Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H257_003251617124024011951e-167
H310_014621617122524010462e-145
SDRG_06607161712202398995e-123
SPRG_05306161712202398987e-123
PYVX_14627161712292467861e-105
PHYSO_538886161712282447852e-105
PPTG_10184161712282447817e-105
PITG_20629161712282447801e-104
PHYKE_10818161712302467791e-104
PYU1_G001971161712222397772e-104
PHYCA_122818161712292457747e-104
PHALS_05193161712282447722e-103
PYIW_17751161712242417703e-103
PYIR_17033161712322427634e-102
PYAR_17130161712272447486e-100
CCI46337161712292457373e-98
CCA17366161712282467182e-95
HYAP_07162161711942377135e-95
PYAP_16586161712532707012e-92
PHYRA_847301617019432337321e-87
HYAP_07161161701881826535e-86
PHYSO_5312751106910631673.3
H257_1689412221033674704.5
PYIW_2766816706413838675.9
PPTG_0067413381276117696.5
CCA177741184121864678.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H257_00325

Length=240
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H257_00325                                                            464     1e-167
H310_01462                                                            407     2e-145
SDRG_06607                                                            350     5e-123
SPRG_05306                                                            350     7e-123
PYVX_14627                                                            307     1e-105
PHYSO_538886                                                          306     2e-105
PPTG_10184                                                            305     7e-105
PITG_20629                                                            305     1e-104
PHYKE_10818                                                           304     1e-104
PYU1_G001971                                                          303     2e-104
PHYCA_122818                                                          302     7e-104
PHALS_05193                                                           301     2e-103
PYIW_17751                                                            301     3e-103
PYIR_17033                                                            298     4e-102
PYAR_17130                                                            292     6e-100
CCI46337                                                              288     3e-98 
CCA17366                                                              281     2e-95 
HYAP_07162                                                            279     5e-95 
PYAP_16586                                                            274     2e-92 
PHYRA_84730                                                           286     1e-87 
HYAP_07161                                                            256     5e-86 
PHYSO_531275                                                          30.4    3.3   
H257_16894                                                            31.6    4.5   
PYIW_27668                                                            30.4    5.9   
PPTG_00674                                                            31.2    6.5   
CCA17774                                                              30.4    8.5   

>H257_00325
Length=240

 Score = 464 bits (1195),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 240/240 (100%), Positives = 240/240 (100%), Gaps = 0/240 (0%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH
Sbjct  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA
Sbjct  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180

Query  181  KGMQAVTDATDSKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGLSSWWVET  240
            KGMQAVTDATDSKPDKHEAPSRRRSSSVDLSDSDPKPAALQIIGTIDEDGLGLSSWWVET
Sbjct  181  KGMQAVTDATDSKPDKHEAPSRRRSSSVDLSDSDPKPAALQIIGTIDEDGLGLSSWWVET  240

>H310_01462
Length=225

 Score = 407 bits (1046),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/240 (88%), Positives = 221/240 (92%), Gaps = 15/240 (6%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVLCRVADVIQVAPELFS+DYSSVLIEEIDRKYANKV+ADVGLCITHYDFIEIGDAY+H
Sbjct  1    MFVLCRVADVIQVAPELFSADYSSVLIEEIDRKYANKVIADVGLCITHYDFIEIGDAYVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSHTDVIFRMVVFRPFIGEILKGKII+CTEEHIRVSM+FMQDIIIPSYAMQNPSFF
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIINCTEEHIRVSMEFMQDIIIPSYAMQNPSFF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            DKTERLWEWKFPGRE               DDQDPYYMYLNEE+RFRVTNINFTRVLKTA
Sbjct  121  DKTERLWEWKFPGRE---------------DDQDPYYMYLNEEVRFRVTNINFTRVLKTA  165

Query  181  KGMQAVTDATDSKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGLSSWWVET  240
             GMQAVT+A D+KPDK E P+RRRSSSVDLSD+DPKPAALQIIGTIDEDGLGLSSWWVE+
Sbjct  166  NGMQAVTEAADTKPDKSENPTRRRSSSVDLSDTDPKPAALQIIGTIDEDGLGLSSWWVES  225

>SDRG_06607
Length=220

 Score = 350 bits (899),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 203/239 (85%), Gaps = 20/239 (8%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVLCR+ADVIQ+APELF +DYSSVL EEIDRKYANKV+ADVGLCIT YDFIEIGDAYIH
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSHT+V+FRMVVF+PFIGE+LKGKIISCTEEHIRVSMDF+QDIIIPSYAMQ PSFF
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            DK ERLWEWKFPG+E               D+QDPYYMYL+EEIRFRVTNINFTRV KTA
Sbjct  121  DKNERLWEWKFPGKE---------------DEQDPYYMYLHEEIRFRVTNINFTRVTKTA  165

Query  181  KGMQAVTDATDSKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGLSSWWVE  239
            KG+QA             A SRRRSSSVDLS+ DPKP+A+QIIGTIDEDGLGLSSWW+E
Sbjct  166  KGIQATVTEAADS-----ASSRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWWIE  219

>SPRG_05306
Length=220

 Score = 350 bits (898),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 203/239 (85%), Gaps = 20/239 (8%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVLCR+ADVIQ+APELF +DYSSVL EEIDRKYANKV+ADVGLCIT YDFIEIGDAYIH
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSHT+V+FRMVVF+PFIGE+LKGKIISCTEEHIRVSMDF+QDIIIPSYAMQ PSFF
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            DK ERLWEWKFPG+E               D+QDPYYMYL+EE+RFRVTNINFTRV KTA
Sbjct  121  DKNERLWEWKFPGKE---------------DEQDPYYMYLHEEVRFRVTNINFTRVTKTA  165

Query  181  KGMQAVTDATDSKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGLSSWWVE  239
            KG+QA             A SRRRSSSVDLS+ DPKP+A+QIIGTIDEDGLGLSSWW+E
Sbjct  166  KGIQATVTEAADS-----ASSRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWWIE  219

>PYVX_14627
Length=229

 Score = 307 bits (786),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 195/246 (79%), Gaps = 26/246 (11%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAPELF +DY+ VL+EEIDRKYANKV+ADVGLCIT +DF+ IGDA+IH
Sbjct  1    MFVLTRLSDVIPVAPELFDADYTQVLVEEIDRKYANKVIADVGLCITLHDFVHIGDAFIH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+                   D Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DSAERLWVWKYS------------------DSQEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQA-VTDATDSKPDK-------HEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLG  232
            KG+QA  T+ATD + D         E+ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGLG
Sbjct  163  KGIQATTTEATDKEQDGGAKNGDMRESLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLG  222

Query  233  LSSWWV  238
            L+SWWV
Sbjct  223  LTSWWV  228

>PHYSO_538886
Length=228

 Score = 306 bits (785),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 195/244 (80%), Gaps = 25/244 (10%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAPELF +DY+ VLIEEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FR+VVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS--EG----------------QEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQA-VTDATD------SKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGL  233
            KG+QA  T+ATD      S  D  ++ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGLGL
Sbjct  163  KGIQATTTEATDKAEKEVSAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGL  222

Query  234  SSWW  237
            SSWW
Sbjct  223  SSWW  226

>PPTG_10184
Length=228

 Score = 305 bits (781),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 194/244 (80%), Gaps = 25/244 (10%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MF L R++DVI VAPELF +DY+ VLIEEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFALTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FR+VVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS--EG----------------QEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQA-VTDATD------SKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGL  233
            KG+QA  T+ATD      S  D  ++ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGLGL
Sbjct  163  KGIQATTTEATDKAEKEVSAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGL  222

Query  234  SSWW  237
            SSWW
Sbjct  223  SSWW  226

>PITG_20629
Length=228

 Score = 305 bits (780),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 194/244 (80%), Gaps = 25/244 (10%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAPELF +DY+ VLIEEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FR+VVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS--EG----------------QEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQA-VTDATD------SKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGL  233
            KG+QA  T+ATD      S  D  ++ +RRRSSSVDLSD+DP P+A+ I+ TIDEDGLGL
Sbjct  163  KGIQATTTEATDKAEKEISAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGL  222

Query  234  SSWW  237
            SSWW
Sbjct  223  SSWW  226

>PHYKE_10818
Length=230

 Score = 304 bits (779),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/246 (66%), Positives = 195/246 (79%), Gaps = 27/246 (11%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAPELF +DY+ VL+EEIDRKYANKV++DVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVISDVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DSAERLWVWKYS--EG----------------QEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQA-VTDATD--------SKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGL  231
            KG+QA  T+ATD        +  D  ++ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGL
Sbjct  163  KGIQATTTEATDKAENEGVVTAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGL  222

Query  232  GLSSWW  237
            GLSSWW
Sbjct  223  GLSSWW  228

>PYU1_G001971
Length=222

 Score = 303 bits (777),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/239 (67%), Positives = 193/239 (81%), Gaps = 19/239 (8%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI V PELF +DY+ VL+EEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM ++EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS--EG----------------QEKFYMDMHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQA-VTDATDSKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGLSSWWV  238
             G+QA  T+A+D    + ++ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGLGLSSWW+
Sbjct  163  NGIQATTTEASDKAASEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWI  221

>PHYCA_122818
Length=229

 Score = 302 bits (774),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 195/245 (80%), Gaps = 26/245 (11%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAPELF +DY+ VL+EE+DRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEVDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS--EG----------------QEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KG-MQA-VTDATD------SKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLG  232
            KG +QA  T+ATD      S  D  ++ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGLG
Sbjct  163  KGSIQATTTEATDKAEKETSAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLG  222

Query  233  LSSWW  237
            LSSWW
Sbjct  223  LSSWW  227

>PHALS_05193
Length=228

 Score = 301 bits (772),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 191/244 (78%), Gaps = 25/244 (10%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI V PELF +DY+ VLIEEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FR+VVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+                   D Q+ ++M L+EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS------------------DGQEKFFMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQA-VTDATDSKP------DKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGL  233
            KG+QA  T+ATD         D   + +R+RSSSVDLSD+DP P+A+ I+GTIDEDGLGL
Sbjct  163  KGIQATTTEATDKSEKEIGAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGL  222

Query  234  SSWW  237
            SSWW
Sbjct  223  SSWW  226

>PYIW_17751
Length=224

 Score = 301 bits (770),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/241 (66%), Positives = 190/241 (79%), Gaps = 21/241 (9%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI V PELF +DY+ VL+EEIDRKYANKVVADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVVADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM ++EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS--EG----------------QEKFYMDMHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQAVTDATDSKP---DKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGLSSWW  237
             G+QA T     K    D  ++ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGLGL+SWW
Sbjct  163  TGIQATTTEASDKAEASDLRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWW  222

Query  238  V  238
            V
Sbjct  223  V  223

>PYIR_17033
Length=232

 Score = 298 bits (763),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 191/242 (79%), Gaps = 24/242 (10%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI V+PELF +DY+ VL+EEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLTRISDVIPVSPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM ++EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS--EG----------------QEKFYMDMHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQAVTD------ATDSKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGLS  234
             G+QA T       AT +  D  ++ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGLGL+
Sbjct  163  TGIQATTTEASDKAATSAAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLT  222

Query  235  SW  236
            SW
Sbjct  223  SW  224

>PYAR_17130
Length=227

 Score = 292 bits (748),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 185/244 (76%), Gaps = 25/244 (10%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAP+LF  DY  VL+EEIDRKYANKV+ADVGLC++ YDF+ IGDA++H
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            P+DGTSH+ V FRMVVFRPF+GE+LKG+I+SC EEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                 + +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DTAERLWVWKYS--EG----------------NEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQAVTDATDSKP-------DKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGL  233
             G+QA T     K        D  ++ +R RS+SVDLS+SDP P+A+ I+GTIDEDGLGL
Sbjct  163  HGIQATTTEASDKTEGARNAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGL  222

Query  234  SSWW  237
            SSWW
Sbjct  223  SSWW  226

>CCI46337
Length=229

 Score = 288 bits (737),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 180/245 (73%), Gaps = 24/245 (10%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI + P LF  DY+ VL EEIDRKY NKV+ADVGLCI+ YDFI IGDA IH
Sbjct  1    MFVLTRISDVIAIHPMLFDGDYTKVLKEEIDRKYCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PS+G SHT V FRM+VFRPFIGE+LKGKI+SC E HIR++M+FMQDI+IPSYA+Q PS F
Sbjct  61   PSEGDSHTQVEFRMIVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW W                  TF D  + ++M LNEEIRFRVTN+NFT+V KTA
Sbjct  121  DTYERLWVW------------------TFTDSAEKFHMDLNEEIRFRVTNVNFTQVHKTA  162

Query  181  KGMQAVTDATDSKPDKHEAP------srrrsssvdlsdsdPKPAALQIIGTIDEDGLGLS  234
            KGMQA T  +  K DK           RRR SSVDLSDSDP P+A+QI+GTIDEDGLGL+
Sbjct  163  KGMQATTSESTEKKDKASLKRGNLDDKRRRLSSVDLSDSDPTPSAMQILGTIDEDGLGLT  222

Query  235  SWWVE  239
            SWW+E
Sbjct  223  SWWIE  227

>CCA17366
Length=228

 Score = 281 bits (718),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 180/246 (73%), Gaps = 24/246 (10%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI + P LF  DY+ VL EEID+K+ NKV+ADVGLCI+ YDFI IGDA IH
Sbjct  1    MFVLARISDVIAIHPMLFDGDYTRVLKEEIDKKFCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PS+G SHT V FRMVVFRPFIGE+LKGKI+SC E HIR++M+FMQDI+IPSYA+Q PS F
Sbjct  61   PSEGDSHTQVEFRMVVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW W                  TF +  + ++M LNEE+RFRVTN+NFT+V KTA
Sbjct  121  DTYERLWVW------------------TFTESGEKFHMDLNEEVRFRVTNVNFTQVHKTA  162

Query  181  KGMQAVTDATDSKPDKHEAP------srrrsssvdlsdsdPKPAALQIIGTIDEDGLGLS  234
            KGMQA T  +  K  K           +RR SSVDLSD+DP P+A+QI+GTIDEDGLGL+
Sbjct  163  KGMQATTIESTDKDGKSTLKGGNIDDRKRRLSSVDLSDNDPTPSAMQILGTIDEDGLGLT  222

Query  235  SWWVET  240
            SWWVET
Sbjct  223  SWWVET  228

>HYAP_07162
Length=194

 Score = 279 bits (713),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 169/237 (71%), Gaps = 45/237 (19%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAP LF +DY+ VLIEEIDRKYANKV+ADVGLC+T YDF+ IGDA++H
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRM+VFRPF+GE+LKG+I+ CT+EHIRVSMDF+QDIIIPSYA+Q PS++
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  E+LW WK+                   D Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DTAEKLWVWKYS------------------DGQEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQAVTDATDSKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTIDEDGLGLSSWW  237
            K      D +D+                      P P+A+ I+G+IDEDGLGLSSWW
Sbjct  163  K------DLSDND---------------------PTPSAIHILGSIDEDGLGLSSWW  192

>PYAP_16586
Length=253

 Score = 274 bits (701),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 187/270 (69%), Gaps = 51/270 (19%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAP+LF  DY  VL+EEIDRKYANKV+ADVGLC++ YDF+ IGDA++H
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCLSIYDFVHIGDAFVH  60

Query  61   PSDGTSHTDVI------------FRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDII  108
            P+DGTSH+ V             FRMVVFRPF+GE+LKG+I+SC EEHIRVSMDF+QDII
Sbjct  61   PADGTSHSQVKRDGSTDARGVVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDII  120

Query  109  IPSYAMQNPSFFDKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRV  168
            IPSYAMQ PS+FD  ERLW WK+   EG                 + +YM L+EEIRFRV
Sbjct  121  IPSYAMQTPSYFDTAERLWVWKYS--EG----------------NEKFYMDLHEEIRFRV  162

Query  169  TNINFTRVLKTAK--------------GMQAV-------TDATDSKPDKHEAPsrrrsss  207
            T+INFTRV KTA               G+QA        T+ T +  D  ++ +R RS+S
Sbjct  163  TSINFTRVTKTAHGGWYVDADGVVGGVGIQATTTEASEKTEGTANAGDMRQSLTRGRSAS  222

Query  208  vdlsdsdPKPAALQIIGTIDEDGLGLSSWW  237
            VDLSDSDP P+A+ I+GTIDEDGLGLSSWW
Sbjct  223  VDLSDSDPTPSAIHILGTIDEDGLGLSSWW  252

>PHYRA_84730
Length=1943

 Score = 286 bits (732),  Expect = 1e-87, Method: Composition-based stats.
 Identities = 151/233 (65%), Positives = 182/233 (78%), Gaps = 25/233 (11%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAPELF +DY+ VL+EEIDRKYANKV+ADVGLCIT YDF+ IGDAY+H
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVLADVGLCITLYDFVSIGDAYVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+++SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRVVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  ERLW WK+   EG                Q+ +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DAAERLWVWKY--SEG----------------QEKFYMDLHEEIRFRVTNINFTRVTKTA  162

Query  181  KGMQA-VTDATD------SKPDKHEAPsrrrsssvdlsdsdPKPAALQIIGTI  226
            KG+QA  T+ATD      S  D  ++ +RRRSSSVDLSD+DP P+A+ I+  +
Sbjct  163  KGIQATTTEATDKAEKEVSAGDMRQSLARRRSSSVDLSDNDPTPSAIHILARL  215

>HYAP_07161
Length=188

 Score = 256 bits (653),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 148/182 (81%), Gaps = 4/182 (2%)

Query  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60
            MFVL R++DVI VAP LF +DY+ VLIEEIDRKYANKV+ADVGLC+T YDF+ IGDA++H
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120
            PSDGTSH+ V FRM+VFRPF+GE+LKG+I+ CT+EHIRVSMDF+QDIIIPSYA+Q PS++
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180
            D  E+LW WK+   +G      +P   +     + +YM L+EEIRFRVTNINFTRV KTA
Sbjct  121  DTAEKLWVWKYSDGQG----EGVPQTWSRCLAVEKFYMDLHEEIRFRVTNINFTRVTKTA  176

Query  181  KG  182
            KG
Sbjct  177  KG  178

>PHYSO_531275
Length=106

 Score = 30.4 bits (67),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 0/31 (0%)

Query  89   IISCTEEHIRVSMDFMQDIIIPSYAMQNPSF  119
            I++C   H R+++  + +I +  YAMQN  F
Sbjct  40   ILACDGGHTRLALRLLDEIDVEEYAMQNHPF  70

>H257_16894
Length=336

 Score = 31.6 bits (70),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 31/74 (42%), Gaps = 10/74 (14%)

Query  93   TEEHIRVSMDFMQDIIIPSYAMQNPSFFDKTERLWEWKFPGREG--IYCYAALPPIPTFV  150
            TE   R+   F QD+ + S             R W+    GR G  I  +  +PP+P+  
Sbjct  267  TEATTRLHPLFDQDMTMESLVA--------VRRAWDAHLSGRGGSRIPPHFVIPPLPSTT  318

Query  151  DDQDPYYMYLNEEI  164
            D   P++ YL   +
Sbjct  319  DSSSPWHAYLTPAV  332

>PYIW_27668
Length=138

 Score = 30.4 bits (67),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 12/38 (32%), Positives = 25/38 (66%), Gaps = 1/38 (3%)

Query  81   IGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPS  118
            + E+ K +  + +++H+ ++MDF Q++  PS A + PS
Sbjct  24   LRELYKNEFAAVSDDHVVLTMDFAQNLTTPS-AAETPS  60

>PPTG_00674
Length=1276

 Score = 31.2 bits (69),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 47/117 (40%), Gaps = 27/117 (23%)

Query  89   IISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF--------------DKTERLWEWK----  130
            ++SC   HIR       D + P    +  S F                TE++W+ +    
Sbjct  403  LVSCGVRHIRFWTLTKGDYVPPPSKEKADSAFYGSTFGGPQRLRPPTPTEKVWKLEGNVP  462

Query  131  -FPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNI---NFTRVLK-TAKG  182
             F GR  +  + +L    TFV+D  P YMY         TNI   +  R++  TAKG
Sbjct  463  SFHGRFEVQDFTSL----TFVNDSPPLYMYDEHSKELVATNITDHSLGRIVAGTAKG  515

>CCA17774
Length=218

 Score = 30.4 bits (67),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 5/64 (8%)

Query  36   NKVVADVGLCITHYDFIEIGDAYIHP-SDGT-SHTDVIFRMVVFRPFIGEILKGKIISCT  93
            N+ +  V LC   ++ I +GD Y H  SD    H  +I   +VF+P  G +LK +I    
Sbjct  43   NETLKGVILC---FNSIHLGDPYGHIISDSPYVHCKIIANALVFQPRQGMLLKAQINKIG  99

Query  94   EEHI  97
              HI
Sbjct  100  SNHI  103

Lambda      K        H        a         alpha
   0.323    0.140    0.434    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 12772225152

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40