query  513   FIQLDEVIDAKKTNGTKIDNDASDLALKDGGGAANLNFDVETAISVLWENYPQHALTLAR  572
             FIQL++                 ++A    GG  +LNFDVETAISVLWE YPQHALTLAR
Sbjct  686   FIQLED----------------GNVA----GGHTSLNFDVETAISVLWEMYPQHALTLAR  725

Query  573   KHEEHSWYLKIQLGQISYVdsedsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRT  632
             KHEEHSWYLKIQL QISYV+S+ S  LS +EKERV DAL+YI+HLSF+EAD+NLRKYGRT
Sbjct  726   KHEEHSWYLKIQLDQISYVESDGSTTLSGAEKERVIDALKYIEHLSFAEADANLRKYGRT  785

Query  633   LVTHMPGPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  692
             LVTH+PGP TELLKRLCTGK+VPE P LKS+P DFLHLFVSHRAQL+EFLQYIVEVET++
Sbjct  786   LVTHLPGPTTELLKRLCTGKFVPEKPELKSNPADFLHLFVSHRAQLREFLQYIVEVETIT  845

Query  693   NTSIGNTLLEMVLSDDDEGENGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKK  752
             + SIGNTLLEMVL+  DEG     + + KE++V+ ILDNPRV+YDEDHALIHLQM GM+K
Sbjct  846   DPSIGNTLLEMVLT--DEGSEESPNTDRKEDAVMAILDNPRVRYDEDHALIHLQMHGMRK  903

Query  753   GKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGA  812
             GKRYL+NKLHMYHMLVQ HIEENDDQSI+EEVRKHGDKDPNLWSLALKYFAERGPLPK A
Sbjct  904   GKRYLFNKLHMYHMLVQHHIEENDDQSIIEEVRKHGDKDPNLWSLALKYFAERGPLPKNA  963

Query  813   -----TSGKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdek  867
                  +S +EW+EL+QLL +IDTN  IPPLQVVQVLSQ+R+LP+SVIK Y++NQL+ +++
Sbjct  964   SKSSKSSTEEWKELRQLLSMIDTNPVIPPLQVVQVLSQARDLPLSVIKPYILNQLSHNQE  1023

Query  868   kieedeekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHL  927
              IE DEEKI+AF++DT+QMKEEI+QL+S+A+VFQATKCDLC+HDLDLPAVHFMCQHSFHL
Sbjct  1024  LIESDEEKIRAFKADTRQMKEEISQLNSKAIVFQATKCDLCNHDLDLPAVHFMCQHSFHL  1083

Query  928   NCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGKGIF  987
             NCISETDREC++CS++HRHILGLKTQL+QKAGNHEQFYNQLET+ DGF TIAEYFGKGIF
Sbjct  1084  NCISETDRECMTCSVEHRHILGLKTQLDQKAGNHEQFYNQLETSMDGFETIAEYFGKGIF  1143

Query  988   KSNEVVLDEGSFETRFSAEF  1007
             K NE+ +D+ +F+ +   +F
Sbjct  1144  KRNEIPVDDPAFDFQSGVDF  1163

>SDRG_14094
Length=1003

 Score = 1278 bits (3306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1044 (64%), Positives = 788/1044 (75%), Gaps = 78/1044 (7%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGR--APNAEE----PTG-  113
             AH+ FVSHVVMMK++NVL +IGDG DPR  +L + SKA+AEA R  A   E+     TG 
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYTSTGS  120

Query  114   --KSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  171
                STA+V+ WRTD QDREGKPKL+ Q+ IFAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  172   VILFRSDLKRRT-----DRPSHLLQPAGQYPVTGLSFISKPV-------TATSVHVFLYA  219
             +ILFRS++KRR        P  LLQ A   PVT LSF  KP        T+T   ++LYA
Sbjct  180   IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  220   STRRGLTCYHCSHDDPALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDA  279
             +T+RGLTCYHC  DD      V    +L PR+ VLDERGV ++C CVN++ ++ +GQTDA
Sbjct  240   ATKRGLTCYHC--DD------VKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291

Query  280   VYFYTTEDRSVCFAFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTS  339
             VYFYT EDR+ CF FEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351

Query  340   TNPKGPMRKPPLASNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  399
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G VYRLSEKDT S
Sbjct  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVYRLSEKDTAS  406

Query  400   KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  459
             KL ILF KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHVE
Sbjct  407   KLSILFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVE  466

Query  460   PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  519
             PSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+     
Sbjct  467   PSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLL----  522

Query  520   IDAKKTNGTKIDNDASDLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSW  579
                       ID+D S+   K+G   A L FDVETA++VL ENYPQHAL LARKH EHSW
Sbjct  523   ----------IDDDGSN--AKEGTPQA-LTFDVETALTVLRENYPQHALALARKHAEHSW  569

Query  580   YLKIQLGQISYVdsedsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPG  639
             YLKIQL +IS         LS++E  RVADAL+YI+ LSF+EAD NLRKYGRTLVTH+PG
Sbjct  570   YLKIQLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPG  622

Query  640   PATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNT  699
             P TELL++LCTG++     + KSDPGDFLHLFVSHR QL+EFL+YIV+VE+VSNTSIGNT
Sbjct  623   PTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLREFLEYIVQVESVSNTSIGNT  681

Query  700   LLEMVLSD--------DDEGE----NGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQM  747
             LLEMVL+D        DD+ E    +   S    E +VL +LDNPRVKYDEDHALI +QM
Sbjct  682   LLEMVLNDTHKRDVPKDDDSEEPEVHEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQM  741

Query  748   RGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGP  807
              G+K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++    D NLW LAL+YFAERGP
Sbjct  742   HGLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVKQQ--TDSNLWLLALRYFAERGP  799

Query  808   LPKGAT--SGKEWEELQQLLVLIDTNSA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLA  863
              PKG++  S  EW EL+QLL L+D      IPPLQVV +LSQSRE+P+SV++ YVV+QL 
Sbjct  800   YPKGSSVRSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLK  859

Query  864   SdekkieedeekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQH  923
              D+  I+ D ++IK ++ DT +M+ ++A LSS+A+VFQATKCDLCSHDLDLP VHFMC H
Sbjct  860   KDQAHIDADSDEIKKYKQDTAKMRTQMAGLSSKAMVFQATKCDLCSHDLDLPVVHFMCGH  919

Query  924   SFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFG  983
             SFH NCISET+RECI+C+ +HRH+L LK  LE KAGNHEQF+NQLETAADGFNTIAEYFG
Sbjct  920   SFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFG  979

Query  984   KGIFKSNEVVLDEGSFETRFSAEF  1007
             KGIFKS   V    S   RFS E 
Sbjct  980   KGIFKSEAAVDRRPSGVPRFSNEL  1003

>H310_11729
Length=1002

 Score = 1255 bits (3248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/1046 (62%), Positives = 790/1046 (76%), Gaps = 83/1046 (8%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFF+KE+LKD NG W++G+D+TSMS NRGL+ +GDA G +HLANR LE R F+
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHLANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEEP-------TG  113
             AHE FVSHV+MMK++N+L +IGDG DPR  +L + SKA+AEA R    ++        + 
Sbjct  61    AHEHFVSHVIMMKKANLLVSIGDGKDPRDPDLIKASKAVAEASRTQAQQDEQLFTSSDSR  120

Query  114   KSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVI  173
              STA+V+ WRTD QDR+GKPKLLQQI IF+K + EEAVTAFAV+DDLSQ A+GL NGA+I
Sbjct  121   GSTALVKIWRTDQQDRDGKPKLLQQIKIFSK-FAEEAVTAFAVSDDLSQIAIGLLNGAII  179

Query  174   LFRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVF-LYASTRRGLTCYHCSH  232
             LFRSD KRR+D+P  LLQPA QYPVT L F      AT V++  LYA+T+RGLTCYHC  
Sbjct  180   LFRSDAKRRSDKPPLLLQPATQYPVTSLHF------ATKVNILTLYAATKRGLTCYHC--  231

Query  233   DDPALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCF  292
              D A  KS      +P R+ VLDERGV ++C  V+E+ ++AVGQ+DAVYFYT E+RSVCF
Sbjct  232   -DDASSKSNASNNGMP-RSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEERSVCF  289

Query  293   AFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLA  352
              FEG+KKYL FFK YLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLT+T           A
Sbjct  290   GFEGDKKYLGFFKQYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNT-----------A  338

Query  353   SNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  412
                     RFG D  EE+RHVV EFGA+FV+SS+G+VYRL E DTTSKL+ILFRK+LYSI
Sbjct  339   KIGAGGGGRFGDDAAEEIRHVVSEFGAVFVLSSLGYVYRLMEIDTTSKLDILFRKHLYSI  398

Query  413   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  472
             AISLAFSSNYD+ SI+DIFR YGDHLYQKGD+DGSLRQY RTIG+VEPSYVIR+FLDAQR
Sbjct  399   AISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQR  458

Query  473   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDN  532
             IHNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+    +ID ++T      +
Sbjct  459   IHNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFL----LIDDEQTT-----D  509

Query  533   DASDLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVd  592
             DA   A         L FDVETA++VL + YP HAL LA+KH EHSWYLKIQL +I    
Sbjct  510   DAPTTADTRKQPKQQLTFDVETALTVLRDYYPTHALALAKKHHEHSWYLKIQLDRI----  565

Query  593   sedsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGK  652
                S  LS+++  RV DAL YI+ LSF+EA+ NLRKYGRTLVTH+PGP TELLK LCTG+
Sbjct  566   --HSETLSDADHARVQDALTYIEGLSFTEANLNLRKYGRTLVTHVPGPTTELLKALCTGR  623

Query  653   YVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSD-----  707
             +   +   K+DP +FLHLFVSHRAQL+EFL+YIV VETV+N  IGNTLLEMVLSD     
Sbjct  624   FHDSNGE-KADPANFLHLFVSHRAQLREFLEYIVHVETVANPQIGNTLLEMVLSDVGRGG  682

Query  708   --------DDEGENGGR---------SVEEKEESVLRILDNPRVKYDEDHALIHLQMRGM  750
                     D+E + GGR         S  + E +VL +LDNPRVKYDEDHALI +QM G+
Sbjct  683   PNAAVDELDEEHDEGGRAPGGGTASTSAAKNESAVLALLDNPRVKYDEDHALILMQMHGL  742

Query  751   KKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPK  810
             K+GKRYLY KLHMYHMLVQ H+EE D+ ++LE+V++HG+ +PNLW LALKYF+E+     
Sbjct  743   KQGKRYLYQKLHMYHMLVQHHMEEGDNVAVLEQVKQHGESNPNLWLLALKYFSEK-----  797

Query  811   GATSGKEWEELQQLLVLIDTNSA---IPPLQVVQVLSQSRELPVSVIKQYVVNQLASdek  867
                +   +  LQ LL  +D++S    IPPLQVV +LSQ+R+LP+SV++QYVVNQL  D+ 
Sbjct  798   -KDNDPTYTHLQTLLSWMDSSSKSLQIPPLQVVAILSQARDLPLSVVRQYVVNQLKQDQI  856

Query  868   kieedeekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHL  927
              I+++ ++IK F+ DT +M+ ++  LSS+A+VFQATKCDLCSHDLDLP VHFMC HSFH 
Sbjct  857   HIDKENDEIKKFKQDTAKMRAQLTTLSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQ  916

Query  928   NCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGKGIF  987
             NCISETDREC++C  +HRH + LKT LE KA NHE F+NQLE+A DGFNTIAEYFGKGIF
Sbjct  917   NCISETDRECMTCGPEHRHFVALKTSLETKASNHELFFNQLESATDGFNTIAEYFGKGIF  976

Query  988   KSNEVVL------DEGSFETRFSAEF  1007
             K+++ ++      DE + E RFS E+
Sbjct  977   KADDPMMAQLGLGDEHASEARFSNEY  1002

>H257_12787
Length=968

 Score = 1241 bits (3211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1034 (62%), Positives = 778/1034 (75%), Gaps = 93/1034 (9%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRFAFF+KE+LKD NG W++G+D+TSMS NRGL+ +GDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEEP-------TG  113
             AH+ FVSHV+MMK++N+L +IGDG DPR  EL + SKAIA+A R    ++        + 
Sbjct  61    AHDHFVSHVIMMKKANLLVSIGDGKDPRDPELIKASKAIADASRTQAQQDEQLFTASDSQ  120

Query  114   KSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVI  173
              STA+V+ WRTD QDR+GKPKLLQQI IFAK +PEEAVTAF+V+DDL+Q AVGL NGA+I
Sbjct  121   GSTALVKIWRTDQQDRDGKPKLLQQIKIFAK-FPEEAVTAFSVSDDLAQIAVGLLNGAII  179

Query  174   LFRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHD  233
             LFRSD KRR+D+P  LLQPA QYPVT L F +K    T     LYA+T+RGLTCYHC  D
Sbjct  180   LFRSDAKRRSDKPPLLLQPATQYPVTSLHFATKLNVPT-----LYAATKRGLTCYHC--D  232

Query  234   DPALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFA  293
             D +     GG     PR+ VLDERGV ++C  V+E+ ++AVGQ+DAVYFYT EDRSVCF 
Sbjct  233   DSS---RSGGM----PRSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEDRSVCFG  285

Query  294   FEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLAS  353
             F+G+KKYL FFK YLLVAH+DPRGRHQVN+YDLQNKFIAFNWTLT+T           A 
Sbjct  286   FDGDKKYLGFFKQYLLVAHVDPRGRHQVNLYDLQNKFIAFNWTLTNT-----------AK  334

Query  354   NSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIA  413
                    RFG D  EE+RHVV EFGA+FV SS+G+VYRL E DTTSKL+ILFRK+LYSIA
Sbjct  335   GGGGGGGRFGDDAAEEIRHVVSEFGAVFVQSSLGYVYRLLEVDTTSKLDILFRKHLYSIA  394

Query  414   ISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRI  473
             ISLAFSSNYD+ SI+DIFR YGDHLYQKGD+DGSLRQY RTIG+VEPSYVIR+FLDAQRI
Sbjct  395   ISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQRI  454

Query  474   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDND  533
             HNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+ +D+    KK         
Sbjct  455   HNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDDDPKEKKQ--------  506

Query  534   ASDLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVds  593
                           L FDVETA++VL +NYP HALTLA+KH EHSWYLKIQL +I     
Sbjct  507   -------------PLTFDVETALTVLRDNYPTHALTLAKKHHEHSWYLKIQLDRIH----  549

Query  594   edsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKY  653
               S  LSES++ RV DAL YI+ LSF EA+ NLRKYGRTLVTH+PGP TELLK LCTG++
Sbjct  550   --SETLSESDQARVLDALTYIEGLSFGEANLNLRKYGRTLVTHVPGPTTELLKALCTGRF  607

Query  654   VPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSD------  707
                D + K+DP +FLHLFVSHRAQL+EFL+YIV+VETV+N  IGNTLLEMVL D      
Sbjct  608   --HDSTDKADPANFLHLFVSHRAQLREFLEYIVDVETVANPQIGNTLLEMVLGDVGRSPA  665

Query  708   --DDEGENGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYH  765
               +++ E+    +   E +VL +LDNPRVKYDEDHALI +QM G+K+GKRYLY KLHMYH
Sbjct  666   TAEEDAEDKPIIMATNEAAVLALLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYH  725

Query  766   MLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLL  825
             ML+Q H+EE DD ++L++V++HG+ +PNLW LALKYF+++          K+   LQ LL
Sbjct  726   MLLQHHMEEGDDLAVLDQVKQHGESNPNLWLLALKYFSDQ----------KDPGHLQTLL  775

Query  826   V-LIDTN---SAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRS  881
               ++DT+     IPPLQVV +LSQ+R+LP+SV++ YVV+QL  D+  I++++ +IK F+ 
Sbjct  776   SWMMDTSVPAPPIPPLQVVAILSQARDLPLSVVRPYVVSQLKQDQAHIDKEKGEIKKFQQ  835

Query  882   DTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCS  941
             DT +M+ ++  LSS+A+VFQATKCDLCSHDLDLP VHFMC HSFH NCISETDREC++C 
Sbjct  836   DTAKMRAQVTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETDRECMTCG  895

Query  942   MDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGKGIFK--------SNEVV  993
              +HRH + L++ L+ KA NHE F+NQLETA DGFNTIAEYFGKGIFK         N V 
Sbjct  896   PEHRHFVALQSSLQAKASNHELFFNQLETATDGFNTIAEYFGKGIFKPVDDDDDDENRVA  955

Query  994   LDEGSFETRFSAEF  1007
                GS E RFS E+
Sbjct  956   ESVGSNE-RFSNEY  968

>SPRG_03282
Length=1004

 Score = 1241 bits (3210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/1045 (62%), Positives = 779/1045 (75%), Gaps = 79/1045 (8%)

Query  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGR--APNAEE----PTG-  113
             AH+ FVSHVVMMK++NVL +IGDG DPR  +L + SKA+AEA R  A   E+     TG 
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120

Query  114   --KSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  171
                STA+V+ WRTD QDREGKPKL+ Q+ IFAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  172   VILFRSDLKRRT-----DRPSHLLQPAGQYPVTGLSFISKPV-------TATSVHVFLYA  219
             +ILFRS++KRR        P  LLQ A   PVT LSF  KP        T+T   ++LYA
Sbjct  180   IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  220   STRRGLTCYHCSHDDPALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDA  279
             +T+RGLTCYHC  DD      V    +L PR+ VLDERGV ++C CVN++ ++ +GQTDA
Sbjct  240   ATKRGLTCYHC--DD------VKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291

Query  280   VYFYTTEDRSVCFAFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTS  339
             VYFYT EDR+ CF FEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351

Query  340   TNPKGPMRKPPLASNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  398
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406

Query  399   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  458
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466

Query  459   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  518
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+    
Sbjct  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLL---  523

Query  519   VIDAKKTNGTKIDNDASDLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHS  578
                        ID+D S  + K+G   A L FDVETA++VL ENYPQHAL LA+KH EHS
Sbjct  524   -----------IDDDGS--SAKEGTPQA-LTFDVETALTVLRENYPQHALALAKKHGEHS  569

Query  579   WYLKIQLGQISYVdsedsaalsesekeRVADALEYIQHLSFSEADSNLRKYGRTLVTHMP  638
             WYLKIQL +IS         LS++E  RVADAL+YI+ LSF+EAD NLRKYGRTLVTH+P
Sbjct  570   WYLKIQLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLP  622

Query  639   GPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGN  698
             GP TELL++LCTG++     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSIGN
Sbjct  623   GPTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGN  681

Query  699   TLLEMVLSD--------DDEGE----NGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQ  746
             TLLEMVL+D        DDEG+        S    E +VL +LDNPRVKYDEDHALI +Q
Sbjct  682   TLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQ  741

Query  747   MRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERG  806
             M G+K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++    D NLW LAL+YFAERG
Sbjct  742   MHGLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVKQQ--TDSNLWLLALRYFAERG  799

Query  807   PLPKGAT--SGKEWEELQQLLVLIDTNSA--IPPLQVVQVLSQSRELPVSVIKQYVVNQL  862
             P PKGA+  S  EW EL+QLL L+D      IPPLQVV +LSQSRE+P+SV++ YVV+QL
Sbjct  800   PYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQL  859

Query  863   ASdekkieedeekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQ  922
               D+  I+ D ++IK ++ DT +M+ ++  LSS+A+VFQATKCDLCSHDLDLP VHFMC 
Sbjct  860   KKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCG  919

Query  923   HSFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYF  982
             HSFH NCISET+RECI+C+ +HRH+L LK  LE KAGNHEQF+NQLETAADGFNTIAEYF
Sbjct  920   HSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYF  979

Query  983   GKGIFKSNEVVLDEGSFETRFSAEF  1007
             GKGIFKS   +    S   RFS E 
Sbjct  980   GKGIFKSEAALDRRPSGVARFSNEL  1004

>PHYKE_6407
Length=934

 Score = 1151 bits (2978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/632 (91%), Positives = 597/632 (94%), Gaps = 6/632 (1%)

Query  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
            MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADG+VHL+NRSLEARKFQ
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLSNRSLEARKFQ  60

Query  61   AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPNAEE-----PTGKS  115
            AHELFVSHVVMM+RSNVL TIGDGIDPR +ELR QSKAIAEAGRAPNAE+     P+GKS
Sbjct  61   AHELFVSHVVMMQRSNVLVTIGDGIDPRSEELRAQSKAIAEAGRAPNAEDMYTSKPSGKS  120

Query  116  TAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  175
            TAVVRFWRTD QDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
Sbjct  121  TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF  180

Query  176  RSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDDP  235
            RSDLKRRTDRP HLLQPAGQYPVTGLSF SKPVTA+  HVFLYASTRRGLTCYHCSHDDP
Sbjct  181  RSDLKRRTDRPPHLLQPAGQYPVTGLSFTSKPVTASVSHVFLYASTRRGLTCYHCSHDDP  240

Query  236  ALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAFE  295
            ALVKS GGAAALPPRTTVLDERGVD+NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF FE
Sbjct  241  ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  296  GEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNS  355
            GEKKYL FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLT+T+ K  MRKPPLA+N+
Sbjct  301  GEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTSSKAGMRKPPLAANA  360

Query  356  RTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  415
            R   ARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
Sbjct  361  RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS  420

Query  416  LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  475
            LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
Sbjct  421  LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN  480

Query  476  LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDNDAS  535
            LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTK  +D S
Sbjct  481  LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKSGSD-S  539

Query  536  DLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsed  595
             +    G GA+NLNFDVETAISVLWENYPQHALTLA+KHEEHSWYLKIQL  ISYVDSED
Sbjct  540  GMTTPRGAGASNLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSED  599

Query  596  saalsesekeRVADALEYIQHLSFSEADSNLR  627
            S ALSE+EKERVADALEYI+HLSFSEADSNLR
Sbjct  600  SVALSENEKERVADALEYIEHLSFSEADSNLR  631

 Score = 571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/301 (94%), Positives = 295/301 (98%), Gaps = 0/301 (0%)

Query  707   DDDEGENGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKLHMYHM  766
             DD++GENG RS+EEKEE+VLRILDNPRVKYDEDHALIHLQM GMKKGKRYLYNKLHMYHM
Sbjct  634   DDEDGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHM  693

Query  767   LVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLV  826
             LVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSG+EW+EL+QLL 
Sbjct  694   LVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLA  753

Query  827   LIDTNSAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQM  886
             LIDTN AIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAF+ DTKQM
Sbjct  754   LIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQM  813

Query  887   KEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISCSMDHRH  946
             KEEIAQLSSRAVVFQATKCDLC+HDLDLPAVHFMCQHSFHLNCISETDRECI+CSMDHRH
Sbjct  814   KEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRH  873

Query  947   ILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVVLDEGSFETRFSAE  1006
             ILGLKTQLEQKAGNHEQFYNQLETAADGF+TIAEYFGKGIFKSNEV+LDEGSFE RFSAE
Sbjct  874   ILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVLLDEGSFEARFSAE  933

Query  1007  F  1007
             F
Sbjct  934   F  934

>PYAR_24779
Length=699

 Score = 1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/696 (77%), Positives = 591/696 (85%), Gaps = 43/696 (6%)

Query  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60
            MAQWRRFAFFDKEVLKDANG WMKGVDIT+MSANRG+ICVGDADG+VHLANR LE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60

Query  61   AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAP--NAEE-------P  111
            AHE FVSH+VMMKRSNVL TIGDG+DPR +ELREQS+AIAEAGRA   NA E        
Sbjct  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120

Query  112  TGKSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  171
             GKS+A+VR WRTD QDR+G PKLLQQ+P+FAKKYPEEAVTAFAV+DD+ QFAVGLKNGA
Sbjct  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180

Query  172  VILFRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCS  231
            VILFR DLKR+ DRP HLLQPAGQ+PVTGLSF SKPVTAT  H FLYA+TRRGL+CYHC+
Sbjct  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240

Query  232  HDDPALVKSVGGAAA-----LPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTE  286
            H+D ALVK+VG AAA     +PPRT VLDERGVD+N SCVN+E E+AVGQ DAVYFYTTE
Sbjct  241  HEDQALVKAVGQAAAAGGGGMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300

Query  287  DRSVCFAFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLT--STNPKG  344
            DRSVCF FEGEKKYL FFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNW+LT  +  P G
Sbjct  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360

Query  345  PM-----RKPPLASNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTS  399
             +     R+    SN+R   ARFGLD+MEE+RHVVCEFGAIFVVSS+G VYRL+EKDTTS
Sbjct  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420

Query  400  KLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVE  459
            KLEILFRKNLYSIAISLAFSSNYD+NSI+DIFRMYGDHLY+KGD+DGSLRQYVRTIGHVE
Sbjct  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480

Query  460  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEV  519
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540

Query  520  IDAKKTNGTKIDNDASD-----LALKDGG-----------------GAANLNFDVETAIS  557
            +DA K NG    +  +      LA  +GG                 G+  +NFD+ETAIS
Sbjct  541  VDANKLNGAAGGDAGATANGKALAKTNGGDNAHPRPSEQEGQIAKPGSGGMNFDIETAIS  600

Query  558  VLWENYPQHALTLARKHEEHSWYLKIQLGQISYVdsedsaalsesekeRVADALEYIQHL  617
            VLWENYP HAL LA+KHEEHSWYLKIQL +ISYV+SEDS ALS  EKERVADALEYIQHL
Sbjct  601  VLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIQHL  660

Query  618  SFSEADSNLRKYGRTLVTHMPGPATELLKRLCTGKY  653
            SFSEAD+NLRKYGRTLVTH+PGP T+LLKRLCTG +
Sbjct  661  SFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696

>PYAR_24374
Length=325

 Score = 483 bits (1242),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/326 (75%), Positives = 281/326 (86%), Gaps = 22/326 (7%)

Query  703   MVLSDDDEGENGG-RSVEEKEESVLRILDNPRVKYDEDHALIHLQMRGMKKGKRYLYNKL  761
             MVLS D E +    R+V EKE++V+ ILDNPRV+YDEDHALIHLQM GMKKGKRYLYNKL
Sbjct  1     MVLSADGESDEAKERTVAEKEDAVMAILDNPRVRYDEDHALIHLQMHGMKKGKRYLYNKL  60

Query  762   HMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGKEWEEL  821
             H+YHMLVQFHIEENDD SI++EVRKHGDKDPNLWSLALKYFAERGPLPKG  +G+EW +L
Sbjct  61    HLYHMLVQFHIEENDDSSIIDEVRKHGDKDPNLWSLALKYFAERGPLPKGVKTGEEWHDL  120

Query  822   QQLLVLIDTNSAIPPLQVVQ-----------------VLSQSRELPVSVIKQYVVNQLAS  864
             +QLL LIDTN AIPPL VVQ                 VLSQSRELPV+V+KQY+VNQL S
Sbjct  121   KQLLALIDTNPAIPPLHVVQVLSQSRELPVAVVKQYIVLSQSRELPVAVVKQYIVNQLLS  180

Query  865   dekkieedeekikAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHS  924
             DE+KIEEDE+KIK +++DTK+MKEEI +L+S+AVVFQATKC+LC+HDLDLPAVHFMC+HS
Sbjct  181   DERKIEEDEDKIKTYKADTKKMKEEIGELNSKAVVFQATKCELCNHDLDLPAVHFMCKHS  240

Query  925   FHLNCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGK  984
             FHLNCISET+RECI+CS++HRHI+GLKTQLEQKAGNHEQFYNQLETAADGF TIAEYFGK
Sbjct  241   FHLNCISETERECITCSLEHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFQTIAEYFGK  300

Query  985   GIFKSNEVVL---DEGSFETRFSAEF  1007
             GIFK+ E+     D+G+F+ RFSAEF
Sbjct  301   GIFKT-EIASGDDDDGAFDHRFSAEF  325

>PYAP_19745
Length=725

 Score = 37.0 bits (84),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 46/108 (43%), Gaps = 10/108 (9%)

Query  113  GKSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAV  172
            G    VV  W T  Q R G    +           E  VTA   +DD   FAVG  NG  
Sbjct  196  GCEDGVVECWDTRSQSRVGVLDSVVGHCGGGVGDAEVGVTALEFDDDGLTFAVGTSNGHC  255

Query  173  ILFRSDLKRRTDRPSHLLQPAGQY--PVTGLSF--ISKPVTATSVHVF  216
            +L+  DL  R+ +P  LLQ   QY  P+  + F   S+ V +T   V 
Sbjct  256  LLY--DL--RSSKP--LLQKTHQYGLPIVDVKFHDYSRKVLSTDAKVI  297

>PYIR_16790
Length=744

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 53/122 (43%), Gaps = 18/122 (15%)

Query  112  TGKSTAVVRFWRTDLQDREGKPKLLQQIPIFA--KKYPEEA---VTAFAVNDDLSQFAVG  166
             G     V  W T  Q R G   +L  I  FA      +EA   VTA   +DD   F VG
Sbjct  195  VGCEDGTVECWDTRSQRRVG---ILDGISTFAGGPAGADEAPVQVTALEFDDDGLTFGVG  251

Query  167  LKNGAVILFRSDLKRRTDRPSHLLQPAGQY--PVTGLSF--ISKPVTATSVHVFLYASTR  222
              NG  +L+  DL  R+ +P  LLQ + QY  P+  L F   ++ V +T   V      R
Sbjct  252  TSNGHCLLY--DL--RSSKP--LLQKSHQYGLPIIDLKFHDYARKVISTDAKVIKIWDKR  305

Query  223  RG  224
             G
Sbjct  306  DG  307

>PYAP_13607
Length=270

 Score = 35.0 bits (79),  Expect = 1.8, Method: Composition-based stats.
 Identities = 14/38 (37%), Positives = 18/38 (47%), Gaps = 0/38 (0%)

Query  903  TKCDLCSHDLDLPAVHFMCQHSFHLNCISETDRECISC  940
            T C +C   +D P V   C H FH+ CI    R   +C
Sbjct  73   TSCVVCMETMDQPCVQLPCHHYFHVGCIEPWLRMHSTC  110

>SPRG_13639
Length=179

 Score = 33.9 bits (76),  Expect = 2.5, Method: Composition-based stats.
 Identities = 19/62 (31%), Positives = 26/62 (42%), Gaps = 7/62 (11%)

Query  893  LSSRAVVFQATKCDLC-----SHDLDLPAV--HFMCQHSFHLNCISETDRECISCSMDHR  945
              SR  V   T+C +C       D ++P V     C H FH  CI+E      +C +   
Sbjct  101  FQSRRNVPSETECSICLVPFSRDDFEVPGVVVETQCTHVFHQGCIAEWIETAATCPICRH  160

Query  946  HI  947
            HI
Sbjct  161  HI  162

>SPRG_14870
Length=246

 Score = 34.7 bits (78),  Expect = 2.6, Method: Composition-based stats.
 Identities = 19/62 (31%), Positives = 26/62 (42%), Gaps = 7/62 (11%)

Query  893  LSSRAVVFQATKCDLC-----SHDLDLPAV--HFMCQHSFHLNCISETDRECISCSMDHR  945
              SR+ +   T+C +C       D  LP V     C H FH  CI+E      +C +   
Sbjct  168  FQSRSSLPSETECSICLVPFSRDDFHLPGVVVETQCTHVFHQGCIAEWIETAATCPICRH  227

Query  946  HI  947
            HI
Sbjct  228  HI  229

>H310_10523
Length=262

 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 30/64 (47%), Gaps = 1/64 (2%)

Query  878  AFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLD-LPAVHFMCQHSFHLNCISETDRE  936
            +++  +  + E++A     A       C +C + LD    V   C+HS+H +CI +    
Sbjct  56   SYKPTSHSILEKLATWQVPATKLDDATCAVCMNSLDDATVVALPCKHSYHTDCIRQWLAR  115

Query  937  CISC  940
            C +C
Sbjct  116  CNTC  119

>PYAP_22931
Length=1059

 Score = 35.0 bits (79),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 39/163 (24%), Positives = 72/163 (44%), Gaps = 31/163 (19%)

Query  789  DKDPNLWSLALKYFAERGPLPKGATSGKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSRE  848
            D DPNLW   +            + S KE   +++LL     +  I P+++++ + +  +
Sbjct  836  DHDPNLWDYLIDL----------SLSSKE--NVEELLSFA-AHHKIDPIKLIRKIPE--D  880

Query  849  LPVSVIKQYVVNQLASdekkieedeekikAFRSDTKQM-KEEIAQLSSRAVVFQATKCDL  907
            + +  +K+ +V  ++S   + +  E   K F SD  Q+ K ++A       V   T C +
Sbjct  881  MQIDDLKEKLVEIVSSYRIQQKLCEGCNKVFESDRVQLLKRQVAVRKRGRRVAPRTACSI  940

Query  908  CSHDLDLP------------AVH---FMCQHSFHLNCISETDR  935
            C+  +  P            A+H   F C H++HL C+ E  R
Sbjct  941  CNELIRPPTSTGGRSGAVSAAMHVCIFECGHNYHLPCLEEKIR  983

>PHALS_11598
Length=1421

 Score = 35.0 bits (79),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 58/111 (52%), Gaps = 11/111 (10%)

Query  350  PLASNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSM-GHVYRLSEKDTTSK--LEILFR  406
            PLAS +    A    D++  ++  V EFG  FV+SS+ G +Y+L+E  +  K  ++ +F+
Sbjct  280  PLASGA--VGAFLSSDDVNHLKAFVREFGLRFVLSSLEGRIYQLNEIVSAMKKGVKNVFK  337

Query  407  ------KNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQY  451
                  K+L    +S + + +Y  ++I    R+  D  +   DY+ +L+ Y
Sbjct  338  SWLRKPKDLRMSNVSASGNVSYKSDAIESQTRLLADTAFLVRDYELALQMY  388

>SPRG_19519
Length=148

 Score = 32.7 bits (73),  Expect = 4.8, Method: Composition-based stats.
 Identities = 17/55 (31%), Positives = 25/55 (45%), Gaps = 2/55 (4%)

Query  890  IAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISE--TDRECISCSM  942
            +AQL S         C +C   +D   +   CQH+FH  CI E  + R   +C +
Sbjct  56   LAQLPSWQAAPTDDACVICMSPMDDDRIALPCQHAFHHACIREWLSRRNTAACDV  110

>CCA20583
Length=365

 Score = 33.9 bits (76),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (7%)

Query  900  FQATKCDLCSHDLDLPAVHFMCQHSFHLNCISET---DRECISC  940
            FQ+ +C +C ++L        C H FHL CI E     ++C  C
Sbjct  102  FQSQECLICLNELQTNLAAVQCGHVFHLICIKEAFEYKKQCPVC  145

>SDRG_10146
Length=220

 Score = 33.5 bits (75),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (49%), Gaps = 0/43 (0%)

Query  890  IAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFHLNCISE  932
            +AQL S  V      C +C   +D   +   CQH+FH  CI E
Sbjct  65   LAQLPSWQVAASDDACVICMSPMDDDRIALPCQHAFHHTCIRE  107

>PYVX_16007
Length=90

 Score = 31.6 bits (70),  Expect = 4.9, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 19/43 (44%), Gaps = 1/43 (2%)

Query  905  CDLCSHDLDLP-AVHFMCQHSFHLNCISETDRECISCSMDHRH  946
            C +C     +   V   C H FHL+CIS  +R  I     H H
Sbjct  43   CSICREPFGVKEQVILSCSHMFHLDCISSFERSDIIAYWHHNH  85

>PYAP_25178
Length=286

 Score = 33.9 bits (76),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 40/81 (49%), Gaps = 17/81 (21%)

Query  699  TLLEMVLSDDDEGENGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQMRG---MKKGKR  755
            T+ ++VLSD D G+ G R+V +    +LR+          +H L H+ + G      G  
Sbjct  67   TVKQLVLSDHDIGDKGARAVAD----MLRV----------NHTLQHVDLYGNAITDAGCE  112

Query  756  YLYNKLHMYHMLVQFHIEEND  776
             + N L+ +  LV+ H+  ND
Sbjct  113  AIANSLYGHESLVELHLWSND  133

>PYAP_21787
Length=520

 Score = 33.9 bits (76),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  411  SIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIG  456
            S+  + +   +YD     DI R  G+  Y++GDY  +++ Y R++G
Sbjct  145  SVTTTSSAVKSYDGRPREDIEREEGNEHYKRGDYVAAIKSYTRSLG  190

>H257_03925
Length=290

 Score = 33.5 bits (75),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 6/62 (10%)

Query  900  FQATKCDLC---SHDLDL---PAVHFMCQHSFHLNCISETDRECISCSMDHRHILGLKTQ  953
             + T C +C     D+D    P  H  C H FHL+CI E  +   +C +  R +  ++  
Sbjct  133  IKTTSCAICWESCGDIDFCSSPPHHLPCGHGFHLSCIREWMKRDATCPLCRRALPSVQDT  192

Query  954  LE  955
             E
Sbjct  193  FE  194

Lambda      K        H        a         alpha
   0.319    0.135    0.397    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 83963418675

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40