Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H257_073581114798984324e-56
H310_075671114798963631e-45
SDRG_1491211147105922842e-33
SPRG_1288311147105922842e-33
PYVX_2085411147104852061e-21
PYAR_2320711147112941982e-20
PYU1_G00596311147103901913e-19
PYIW_1474311147105831888e-19
PYIR_1518611147109831853e-18
PHYCA_53538011147108851801e-17
PHYKE_584111147121851783e-17
PHYRA_8167511147106851773e-17
PPTG_0925211147105851765e-17
PITG_1373911147105901756e-17
PHYSO_31501711147109851758e-17
PYAP_2284611147104831671e-15
PHALS_1156411147107851652e-15
CCI4423211147105731471e-12
HYAP_0849911147108831452e-12
HYAP_0850065260172831458e-12
CCA1752111147104731331e-10
PYIW_199701475513037780.029
CCA175421475512038740.081
PHYRA_959031475513437740.11
PHYCA_101566793911240710.21
PHYRA_94273793911240710.25
PHYSO_3211551475513637710.27
PYU1_G0017361475512346700.30
CCA224011561310942700.32
HYAP_11236793911240680.55
HYAP_11542797211240680.55
PYVX_181801475513547690.56
PHYCA_118341475513437680.64
PHALS_064791475513637670.85
PYIR_1689917518645660.85
PHYSO_355016793911139661.1
PYVX_22540175110158651.4
PYU1_G00921817518645641.6
PHYCA_55379217518844632.5
PPTG_01750793911240642.5
H257_042951400846746622.6
PHYKE_83921475513837642.9
CCI448201475512346633.0
PHYKE_80515700265636653.0
PPTG_171261475513637633.8
HYAP_071031475516437633.8
H310_1409314548238221634.3
PYVX_158475700265845635.8
PYIW_2750217518645606.3
PYAP_231925700265635619.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H257_07358

Length=98
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H257_07358                                                            171     4e-56
H310_07567                                                            144     1e-45
SDRG_14912                                                            114     2e-33
SPRG_12883                                                            114     2e-33
PYVX_20854                                                            84.0    1e-21
PYAR_23207                                                            80.9    2e-20
PYU1_G005963                                                          78.2    3e-19
PYIW_14743                                                            77.0    8e-19
PYIR_15186                                                            75.9    3e-18
PHYCA_535380                                                          73.9    1e-17
PHYKE_5841                                                            73.2    3e-17
PHYRA_81675                                                           72.8    3e-17
PPTG_09252                                                            72.4    5e-17
PITG_13739                                                            72.0    6e-17
PHYSO_315017                                                          72.0    8e-17
PYAP_22846                                                            68.9    1e-15
PHALS_11564                                                           68.2    2e-15
CCI44232                                                              61.2    1e-12
HYAP_08499                                                            60.5    2e-12
HYAP_08500                                                            60.5    8e-12
CCA17521                                                              55.8    1e-10
PYIW_19970                                                            34.7    0.029
CCA17542                                                              33.1    0.081
PHYRA_95903                                                           33.1    0.11 
PHYCA_101566                                                          32.0    0.21 
PHYRA_94273                                                           32.0    0.25 
PHYSO_321155                                                          32.0    0.27 
PYU1_G001736                                                          31.6    0.30 
CCA22401                                                              31.6    0.32 
HYAP_11236                                                            30.8    0.55 
HYAP_11542                                                            30.8    0.55 
PYVX_18180                                                            31.2    0.56 
PHYCA_11834                                                           30.8    0.64 
PHALS_06479                                                           30.4    0.85 
PYIR_16899                                                            30.0    0.85 
PHYSO_355016                                                          30.0    1.1  
PYVX_22540                                                            29.6    1.4  
PYU1_G009218                                                          29.3    1.6  
PHYCA_553792                                                          28.9    2.5  
PPTG_01750                                                            29.3    2.5  
H257_04295                                                            28.5    2.6  
PHYKE_8392                                                            29.3    2.9  
CCI44820                                                              28.9    3.0  
PHYKE_8051                                                            29.6    3.0  
PPTG_17126                                                            28.9    3.8  
HYAP_07103                                                            28.9    3.8  
H310_14093                                                            28.9    4.3  
PYVX_15847                                                            28.9    5.8  
PYIW_27502                                                            27.7    6.3  
PYAP_23192                                                            28.1    9.6  

>H257_07358
Length=98

 Score = 171 bits (432),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGI
Sbjct  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPFGQNHPDRPASINP  98
           QQLNQYVALDPNAQSWSVDMDKDPFGQNHPDRPASINP
Sbjct  61  QQLNQYVALDPNAQSWSVDMDKDPFGQNHPDRPASINP  98

>H310_07567
Length=98

 Score = 144 bits (363),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           MS+SPTVPQIYRRVLQLA KFPSIK+ QLV+DIK EFH+NK LTDP KIKEK+NIAIKGI
Sbjct  1   MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPFGQNHPDRPASI  96
           QQLNQYV+LDPNAQ WSVDM+KDPFGQNHPDRP S+
Sbjct  61  QQLNQYVSLDPNAQHWSVDMEKDPFGQNHPDRPQSL  96

>SDRG_14912
Length=105

 Score = 114 bits (284),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 1/92 (1%)

Query  6   TVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgiQQLNQ  65
           +VPQIYRRVL+LA +FPSIK+ QLV DIK EFHEN +LTD AKI+EKI IA+KGI+QL Q
Sbjct  5   SVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQLGQ  64

Query  66  YVALDPNAQSWSVDMDKDPFGQNHPDRPASIN  97
           YV LDP A SW+V+M+KDPFGQN P RPA + 
Sbjct  65  YVHLDPTAHSWTVEMEKDPFGQNQP-RPADVR  95

>SPRG_12883
Length=105

 Score = 114 bits (284),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 1/92 (1%)

Query  6   TVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgiQQLNQ  65
           +VPQIYRRVL+LA +FPSIK+ QLV DIK EFHEN +LTD AKI+EKI IA+KGI+QL Q
Sbjct  5   SVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQLGQ  64

Query  66  YVALDPNAQSWSVDMDKDPFGQNHPDRPASIN  97
           YV LDP A SW+V+M+KDPFGQN P RPA + 
Sbjct  65  YVHLDPTAHSWTVEMEKDPFGQNQP-RPADVR  95

>PYVX_20854
Length=104

 Score = 84.0 bits (206),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 64/85 (75%), Gaps = 0/85 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+    V ++YRR+L+LA ++PS+K+  +V+DIK EFHENKAL+D  +++EKI  A  GI
Sbjct  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPF  85
           Q+L+QY AL P+A SW+V++ +D  
Sbjct  61  QELSQYAALHPSAASWTVEVGRDAL  85

>PYAR_23207
Length=112

 Score = 80.9 bits (198),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 4/94 (4%)

Query  2   SSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgiQ  61
           ++S  V ++YRRVLQLA ++PSIK+  LV+DIKLEFHE K LTD   I+ KI  A  GI+
Sbjct  5   ATSREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIK  64

Query  62  QLNQYVALDPNAQSWSVDMDKDPFGQNHPDRPAS  95
           +L+QY +L  +A SW+VD+ ++      P +PAS
Sbjct  65  ELSQYASLRSDAMSWTVDVGREV----EPRQPAS  94

>PYU1_G005963
Length=103

 Score = 78.2 bits (191),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 64/90 (71%), Gaps = 1/90 (1%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V +IYRR+L+LA ++PSIK+  +++DIKLEF ENK LTD + I  K+  A +GI
Sbjct  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPFGQNHP  90
            +L+QY  L+P++ +W VD+ ++  GQ  P
Sbjct  61  VELSQYTNLNPSSMTWKVDVGRE-VGQGPP  89

>PYIW_14743
Length=105

 Score = 77.0 bits (188),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 64/83 (77%), Gaps = 0/83 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA ++PSIK+  ++++IK+EFH+NK LTD AKI +K+  A +GI
Sbjct  1   MAEAKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKD  83
            +L+QY  L+P++ +W VD+ ++
Sbjct  61  VELSQYTNLNPSSMTWKVDVGRE  83

>PYIR_15186
Length=109

 Score = 75.9 bits (185),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 63/83 (76%), Gaps = 0/83 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA ++PSIK+  ++++IKLEFH NK LTD AKI +K+  A +GI
Sbjct  1   MAEAKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKD  83
            +L+QY  L+P++ +W VD+ ++
Sbjct  61  VELSQYTNLNPSSMTWKVDVGRE  83

>PHYCA_535380
Length=108

 Score = 73.9 bits (180),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 62/85 (73%), Gaps = 0/85 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA+++PSIK++ +++DIK EFH NK+LTD  +I+E++     GI
Sbjct  1   MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPF  85
           ++L+ Y  L P+  +WSV++ +D  
Sbjct  61  KELSMYANLHPSLPNWSVEVGRDAI  85

>PHYKE_5841
Length=121

 Score = 73.2 bits (178),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 62/85 (73%), Gaps = 0/85 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+    V ++YRR+L+LA ++PS+K+  +++DIK EFH +K LTD  KI+E++  A  GI
Sbjct  1   MAEVKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPF  85
           ++L+QY +L P++ +WS+++ +D  
Sbjct  61  KELSQYASLHPSSVNWSIEVGRDAI  85

>PHYRA_81675
Length=106

 Score = 72.8 bits (177),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 60/85 (71%), Gaps = 0/85 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA ++PSIK+  +++DIK EFH NK LTD  KI+E++     GI
Sbjct  1   MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPF  85
           ++L+ Y +L P+  +WSV++ +D  
Sbjct  61  KELSMYASLHPSLPNWSVEVGRDAI  85

>PPTG_09252
Length=105

 Score = 72.4 bits (176),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 60/85 (71%), Gaps = 0/85 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA ++PS+K++ +++DIK EFH NK LTD  KI+E++     GI
Sbjct  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPF  85
            +L+ Y +L P+  +WSV++ +D  
Sbjct  61  TELSMYASLHPSLPNWSVEVGRDAI  85

>PITG_13739
Length=105

 Score = 72.0 bits (175),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 62/90 (69%), Gaps = 3/90 (3%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA ++PSIK++ +++DIK EFH NK LTD  KI+E++     GI
Sbjct  1   MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPFGQNHP  90
            +L+ Y +L P+  +WSV++ +D     HP
Sbjct  61  TELSMYASLHPSLPNWSVEVGRDAI---HP  87

>PHYSO_315017
Length=109

 Score = 72.0 bits (175),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 61/85 (72%), Gaps = 0/85 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA ++PS+K++ +++DIK EFH NK LTD  KI+E++     GI
Sbjct  1   MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPF  85
           ++L+ Y +L P+  +WSV++ +D  
Sbjct  61  KELSMYASLHPSLPNWSVEVGRDAI  85

>PYAP_22846
Length=104

 Score = 68.9 bits (167),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 57/83 (69%), Gaps = 0/83 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+    V ++YR +L+LA ++PS+K+  ++QDIKLEFHE K  TD   I+ KI  A  GI
Sbjct  1   MADKQKVLRLYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKD  83
           ++L+ Y  L+P++ +W+V + ++
Sbjct  61  KELSMYATLNPSSTAWTVGVGRE  83

>PHALS_11564
Length=107

 Score = 68.2 bits (165),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 58/85 (68%), Gaps = 0/85 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA  +PSIK++ +++DIK EFH N  +TD  KI E +  A  GI
Sbjct  1   MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKDPF  85
           ++L+ Y +L P+  +WSV++ +D  
Sbjct  61  KELSMYASLHPSQPNWSVEVGRDAI  85

>CCI44232
Length=105

 Score = 61.2 bits (147),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (73%), Gaps = 0/73 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgiQQLNQYVAL  69
           +YRR+L+LA ++PSIK+  +V+DI+LEF E++ +  PA I++KI  A  GI++L  Y  L
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKELMMYANL  68

Query  70  DPNAQSWSVDMDK  82
           +P   +W+V++ +
Sbjct  69  NPVEANWTVEIGR  81

>HYAP_08499
Length=108

 Score = 60.5 bits (145),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 59/83 (71%), Gaps = 0/83 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
           M+ +  V ++YRR+L+LA ++PSIK++ ++ DIK EF  N+ L+D  K+++++ +   GI
Sbjct  1   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  60

Query  61  QQLNQYVALDPNAQSWSVDMDKD  83
           ++L+ Y +L P+  +W++++  D
Sbjct  61  KELSMYASLHPSLPNWNIEVGHD  83

>HYAP_08500
Length=172

 Score = 60.5 bits (145),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 59/83 (71%), Gaps = 0/83 (0%)

Query  1    MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgi  60
            M+ +  V ++YRR+L+LA ++PSIK++ ++ DIK EF  N+ L+D  K+++++ +   GI
Sbjct  65   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  124

Query  61   QQLNQYVALDPNAQSWSVDMDKD  83
            ++L+ Y +L P+  +W++++  D
Sbjct  125  KELSMYASLHPSLPNWNIEVGHD  147

>CCA17521
Length=104

 Score = 55.8 bits (133),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 50/73 (68%), Gaps = 0/73 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAkikekiniaikgiQQLNQYVAL  69
           +YRR+L+LA ++PSIK+  ++ DI++EF E++ +T  A I  KI  A  GI++L  Y  L
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKELLMYANL  68

Query  70  DPNAQSWSVDMDK  82
           +P   +W+V++ +
Sbjct  69  NPVDPNWTVEIGR  81

>PYIW_19970
Length=130

 Score = 34.7 bits (78),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 23/37 (62%), Gaps = 0/37 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           +Y+++LQLA   P  K++   Q I+ EF   K L+DP
Sbjct  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDP  52

>CCA17542
Length=120

 Score = 33.1 bits (74),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 26/38 (68%), Gaps = 0/38 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPA  47
           IY+R+++LA   P+ KQ   + +I+ EF +++ ++DP 
Sbjct  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPT  44

>PHYRA_95903
Length=134

 Score = 33.1 bits (74),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 25/37 (68%), Gaps = 0/37 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           +Y+++L+LA   P  K++Q +  I+ EF  ++ LTDP
Sbjct  9   LYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDP  45

>PHYCA_101566
Length=112

 Score = 32.0 bits (71),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  10  IYRRVLQLANKFPS--IKQKQLVQDIKLEFHENKALTDPA  47
           +YRR+L++A  +    ++Q  +  + +  F EN+ LT+PA
Sbjct  5   LYRRILRVARTWEGGYVEQNWIRAEARRRFEENRTLTNPA  44

>PHYRA_94273
Length=112

 Score = 32.0 bits (71),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query  10  IYRRVLQLANKFPS--IKQKQLVQDIKLEFHENKALTDPA  47
           +YRR+L++A  +    ++Q  +  + +  F EN+ LT PA
Sbjct  5   LYRRILRVARTWEGGYVEQTWIRTEARRRFEENRTLTSPA  44

>PHYSO_321155
Length=136

 Score = 32.0 bits (71),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 24/37 (65%), Gaps = 0/37 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           +Y+++L+LA   P  K++Q +  I+ EF  +  LTDP
Sbjct  11  LYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDP  47

>PYU1_G001736
Length=123

 Score = 31.6 bits (70),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 28/46 (61%), Gaps = 1/46 (2%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           M+SS   P +Y+++L+LA   P+ K++  V+ I+ EF  +    DP
Sbjct  1   MASSDLRP-MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDP  45

>CCA22401
Length=109

 Score = 31.6 bits (70),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query  6   TVPQIYRRVLQLANKFPSIKQKQLVQD-IKLEFHENKALTDP  46
            V ++YR  L+ A K P  + +++V+  IKL+F E ++L DP
Sbjct  4   VVLRLYRDCLRSARKCPEWQNREMVKAYIKLKFREQQSLRDP  45

>HYAP_11236
Length=112

 Score = 30.8 bits (68),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query  10  IYRRVLQLANKFPS--IKQKQLVQDIKLEFHENKALTDPA  47
           +YRR+L++A  +    ++QK +  + +  F +N++L+D A
Sbjct  5   LYRRILRVARTWEGGCVEQKWIRDEARRRFEDNRSLSDAA  44

>HYAP_11542
Length=112

 Score = 30.8 bits (68),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query  10  IYRRVLQLANKFPS--IKQKQLVQDIKLEFHENKALTDPA  47
           +YRR+L++A  +    ++QK +  + +  F +N++L+D A
Sbjct  5   LYRRILRVARTWEGGCVEQKWIRDEARRRFEDNRSLSDAA  44

>PYVX_18180
Length=135

 Score = 31.2 bits (69),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 26/47 (55%), Gaps = 0/47 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPA  47
           M+S   +  +Y+++L+LA   P  K+   V  I+ EF  +  +TD A
Sbjct  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAA  47

>PHYCA_11834
Length=134

 Score = 30.8 bits (68),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (65%), Gaps = 0/37 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           +Y+++L+LA   P  K++  +  I+ EF  ++ LTDP
Sbjct  9   LYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDP  45

>PHALS_06479
Length=136

 Score = 30.4 bits (67),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (65%), Gaps = 0/37 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           +Y+++L+LA   P  K++  +  I+ EF  ++ LTDP
Sbjct  11  LYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDP  47

>PYIR_16899
Length=86

 Score = 30.0 bits (66),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 30/45 (67%), Gaps = 1/45 (2%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQ-DIKLEFHENKALT  44
           M+S   V Q+Y+++L+ A+KF S   ++  +  +K +FH++K+L 
Sbjct  1   MASKQQVLQLYKQMLRNASKFESYNYRKYAERRVKEDFHKHKSLA  45

>PHYSO_355016
Length=111

 Score = 30.0 bits (66),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  10  IYRRVLQLANKF--PSIKQKQLVQDIKLEFHENKALTDP  46
           +YRR+L++A  +   +++Q  +  + +  F EN++L DP
Sbjct  5   LYRRILRVARTWEGGAVEQDWIRAEARRRFEENRSLRDP  43

>PYVX_22540
Length=101

 Score = 29.6 bits (65),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 15/58 (26%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQ--------KQ-------LVQDIKLEFHENKAL  43
           MSSS  V ++YR +L+ A+KF   ++        KQ        V+ +K +FH+NKAL
Sbjct  1   MSSSQNVLRLYREMLRNASKFEPYRELTTCFTRCKQSYNFRSYAVRRVKEDFHKNKAL  58

>PYU1_G009218
Length=86

 Score = 29.3 bits (64),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQ-DIKLEFHENKALT  44
           M+S   V ++Y+ +L+ A+KF S   ++  +  +K +FH+NK L 
Sbjct  1   MASKQQVLRLYKEMLRNASKFESYNYRKYAERRVKEDFHKNKQLA  45

>PHYCA_553792
Length=88

 Score = 28.9 bits (63),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQL-VQDIKLEFHENKAL  43
           MSSS +V ++YR +L+ A KF +   +    + +K +F +N AL
Sbjct  1   MSSSSSVLRLYREMLRNAAKFETYNFRAYATRRVKEDFRKNSAL  44

>PPTG_01750
Length=112

 Score = 29.3 bits (64),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  10  IYRRVLQLANKFPSI--KQKQLVQDIKLEFHENKALTDPA  47
           +YRR+L++A  +     +Q  +  + +  F EN+ LT PA
Sbjct  5   LYRRILRVARTWEGGFHEQNWIRAEARRRFEENRTLTSPA  44

>H257_04295
Length=67

 Score = 28.5 bits (62),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           + ++P +   YR   +L      + + Q + DIK  FHENK + DP
Sbjct  17  LETNPRLTVSYRPTKKLKYLMHHVAKMQFIDDIK--FHENKKIIDP  60

>PHYKE_8392
Length=138

 Score = 29.3 bits (64),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 0/37 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           +Y+++L++A   P  K+ Q +  I+ EF  +  L+DP
Sbjct  11  LYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDP  47

>CCI44820
Length=123

 Score = 28.9 bits (63),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 28/46 (61%), Gaps = 0/46 (0%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           M++     +I++++++LA   P  KQ   + +I+ EF +++ + DP
Sbjct  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDP  46

>PHYKE_8051
Length=656

 Score = 29.6 bits (65),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  12   RRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPA  47
            RR+ +     P I QK L +  KLEF+ N+A T P 
Sbjct  95   RRICEKHRSTPKITQKDLCRWAKLEFNLNRAPTQPT  130

>PPTG_17126
Length=136

 Score = 28.9 bits (63),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 0/37 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           +Y+++L+LA   P  K++  +  I+ +F  +  LTDP
Sbjct  11  LYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDP  47

>HYAP_07103
Length=164

 Score = 28.9 bits (63),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (65%), Gaps = 0/37 (0%)

Query  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
           +Y+++L+LA   P  K+++ +  I+ EF  +  LTDP
Sbjct  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDP  40

>H310_14093
Length=382

 Score = 28.9 bits (63),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  64   NQYVALDPNAQSWSVDMDKDP  84
            N YV+LD  A+SW  D+D  P
Sbjct  322  NGYVSLDDEARSWGCDLDGVP  342

>PYVX_15847
Length=658

 Score = 28.9 bits (63),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query  2    SSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
            S + TV Q  RR+ +     P I QK L +  KLEF+  KA T P
Sbjct  108  SGNLTVEQ-KRRICEKHRSTPKITQKDLCRWAKLEFNLKKAPTQP  151

>PYIW_27502
Length=86

 Score = 27.7 bits (60),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (58%), Gaps = 1/45 (2%)

Query  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQ-DIKLEFHENKALT  44
           M+S   V ++Y+ +L+ A+KF S   ++  +  +K +FH N  L 
Sbjct  1   MASKQQVLRLYKEMLRNASKFESYNYRKYAERRVKEDFHANAGLA  45

>PYAP_23192
Length=656

 Score = 28.1 bits (61),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 19/35 (54%), Gaps = 0/35 (0%)

Query  12   RRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDP  46
            RR+ +     P I QK L +  KLEF+  KA T P
Sbjct  96   RRICEKHRSTPKITQKDLCRWAKLEFNLKKAPTQP  130

Lambda      K        H        a         alpha
   0.314    0.129    0.380    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3415733190

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40