Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H257_07013111481661668311e-114
H310_10665111481651646894e-93
SDRG_04481111481861605622e-73
SPRG_13308111481871665292e-68
PHYCA_118037111481651623803e-46
PYIW_14755111481691613804e-46
PITG_13740111481661623727e-45
SPRG_118791283231251023688e-45
PYAP_22844111481781793641e-43
PPTG_09253111481661623571e-42
PHYSO_300767111481661623553e-42
PHYSO_300766485331661623553e-42
PYU1_G005964111481761743484e-41
PYIR_15183111481871813442e-40
PHALS_11565111481621623266e-38
PYAR_26061111481141112774e-31
PHYRA_96081111481561062292e-23
PYVX_2085911148225661442e-10
H310_0155913853638751740.58
H257_1886214733515176664.3
PHALS_031803088412758655.5
CCI470301187559748675.8
SDRG_040684642541105676.3
PYIR_226467505133476667.0
PHALS_05069596430656658.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H257_07013

Length=166
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H257_07013                                                            324     1e-114
H310_10665                                                            270     4e-93 
SDRG_04481                                                            221     2e-73 
SPRG_13308                                                            208     2e-68 
PHYCA_118037                                                          150     3e-46 
PYIW_14755                                                            150     4e-46 
PITG_13740                                                            147     7e-45 
SPRG_11879                                                            146     8e-45 
PYAP_22844                                                            144     1e-43 
PPTG_09253                                                            142     1e-42 
PHYSO_300767                                                          141     3e-42 
PHYSO_300766                                                          141     3e-42 
PYU1_G005964                                                          138     4e-41 
PYIR_15183                                                            137     2e-40 
PHALS_11565                                                           130     6e-38 
PYAR_26061                                                            111     4e-31 
PHYRA_96081                                                           92.8    2e-23 
PYVX_20859                                                            60.1    2e-10 
H310_01559                                                            33.1    0.58  
H257_18862                                                            30.0    4.3   
PHALS_03180                                                           29.6    5.5   
CCI47030                                                              30.4    5.8   
SDRG_04068                                                            30.4    6.3   
PYIR_22646                                                            30.0    7.0   
PHALS_05069                                                           29.6    8.6   

>H257_07013
Length=166

 Score = 324 bits (831),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%), Gaps = 0/166 (0%)

Query  1    MVVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDEDLTFESVRPRIELKEE  60
            MVVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLEDDEDLTFESVRPRIELKEE
Sbjct  1    MVVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLEDDEDLTFESVRPRIELKEE  60

Query  61   NGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKCL  120
            NGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKCL
Sbjct  61   NGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKCL  120

Query  121  RDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQPRQTT  166
            RDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQPRQTT
Sbjct  121  RDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQPRQTT  166

>H310_10665
Length=165

 Score = 270 bits (689),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 151/164 (92%), Gaps = 1/164 (1%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDEDLTFESVRPRIELKEEN  61
            +VRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVL+DD+DLTF SVRPRIELKEEN
Sbjct  1    MVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLDDDDDLTFASVRPRIELKEEN  60

Query  62   GLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKCLR  121
            GLIRRN MFQEALFQMTEARNPHQWP HTLQTYWLGYY++EDD TPTII TED  ++ LR
Sbjct  61   GLIRRNLMFQEALFQMTEARNPHQWPTHTLQTYWLGYYKNEDDMTPTIIPTED-EARSLR  119

Query  122  DVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQPRQT  165
            DVLDMKSTKVTADLI++PQSQIGPVC+ CCQ CALCP+IQ   T
Sbjct  120  DVLDMKSTKVTADLIIVPQSQIGPVCAMCCQGCALCPAIQLHAT  163

>SDRG_04481
Length=186

 Score = 221 bits (562),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 130/160 (81%), Gaps = 1/160 (1%)

Query  1    MVVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDEDLTFESVRPRIELKEE  60
            MVVRIKVRVF F +DP VEHSY+VGS  GGLSS IGM+V+EDDEDLTF+SVRPRIEL+++
Sbjct  1    MVVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVVEDDEDLTFQSVRPRIELQQD  60

Query  61   NGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKCL  120
              ++RR+ M+QEALF MT   NPHQWP+  LQTYWLGYY HEDD  PTII T D   +  
Sbjct  61   GSVLRRHIMYQEALFLMTSGANPHQWPVKALQTYWLGYYAHEDDLVPTIIPTAD-EHQSF  119

Query  121  RDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSI  160
            R+ LDMK+TK+TADLI+IPQSQIGPVC+ CCQ CA CP I
Sbjct  120  REFLDMKTTKLTADLILIPQSQIGPVCNACCQGCAACPPI  159

>SPRG_13308
Length=187

 Score = 208 bits (529),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 134/166 (81%), Gaps = 1/166 (1%)

Query  1    MVVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDEDLTFESVRPRIELKEE  60
            MVVRIKVRVF F +DP VEHSY+VGS  GGLSS IGM+V++DD+DLTFESVRPRIEL+++
Sbjct  1    MVVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVMDDDDDLTFESVRPRIELQQD  60

Query  61   NGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKCL  120
              + RR+ M+QEALF MT + NPHQWP+  LQTYWLGYY HEDD  PT+I T D   K L
Sbjct  61   GSVQRRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIPTAD-EQKPL  119

Query  121  RDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQPRQTT  166
            R VLDMK+TK+TADLI+IPQSQIGPVC+ CCQ CA+CP I P   T
Sbjct  120  RAVLDMKTTKLTADLILIPQSQIGPVCTACCQGCAVCPPIAPWHPT  165

>PHYCA_118037
Length=165

 Score = 150 bits (380),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 110/162 (68%), Gaps = 3/162 (2%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDED--LTFESVRPRIELKE  59
            +VR+KVRVFTF  DP  ++SY+VG+  GGL   +G + L++ E   +TF  +RPRIEL +
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTVEGGLLPVVGTLNLDEKETDTVTFAQLRPRIELLQ  60

Query  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKC  119
               +IRR+ MFQE L  +  + NPH WP + +QTYW G++  E++  P +I   D ++  
Sbjct  61   SKDVIRRSVMFQEVLALIAASPNPHGWPPNAMQTYWFGHFTDENESAPHVITAADENTP-  119

Query  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161
            +   L+M ++K T DLI++PQ+Q+GPVC QCC+ C+LCPSI 
Sbjct  120  ISQFLNMTTSKQTGDLILVPQTQLGPVCEQCCEGCSLCPSIN  161

>PYIW_14755
Length=169

 Score = 150 bits (380),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 107/161 (66%), Gaps = 5/161 (3%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDEDLTFESVRPRIELKEEN  61
            +V +KVRVFTF   P  ++SY+VG+  GGL   +G + L+D E +TF  +RPRIEL+ +N
Sbjct  1    MVHVKVRVFTFPSSPRKQNSYVVGTWEGGLLPTVGTLKLDDSESVTFAQLRPRIELQNDN  60

Query  62   GLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTI--IRTEDTSSKC  119
             +IRR  MFQE L  +  + NPH+WP   LQTYW G+Y+  +   PT+  +  ED+    
Sbjct  61   FMIRRALMFQEVLAIIATSPNPHRWPHSALQTYWFGFYEDLEQRVPTVLPVAVEDSPVSA  120

Query  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSI  160
                L+M ++K T DLI+IPQ+Q+GPVC +CC+ CALCP I
Sbjct  121  F---LNMMTSKQTGDLILIPQTQVGPVCEKCCEGCALCPPI  158

>PITG_13740
Length=166

 Score = 147 bits (372),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 108/162 (67%), Gaps = 3/162 (2%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDED--LTFESVRPRIELKE  59
            +VR+KVRVFTF  DP  ++SY+VG+  GGL   +G + L+D E   +TF  +R RIEL +
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60

Query  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKC  119
             N +IRR+ MFQE L  +  + NPH+WP + +QTYW G+++ E +  P +I   D     
Sbjct  61   INDVIRRSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIAAADEDCP-  119

Query  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161
            +   L+M ++K+  DLI+IPQ+Q+GPVC QCC+ C LCP IQ
Sbjct  120  ISQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQ  161

>SPRG_11879
Length=125

 Score = 146 bits (368),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 78/102 (76%), Gaps = 1/102 (1%)

Query  65   RRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKCLRDVL  124
            RR+ M+QEALF MT + NPHQWP+  LQTYWLGYY HEDD  PT+I T D   K LR VL
Sbjct  3    RRHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIPTAD-EQKPLRAVL  61

Query  125  DMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQPRQTT  166
            DMKSTK+TADLI+IPQSQIGPVC+ CCQ CA CP I P   T
Sbjct  62   DMKSTKLTADLILIPQSQIGPVCNACCQGCAECPPIAPWHPT  103

>PYAP_22844
Length=178

 Score = 144 bits (364),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 106/179 (59%), Gaps = 25/179 (14%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDE--DLTFESVRPRIELKE  59
            +VR+KVRVFTF  +P  ++SY+     GGL   +G + LE+DE   +TF  +RPRIEL++
Sbjct  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55

Query  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTS---  116
            ++G+IRR+PMFQE L  ++ + NPH+WP   LQTYW GY+   D   P  I    TS   
Sbjct  56   DDGMIRRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFA  115

Query  117  ---------------SKCLRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSI  160
                              +   LDM ++K+T DLI+IPQ+Q GPVC  CCQ C  CP +
Sbjct  116  PLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPV  174

>PPTG_09253
Length=166

 Score = 142 bits (357),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 105/162 (65%), Gaps = 3/162 (2%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDE--DLTFESVRPRIELKE  59
            +VR+KVRVFTF  DP  ++SY+VG+  GGL   +G + L+D E   +TF  +R RIEL +
Sbjct  1    MVRVKVRVFTFPPDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVSTVTFTQLRVRIELLQ  60

Query  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKC  119
               +IRR+ MFQE L  +  + NPH WP + +QTYW G++  E +  P +I   D     
Sbjct  61   VKDVIRRSVMFQEVLALIATSPNPHNWPPNAMQTYWFGHFIDESETIPHVIAASDEDCP-  119

Query  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161
            +   L+M ++K T DLI++PQ+Q+GPVC QCC+ C LCP IQ
Sbjct  120  INQFLNMITSKQTGDLILVPQTQLGPVCEQCCEGCTLCPPIQ  161

>PHYSO_300767
Length=166

 Score = 141 bits (355),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 3/162 (2%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDE--DLTFESVRPRIELKE  59
            +VR+KVRVFTF  DP  ++SY+VG+  GGL   +G + L+D E   +TF  +RPRIEL +
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKC  119
               +IRR+ MFQE L  +  + NPH WP + +QTY  G++  E++  P +I   D     
Sbjct  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCP-  119

Query  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161
            +   L+M ++K T DL++IPQ+Q+GPVC +CC+ C LCP I+
Sbjct  120  ISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIE  161

>PHYSO_300766
Length=166

 Score = 141 bits (355),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 3/162 (2%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDE--DLTFESVRPRIELKE  59
            +VR+KVRVFTF  DP  ++SY+VG+  GGL   +G + L+D E   +TF  +RPRIEL +
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKC  119
               +IRR+ MFQE L  +  + NPH WP + +QTY  G++  E++  P +I   D     
Sbjct  61   TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCP-  119

Query  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161
            +   L+M ++K T DL++IPQ+Q+GPVC +CC+ C LCP I+
Sbjct  120  ISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIE  161

>PYU1_G005964
Length=176

 Score = 138 bits (348),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 110/174 (63%), Gaps = 14/174 (8%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDE--DLTFESVRPRIELKE  59
            +V +K+RVFTF  +P  ++SY+VG+  GGL   +G + LE+DE   +TF  +RPRIEL+ 
Sbjct  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60

Query  60   ENGLIR--------RNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIR  111
            +N +IR        R+ MFQE L  ++ + NPH WP   LQTYW GY+   +   PT++ 
Sbjct  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120

Query  112  TEDT----SSKCLRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161
              +T        + + L+M ++K T DLI+IPQ+Q+GP+C +CCQ CA CP ++
Sbjct  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVR  174

>PYIR_15183
Length=187

 Score = 137 bits (344),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 110/181 (61%), Gaps = 22/181 (12%)

Query  5    IKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDEDLTFESVRPRIELKEENGLI  64
            +KVRVFTF   P  ++SY+VG+  GGL   +G + L++ E +TF  +RPRIEL+ +N +I
Sbjct  7    LKVRVFTFPSSPREQNSYVVGTWEGGLLPTVGTLKLDNSECVTFAQLRPRIELQNDNFMI  66

Query  65   RRNP-MFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTE-----DTSSK  118
            R+ P MFQE L  +  + NPHQWP   LQTYW G+++  +   PT+I        D ++ 
Sbjct  67   RQVPLMFQEVLAIIATSPNPHQWPHSALQTYWFGFFEDLEQSVPTMISVRPSCGCDCTNP  126

Query  119  CLRDV----------------LDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQP  162
               D+                L+M ++K T DLI+IPQ+Q+GPVC +CC+ CALCP I+ 
Sbjct  127  STIDIAQWLQVSDEDSPVSTFLNMTTSKQTGDLILIPQTQVGPVCEKCCKGCALCPPIRK  186

Query  163  R  163
            +
Sbjct  187  K  187

>PHALS_11565
Length=162

 Score = 130 bits (326),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 99/162 (61%), Gaps = 3/162 (2%)

Query  2    VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDED--LTFESVRPRIELKE  59
            ++ +KVRVFTF  DP  ++SY+VGS  GG    +G I+++D E   +TF  +R RIEL +
Sbjct  1    MIHVKVRVFTFPSDPQKQNSYVVGSIEGGHLPVVGTILIDDKEATTITFTQLRQRIELLQ  60

Query  60   ENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSKC  119
                IRR+ MFQE L  +  + N H WP   +QTYW GY+  E    P II   D   + 
Sbjct  61   VKDEIRRSAMFQEVLAFIATSPNSHSWPQKFMQTYWFGYFADEGACVPHIITAAD-EIRP  119

Query  120  LRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161
            +    +M ++K   DLI++PQ+QIGPVC QCCQ C +C +++
Sbjct  120  VSQFTNMATSKQICDLILVPQTQIGPVCHQCCQSCKVCLTLK  161

>PYAR_26061
Length=114

 Score = 111 bits (277),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 81/111 (73%), Gaps = 5/111 (5%)

Query  1    MVVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDED--LTFESVRPRIELK  58
            MV+R+KVRVFTF  DP +++SY+VG+  GGL   +G + L+D E   +TF  +RPR+EL+
Sbjct  1    MVLRVKVRVFTFPSDPRLQNSYVVGTMEGGLLPTVGTLSLDDSEKDTVTFAQLRPRLELR  60

Query  59   EENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTI  109
            +++G+IRR+ +FQE L   + +RNPH WP+  LQTYW G++Q   DP+ T+
Sbjct  61   DDDGMIRRSALFQEVLAIASASRNPHGWPVSALQTYWFGFFQ---DPSETV  108

>PHYRA_96081
Length=156

 Score = 92.8 bits (229),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 2/106 (2%)

Query  7    VRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDE--DLTFESVRPRIELKEENGLI  64
            VRVFTF  DP  ++SY+VG+  GGL   +G + L D E   +TFE +R RIEL ++  +I
Sbjct  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106

Query  65   RRNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTII  110
            RR+ MFQE L  +  + NPH WP + +QTYW G+Y  E+D  P +I
Sbjct  107  RRSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVI  152

>PYVX_20859
Length=225

 Score = 60.1 bits (144),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 2/66 (3%)

Query  2   VVRIKVRVFTFSIDPTVEHSYLVgsaagglssaIGMIVLEDDED--LTFESVRPRIELKE  59
           +VR+KVRVFTF  DP  ++SYLVG++ GGL   +G + +ED E   ++F  +RPRIELK 
Sbjct  1   MVRVKVRVFTFPSDPREQNSYLVGTSEGGLLPVVGTLNVEDAEQDTISFSQLRPRIELKN  60

Query  60  ENGLIR  65
           +N ++R
Sbjct  61  DNNMVR  66

>H310_01559
Length=387

 Score = 33.1 bits (74),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (53%), Gaps = 2/51 (4%)

Query  115  TSSKCLRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQPRQT  165
            TS + + D  D     + A ++V+ +SQ+    S C    +LC SI PRQT
Sbjct  93   TSYEVMSD--DTDPASLLAQVVVLDESQLFLSISNCTNGTSLCDSIAPRQT  141

>H257_18862
Length=151

 Score = 30.0 bits (66),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 36/76 (47%), Gaps = 12/76 (16%)

Query  63   LIRRNPMFQEA----LFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIRTEDTSSK  118
            LI+R  MF++     LFQ    +  +      L    L Y+QHE  P    +   D SS 
Sbjct  3    LIKRGSMFKQGSGDGLFQRRNWKKRY----FELTQEDLRYFQHEHGPMKGCL---DLSS-  54

Query  119  CLRDVLDMKSTKVTAD  134
            C +D L+M  TK++ D
Sbjct  55   CTKDSLEMVPTKMSKD  70

>PHALS_03180
Length=127

 Score = 29.6 bits (65),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query  44   EDLTFESVRPRIELKEENGLIR--RNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYY  99
            +DL FE  R R+E +E   +++   +P F   +    +     QWP+   QT +  Y+
Sbjct  46   DDLIFEEFRQRVESREGLAILKDLTDPYFALIMENKDDVFMLGQWPLSREQTEYTNYF  103

>CCI47030
Length=597

 Score = 30.4 bits (67),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query  50   SVRPRIELKEENGLIRR--NPMFQEAL-FQMTEARNPHQWPMHTLQTY  94
            S  PR EL    GLIR   +PM   A  F   E + P + PMH L+T+
Sbjct  498  SANPRDELPPSRGLIRLKFSPMSMLATSFDSFEKKIPEEMPMHQLKTF  545

>SDRG_04068
Length=541

 Score = 30.4 bits (67),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 44/105 (42%), Gaps = 8/105 (8%)

Query  42   DDEDLTF-ESVRPRIELKEENGLIRRNPMFQEALFQMTEARNPHQWPMHTLQTYWLG--Y  98
            D  DLTF E +  RIE    + +    P+ Q          +P   P+H     W+G  Y
Sbjct  394  DGSDLTFMEDLLARIE---RDQIPAHTPIEQRWTASSRAVMSPASSPLHNQVFSWVGIIY  450

Query  99   YQHEDDPTPTIIRTEDTS-SKCLRDVLD-MKSTKVTADLIVIPQS  141
            Y HE  P+   I+      SK   DV+    +T+  A L   P+S
Sbjct  451  YLHEASPSLDAIKDAFVDYSKVFEDVMAPYGATEHWAKLEFAPRS  495

>PYIR_22646
Length=1334

 Score = 30.0 bits (66),  Expect = 7.0, Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 8/76 (11%)

Query  64   IRRNPMFQEALFQMTEARNPHQW------PMHTLQTYWLGYYQHEDDPTPTIIRTEDTSS  117
            +RR P   E+    +E     ++      P+   ++Y LGY QH+   +P +++T   S 
Sbjct  917  VRREPYHHESPRLPSEMVGGARYERSAAPPLERSESYELGYIQHKS--SPGMLQTRSKSH  974

Query  118  KCLRDVLDMKSTKVTA  133
            +  +DV D+     TA
Sbjct  975  ERYQDVRDLSDMSSTA  990

>PHALS_05069
Length=306

 Score = 29.6 bits (65),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 15/56 (27%), Positives = 28/56 (50%), Gaps = 1/56 (2%)

Query  98   YYQHEDDPTPTIIRTEDTSSKCLRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQR  153
            YY+H  +  P I   +++  +C   +L ++  K   D I+   +QI P C++   R
Sbjct  251  YYEHVVNLQPQIYSMDESMKQCTH-LLVLEDPKAATDKIISDLAQIAPFCAKKSSR  305

Lambda      K        H        a         alpha
   0.323    0.136    0.421    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5981562426

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40