Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCI467171114638238219850.0
CCA159051114662039013271e-179
PYAP_22843111464724225672e-67
PYU1_G005962111466244085362e-61
PYVX_20858111466214115292e-60
PYAR_23206111466004175212e-59
PHYCA_535379111466274055213e-59
PITG_13738111466104025115e-58
PHALS_11563111466133955108e-58
PYIW_14754111466164115054e-57
PPTG_09251111466413945022e-56
PHYRA_81674111466163994924e-55
PYIR_15178111466383574864e-54
PHYSO_315018111466364044864e-54
HYAP_08501111463523623882e-42
SPRG_06313111465152343244e-32
SDRG_01805111465192343042e-29
H310_01471111465603992805e-26
H257_00314111465633902682e-24
PHYKE_5842111455501161431e-08
PYIR_134893014831195980.005
PYU1_G0023783014834196870.10
PHYRA_935224694621112800.65
PYAP_1888210250392225790.68
PHYSO_4867664694892103743.0
PHALS_10324113916951654.9
PPTG_02678469488469717.2
CCA2708315771012493677.8
PHALS_0413631325434151717.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCI46717

Length=382
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CCI46717                                                              769     0.0   
CCA15905                                                              515     1e-179
PYAP_22843                                                            223     2e-67 
PYU1_G005962                                                          211     2e-61 
PYVX_20858                                                            208     2e-60 
PYAR_23206                                                            205     2e-59 
PHYCA_535379                                                          205     3e-59 
PITG_13738                                                            201     5e-58 
PHALS_11563                                                           201     8e-58 
PYIW_14754                                                            199     4e-57 
PPTG_09251                                                            197     2e-56 
PHYRA_81674                                                           194     4e-55 
PYIR_15178                                                            191     4e-54 
PHYSO_315018                                                          191     4e-54 
HYAP_08501                                                            154     2e-42 
SPRG_06313                                                            129     4e-32 
SDRG_01805                                                            121     2e-29 
H310_01471                                                            112     5e-26 
H257_00314                                                            107     2e-24 
PHYKE_5842                                                            59.7    1e-08 
PYIR_13489                                                            42.4    0.005 
PYU1_G002378                                                          38.1    0.10  
PHYRA_93522                                                           35.4    0.65  
PYAP_18882                                                            35.0    0.68  
PHYSO_486766                                                          33.1    3.0   
PHALS_10324                                                           29.6    4.9   
PPTG_02678                                                            32.0    7.2   
CCA27083                                                              30.4    7.8   
PHALS_04136                                                           32.0    7.8   

>CCI46717
Length=382

 Score = 769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/382 (100%), Positives = 382/382 (100%), Gaps = 0/382 (0%)

Query  1    MLATIPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAI  60
            MLATIPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAI
Sbjct  1    MLATIPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAI  60

Query  61   LYTTSRLDSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKE  120
            LYTTSRLDSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKE
Sbjct  61   LYTTSRLDSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKE  120

Query  121  ALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVLCVEH  180
            ALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVLCVEH
Sbjct  121  ALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVLCVEH  180

Query  181  RVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAKKKLL  240
            RVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAKKKLL
Sbjct  181  RVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAKKKLL  240

Query  241  DEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDELRLQNTRIAQISDD  300
            DEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDELRLQNTRIAQISDD
Sbjct  241  DEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDELRLQNTRIAQISDD  300

Query  301  TSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIVPWGRNREATHEVYGHIPSESGHk  360
            TSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIVPWGRNREATHEVYGHIPSESGHK
Sbjct  301  TSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIVPWGRNREATHEVYGHIPSESGHK  360

Query  361  kmkgkkknckEVFSTSQRRSYR  382
            KMKGKKKNCKEVFSTSQRRSYR
Sbjct  361  KMKGKKKNCKEVFSTSQRRSYR  382

>CCA15905
Length=620

 Score = 515 bits (1327),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 269/390 (69%), Positives = 308/390 (79%), Gaps = 10/390 (3%)

Query  1    MLATIPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAI  60
             L TIPSVYDPNS+FSRVMQA  EY IQ+L  DLQQLRSLAD  RSCGE+NELPFIE AI
Sbjct  233  FLPTIPSVYDPNSRFSRVMQATNEYLIQLLDSDLQQLRSLADGLRSCGELNELPFIEGAI  292

Query  61   LYTTSRLDSVEVIQDGNEPT--QMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLL  118
            L+TTSRLDS++++ D +E T  QME++N  EG+ +  YS+YQLENGTYV+LHPVNMKCLL
Sbjct  293  LHTTSRLDSIKIVVDDDELTKMQMEELNGTEGRSNSFYSFYQLENGTYVILHPVNMKCLL  352

Query  119  KEALLQSEWKNKISERNGDFD------VKSSSEMAEYALTSVASGAGSSTQHDALPDVVQ  172
            KEALLQSE +NK S RNG+ D      V   SE AE +  SV S  GS TQHDALPD VQ
Sbjct  353  KEALLQSEKRNKTSHRNGEVDDLSDSSVNLPSEAAETSSMSVTSDGGSCTQHDALPDYVQ  412

Query  173  GEVLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQ  232
            GEVL VEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTL S KKEL +RRRQ
Sbjct  413  GEVLSVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLHSLKKELESRRRQ  472

Query  233  REAKKKLLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDELRLQNT  292
            R AK+KLLDEQLD +E++HA P  +  ++D  PS SPR   E + SNLV+EF EL LQN+
Sbjct  473  RAAKQKLLDEQLDDNEIVHASPNCTNISSDATPSISPREGVEPEPSNLVEEFVELHLQNS  532

Query  293  RIAQISDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIVPWGRNREATHEVYGH  352
            RI Q SD++SSSYAT+TRNSGYFPALEG   Q  AS    E+   PWGRNRE T+EV+GH
Sbjct  533  RIDQASDESSSSYATVTRNSGYFPALEGRIVQ--ASVSGHEEANAPWGRNREGTNEVFGH  590

Query  353  IPSESGHkkmkgkkknckEVFSTSQRRSYR  382
              SE+G+K+ KG+KKN KEVFSTSQRRSYR
Sbjct  591  AASETGNKRTKGRKKNSKEVFSTSQRRSYR  620

>PYAP_22843
Length=472

 Score = 223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/422 (36%), Positives = 219/422 (52%), Gaps = 65/422 (15%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +P+VYD  +K++R++++ +EY +Q+ + +++ L +L  E RS G+++ LPF+EEA+  T+
Sbjct  72   LPTVYDEEAKYARILESTKEYVVQLALSEMRDLEALDAECRSSGDIDTLPFVEEAMKATS  131

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKEALLQ  124
             RL   + + D  +        +     D LYS+YQL+NG YVVLHP+N+KCL KE   +
Sbjct  132  GRLAGYDAMTDNTQSANGFQSFDGLATGD-LYSFYQLQNGCYVVLHPLNVKCLTKEFAEK  190

Query  125  SEWKNKISERNGDFDVKSSSEMAEYALTSVASGAG-------SSTQHDALPDVVQGEVLC  177
             + K  +   +           A +A  S    +G       S+  ++ LP+ +QG VL 
Sbjct  191  KDRKPSVDSED--------QITAAWAGASSPPVSGRFDRQPPSAVNYELLPNTIQGRVLD  242

Query  178  VEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKEL----ATRRRQR  233
            VEH VMDD+ Q+RYRFL HLPK+CDFY+CELDLS  LS +T+Q+ K E       RR +R
Sbjct  243  VEHLVMDDDVQKRYRFLGHLPKFCDFYVCELDLSDILSPETIQAFKGEFKKREKVRRAKR  302

Query  234  EAKKKLLDEQLDGDE-------LIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDE  286
            EA+KK     L G E       +   +P    F+ D   ++ P  A    E +L D FD 
Sbjct  303  EAEKKSKKNGLSGAEATTRSSPVFRQMP---AFSLDEGAAHWPAPA----ELSLNDSFDG  355

Query  287  LRLQN-------------------------TRIAQISDDTSSSYATITRNSGYFPALEGS  321
                N                         T    + D    S+ATITRNSGYFP L GS
Sbjct  356  AMQVNDTSGDEELAAALAASSMMSPPFGASTSTYAVEDGVYGSFATITRNSGYFPPLGGS  415

Query  322  TPQAPASAPAFEQPIVPWGRNREATHEVYGHIPS-ESGHkkmkgkkknckEVFSTSQRRS  380
            T    +SAPA   P+  WG +        G  P   +G  K KG  K   ++FST+QRRS
Sbjct  416  TNDT-SSAPATSSPM--WGASSPPLLGARG--PGIVAGGSKKKGAMKKGTQLFSTAQRRS  470

Query  381  YR  382
            YR
Sbjct  471  YR  472

>PYU1_G005962
Length=624

 Score = 211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 153/408 (38%), Positives = 220/408 (54%), Gaps = 39/408 (10%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +PSVYDP + +SR++++ +EY  Q+L+ +++ L +L  E RS G+V+ LPF+EEA+  T+
Sbjct  226  LPSVYDPAATYSRILESSQEYLTQLLLDEMRDLEALDAEFRSSGDVDSLPFVEEAMRATS  285

Query  65   SRL----DSVEVIQDGNEPTQMEDINNAEGKKD-VLYSWYQLENGTYVVLHPVNMKCLLK  119
             RL     S + +  G E     +   + G +D  +YS+YQL NG YVVLHP+NMKCL+K
Sbjct  286  GRLAQNDGSQQSVSSGYEAANEYEAGASSGGEDENVYSFYQLSNGIYVVLHPLNMKCLMK  345

Query  120  EALLQSEWKNKISERNGDFDVKS-----SSEMAEYALTSVASGAGSSTQHDALPDVVQGE  174
            E    +E K K  ER+ D D K      S+  A+    S +S   +  ++D LP+ ++G 
Sbjct  346  E---YAEPKRK--ERDADHDHKDPDDVVSAAWADATSPSSSSELSTGPRYDLLPNTIRGR  400

Query  175  VLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQRE  234
            +L VEH VMD+E Q+RYRFLSHLP++CDFYLCELDLS  LS +TL + + E+  R +QR+
Sbjct  401  ILDVEHVVMDEEMQKRYRFLSHLPRFCDFYLCELDLSGQLSPETLDAFRGEIKKREKQRK  460

Query  235  AKKKLLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAE-----ELKES-NLVDEFDEL-  287
             +++      +      AL   + F+ +    + P  AE       +E  NL   +DE  
Sbjct  461  QRQRSKARSANSPVYKGAL---AGFSIEQEGMSWPAPAEMSLSDAFQEGVNLNGTYDEGD  517

Query  288  RLQNTRIAQISD----------DTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIV  337
             L   +IA  S           D   S+ATITR SGY+P L   T      A   + P V
Sbjct  518  DLAAAQIASTSTSPPSPYYPAYDAEGSFATITRQSGYYPPLSRVTNSEAGEAAHTQSPSV  577

Query  338  PWGRNREATHEV---YGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
             WG               +P   G  K  G  K    +FSTSQ+RSYR
Sbjct  578  -WGAASSPPPLFDLDLDSLPRTKGKGKKGGAGKKGVALFSTSQQRSYR  624

>PYVX_20858
Length=621

 Score = 208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 209/411 (51%), Gaps = 62/411 (15%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +PS+YD  + FSR++++  EY +Q+++ +++ L +L  E RS GEV+ LPF+ EA+  T+
Sbjct  240  VPSIYDSAAAFSRILESTPEYVMQLVLAEMRDLEALDAEHRSSGEVDSLPFVVEAMRATS  299

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKEALLQ  124
             RL  +E    G+  +  + +  A G+   LYS+YQ+ NG+YV+LHP+NMKCLLKE    
Sbjct  300  GRLAQLESSSHGDRDSDDDHVRVATGE---LYSFYQIANGSYVILHPINMKCLLKE----  352

Query  125  SEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSS------TQHDALPDVVQGEVLCV  178
                   S  N       S++    A +     A  S       +H  +PD V+G VL V
Sbjct  353  ------YSPENRVEAAPPSNDQVAEAWSDTGGTAPESHPVLPVDRHHFMPDTVRGRVLDV  406

Query  179  EHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAKKK  238
            EH VMDDESQ+RYRFLSHLP++CD Y+CE+DLS  LS  TL+  + EL  R + R A+ K
Sbjct  407  EHVVMDDESQKRYRFLSHLPRFCDLYVCEIDLSAQLSAATLECFRAELKKREKHRRAEAK  466

Query  239  -------------LLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAE----ELKESNLV  281
                         L   ++DG        ++      + P+ +  ++E     L ES   
Sbjct  467  HRHAEAAARAASPLFASRMDG--------FSIEQEGMMWPAPAELSSEMHELSLDESGGS  518

Query  282  DEFDELRLQNTRIAQISDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIVPWGR  341
            DE   L   +  +  ++ D  SS+ATITR SGYFP L G    +P+   A          
Sbjct  519  DE-AHLSPVSPPLTTLATDDESSFATITRQSGYFPPLGGPAHHSPSLGAAPSS-------  570

Query  342  NREATHEVYGHIPSES----------GHkkmkgkkknckEVFSTSQRRSYR  382
                +   +G  PS S             K K   K    +FST+QRRSYR
Sbjct  571  GSFGSPSAWGAHPSTSPPALDWDAAGRGGKKKAGGKKGVPLFSTTQRRSYR  621

>PYAR_23206
Length=600

 Score = 205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 146/417 (35%), Positives = 221/417 (53%), Gaps = 55/417 (13%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +P+VYD  +K++R++++  EY + + + +++ L  L  E RS G+ + LPF+EEA+  T+
Sbjct  200  LPTVYDEEAKYARILESTHEYLLHLAMDEMRDLEVLDAECRSSGDADTLPFVEEAMKATS  259

Query  65   SRLDSVEVIQDGNEPTQMEDIN----NAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKE  120
             RL + E  Q     +++        +  G  D +YS+YQ +NG YVVLHP+NMKCL +E
Sbjct  260  QRLAAAEANQPVTAESELSSSKFQSLDGLGVSD-MYSFYQQQNGCYVVLHPLNMKCLTRE  318

Query  121  ALLQSEWKNKISERNGDFDVKSSSEM-------AEYALTSVASGAGSSTQHDALPDVVQG  173
                +E     +E + +    +++ +       A   L+S A  +  S  ++ LPD ++G
Sbjct  319  F---AEKVQPSAEADEETQASATTTLEDAWTGAASPPLSSRAEPSVHSPHYELLPDTIEG  375

Query  174  EVLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQR  233
             VL VEH VMDD  Q+RYRFL HLPK+CDFY+CELDLS  LS++TL++ + EL  R +QR
Sbjct  376  RVLDVEHLVMDDAVQKRYRFLGHLPKFCDFYVCELDLSPLLSRETLEAFRPELKKREKQR  435

Query  234  EAKKKLLDEQLDGDELIHA----------------LPYTSTFTNDLIPSNSPRAAEELKE  277
              K     +   G+   HA                 P    F+ +   ++ P  +E    
Sbjct  436  RLKNNADKKSNSGNNSKHANGSAMSRATLAVHYGDHPTLRGFSLEDGEAHWPAPSE---M  492

Query  278  SNLVDEF-DELRLQNTRIAQISD----DTSSSYATITRNSGYFPALEGSTPQAP---ASA  329
             +L D F D L+  +   +  +D    D+ +S+ATITRNSGY+P L GS   AP    S+
Sbjct  493  PSLADAFQDGLQFSSDSASSFTDQVPADSDASFATITRNSGYYPPLGGSASGAPRDVTSS  552

Query  330  PAFEQPIVPWGRNREATHEVYG----HIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
            P+       WG    +T  + G      P   G  K KG  K    +FST+QRRSYR
Sbjct  553  PSM------WG---SSTGPLSGSGAASPPMAPGGGKKKGAMKKGTPLFSTTQRRSYR  600

>PHYCA_535379
Length=627

 Score = 205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 144/405 (36%), Positives = 205/405 (51%), Gaps = 48/405 (12%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +P+V D ++ +SR+++A   Y  ++L  +++ L+S+  E RS G+V+ LPF+EEA+  T+
Sbjct  244  LPNVTDADATYSRILEATPGYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTS  303

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDV--------LYSWYQLENGTYVVLHPVNMKC  116
             RL   +    G       +I N  GKK          LYS+YQL +GTYVVLHP+NMKC
Sbjct  304  GRLAKSDDFTHGTYGANHSNIANVAGKKGKPRDDNSGDLYSFYQLADGTYVVLHPLNMKC  363

Query  117  LLKEALLQSEWKNKISERNGDFDVKSSSEMA-----EYALTSVASGAGSS-----TQHDA  166
            LLKE           S+ +     + S E+A     E A T   S +  S      ++  
Sbjct  364  LLKE----------FSDTHQHEQEEDSQELAHQKELEAAWTQEGSSSAGSEPLPVDRYQL  413

Query  167  LPDVVQGEVLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKEL  226
            LP+ + G VL +EH VMD+E+Q+RYRFLSHLP++CDFY+CELDL+  LS+ TL + + +L
Sbjct  414  LPEQIHGRVLDIEHVVMDEEAQKRYRFLSHLPRFCDFYVCELDLTSQLSQSTLNAFRNDL  473

Query  227  ATRRRQREAKKKLLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDE  286
              R +QR+ K K          +        +   + +   SP       E  L +  +E
Sbjct  474  KKRTKQRKLKMKQQSTPTPSSPIFKRNADAFSLEEEGMMWPSP------YEQALAESLEE  527

Query  287  LRLQNTRIAQI---------SDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIV  337
              L N+   ++         S D   S+A +T NSGYFPAL G  P       AF  P  
Sbjct  528  FHLSNSSSLELEAELHAVSSSTDEERSFARVTENSGYFPALGGVGPSESRDPIAFGSPSA  587

Query  338  PWGRNREATHEVYGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
             WG N   +  V       SG    K   K    VFST+QRRSYR
Sbjct  588  -WG-NPSTSPPVTAW---NSGKGGKKKAGKKGVSVFSTTQRRSYR  627

>PITG_13738
Length=610

 Score = 201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 138/402 (34%), Positives = 211/402 (52%), Gaps = 55/402 (14%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +P+V D ++ +SR+++A  EY  ++L  +++ L+S+  E RS G+V+ LPF+EEA+  T+
Sbjct  240  LPNVDDADAIYSRILEATLEYLRELLYSEMRDLQSMDTEFRSSGDVDNLPFVEEAMRNTS  299

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDV--------LYSWYQLENGTYVVLHPVNMKC  116
             RL   +    G         N+  GKK+          YS+YQ+ +GTYVVLHP+NMKC
Sbjct  300  GRLAKSDDFSHGTYRQANSTNNSTTGKKNTPKDSDSGDTYSFYQIADGTYVVLHPLNMKC  359

Query  117  LLKEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVL  176
            L+KE      + ++  E   D  + + +E +  +   +        ++  LP+ + G++L
Sbjct  360  LMKE------YSDEHQEHGEDTQLTAWTESSSVSSELLPVD-----RYRMLPERIHGKIL  408

Query  177  CVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAK  236
             +EH V+D+E+Q+RYRFLSHLP++CDFY+CELDL+ +LS  TL + + +L  R +QR+ K
Sbjct  409  DIEHVVLDEEAQKRYRFLSHLPRFCDFYICELDLTSHLSSSTLNAFRNDLKKRAKQRKHK  468

Query  237  KK---------LLDEQLDGDELIH-ALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDE  286
             K         +     D   +    + + S +   L        AE L+E NL +   E
Sbjct  469  HKQSAPTPASPIFKRNADAFSIEQEGMMWPSPYEQAL--------AESLEEFNLSNTSVE  520

Query  287  LRLQNTRIAQISDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIV-----PWGR  341
            L  ++T       D   S+A +T NSGYFPAL G+ P  P   P    PI       WG 
Sbjct  521  LEAEHTEA-----DEEQSFARVTENSGYFPALGGAAPIEP--RPHVTDPIAFGSPSAWGN  573

Query  342  NREATHEV-YGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
               +   V +G     SG    K   K    VFST+QRRSYR
Sbjct  574  TSTSPPAVAWG-----SGKGAKKKAGKKGVSVFSTTQRRSYR  610

>PHALS_11563
Length=613

 Score = 201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 139/395 (35%), Positives = 211/395 (53%), Gaps = 39/395 (10%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +P+V D ++ +SR+++A  EY  ++L+ +++ L+S+  E +S G+V+ LPF+ EA+  T+
Sbjct  241  LPNVNDADATYSRILEATPEYLRELLLAEMRVLQSMDAEFQSSGDVDNLPFVNEAMRNTS  300

Query  65   SRLDSVEVIQDG--NEPTQM----EDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLL  118
             RL   +    G   +P       + I   E   + +YS+YQ+ NGTYV+LHP+NMKCLL
Sbjct  301  ERLSISDDCSRGTYGKPVTTFASDQSIKPLEHGTNDMYSFYQIANGTYVILHPLNMKCLL  360

Query  119  KEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGS----STQHDALPDVVQGE  174
            KE   + E +N +       +VK      E   T+  S A S    + ++  +P+ V G 
Sbjct  361  KEYTDELEHENAV-------EVK-----MESTWTTETSCANSRSPPANRYHLVPEQVHGR  408

Query  175  VLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQRE  234
            VL +EH +MD+E+Q+R+RFLSHLP++CDFY+CELDLS  LS+ TL + K +L  R +QRE
Sbjct  409  VLDIEHFIMDEEAQKRFRFLSHLPRFCDFYICELDLSSQLSRSTLSAFKNDLKKRAKQRE  468

Query  235  AKKKLLDEQLDGDELIHALPYTSTFTNDLIPSNSP---RAAEELKESNLVDEFDELRLQN  291
             K KLL+       +  +   T +  ++     SP     AE +++ +L   F    L  
Sbjct  469  HKLKLLNTPTFSSPMYKSKVQTFSLQHENTHWPSPYEQTLAESVEDFHLSSSFASDLLTE  528

Query  292  TRIAQISDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIV----PWGRNREATH  347
                   +D   S+A IT NSGYFPAL G  P   +  P+          PWG    +  
Sbjct  529  DETTTSFEDDERSFARITENSGYFPAL-GDAPSNESRHPSENSTASGSSHPWGNTISS--  585

Query  348  EVYGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
                   + +G    K   K    VFST+QRRSYR
Sbjct  586  -------NVAGRGSKKKGGKKGISVFSTTQRRSYR  613

>PYIW_14754
Length=616

 Score = 199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 146/411 (36%), Positives = 216/411 (53%), Gaps = 43/411 (10%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +PSVYDP + FSR+++A +EY   +L+ +++ L++L  E RS G+V+ LPF++EA+  T+
Sbjct  216  LPSVYDPAATFSRILEATQEYLTHILLDEMRDLQALDAEFRSSGDVDSLPFVDEAMRATS  275

Query  65   SRL---DSVEVIQDGNEPTQMEDINNAEGKKDV------LYSWYQLENGTYVVLHPVNMK  115
             RL   D  E  Q G  P + +      GK         +YS+YQ  NG YVVLHP+NMK
Sbjct  276  GRLAHNDGGE--QQGGSPPENDTPRRGGGKAATDSSSSEVYSFYQQANGIYVVLHPLNMK  333

Query  116  CLLKE-ALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGE  174
            CLLKE A  + +   ++  R+    + + +     A TS    AG   ++D LP+ + G 
Sbjct  334  CLLKEFAEPKPKDVEELEVRDEVSAIWAEASSLASASTSEIPVAG--VRYDLLPERIHGR  391

Query  175  VLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQRE  234
            VL +EH VMDDE Q+RYRFLSH+P++CDFYLCELDLS  LS  T+ + + E+  R RQR+
Sbjct  392  VLEIEHVVMDDEMQKRYRFLSHMPRFCDFYLCELDLSELLSPATVSAFRGEIKKRERQRK  451

Query  235  AKKKLLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDE-LRLQNTR  293
             K++  D+ ++   +        +   + +   +P       E +L D F+E L L    
Sbjct  452  QKQRSKDKPVNSSPIYKGALSGFSLEQEGMAWPAP------AEMSLSDAFEESLSLHENG  505

Query  294  IA------QISDDTS-----------SSYATITRNSGYFPALEGSTPQAPASAPAF---E  333
             A       + + TS            S+ATITR SGY+P L  +      + PAF    
Sbjct  506  AAGEANSRAVIESTSPQSPYFGSSDEGSFATITRQSGYYPPLSRAASSDTNTRPAFGDYA  565

Query  334  QPIVPWG--RNREATHEVYGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
            Q  + WG   +     ++        G    KG  K    +FSTSQ+RSYR
Sbjct  566  QSPLAWGVTASPPPLFDLDLDSLLRKGKGGKKGSGKKGVSLFSTSQQRSYR  616

>PPTG_09251
Length=641

 Score = 197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 143/394 (36%), Positives = 211/394 (54%), Gaps = 33/394 (8%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +P+V D ++ +SR+++A  EY  ++L  +++ L+S+  E RS G+V+ LPF+EEA+  T+
Sbjct  265  LPNVNDVDAIYSRILEATPEYLRELLYSEMRDLQSMDTEFRSSGDVDSLPFVEEAMRNTS  324

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDV--------LYSWYQLENGTYVVLHPVNMKC  116
             RL   +    G         N+  GKK           YS+YQ+ +GTYVVLHP+NMKC
Sbjct  325  GRLAKSDDFSHGTYRQANSASNSTAGKKSTPKENGSGDAYSFYQIADGTYVVLHPLNMKC  384

Query  117  LLKEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVL  176
            LLKE    S+      E   D  +    E A    +S ++      ++  LP+ + G+VL
Sbjct  385  LLKE---YSDEHQHEQEHGEDAHL----EAAWIESSSASAEPLPVDRYHLLPERIHGKVL  437

Query  177  CVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAK  236
             +EH VMD+E+Q+RYRFLSHLP++CDFY+CELDL+  LS  TL + + +L  R +QR+ K
Sbjct  438  DIEHVVMDEEAQKRYRFLSHLPRFCDFYICELDLTSQLSSSTLNTFRNDLKKRAKQRKHK  497

Query  237  KKLLDEQLDGDELI--HALPYTSTFTNDLIPSNSPRA-AEELKESNLVDEFDELRLQNTR  293
             K  +  +    +   +A  ++      + PS   +A AE L+E +L +   EL  ++  
Sbjct  498  HK-QNAPIPSSPIFKRNADAFSLQEEGMMWPSPYEQALAESLEEFHLSNSSVELDAEHHS  556

Query  294  IAQISDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIV-----PWGRNREATHE  348
             A    D   S+A +T NSGYFPAL G+  + P   P    PI       WG    +   
Sbjct  557  AA----DEERSFARVTENSGYFPALGGAAAREP--RPHVTDPIAFGSPSAWGNASTSPPA  610

Query  349  VYGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
            V     S     K KG  K    VFST+QRRSYR
Sbjct  611  VAW---SSGKGGKKKGAGKKGVSVFSTTQRRSYR  641

>PHYRA_81674
Length=616

 Score = 194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 145/399 (36%), Positives = 216/399 (54%), Gaps = 40/399 (10%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +PS+ D ++ +SR+++A   Y  ++L  +++ L+S+  E RS G+V+ LPF+EEA+  T+
Sbjct  237  LPSINDVDATYSRILEATPAYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTS  296

Query  65   SRLDSVEVIQDG------------NEPTQMEDIN-NAEGKKDVLYSWYQLENGTYVVLHP  111
             RL   +    G            N P   E  + NA G+    YS+YQ+ +GTYVVLHP
Sbjct  297  GRLAKSDDFSHGTYGSSHTYNMNSNTPVAKEKPHENASGEA---YSFYQIADGTYVVLHP  353

Query  112  VNMKCLLKEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSST-----QHDA  166
            +NMKCLL+E     E ++++  R+ + D +   EM E A T  A+ + SS      ++  
Sbjct  354  LNMKCLLRE--YSDEHQHELEGRHEE-DARQK-EM-EAAWTQEANSSASSELLPADRYHL  408

Query  167  LPDVVQGEVLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKEL  226
            LP+ + G VL +EH VMD+E  +RYRFLSHLP++CDFY+CELDL+  LS  TL   + EL
Sbjct  409  LPERIHGRVLDIEHVVMDEEVLKRYRFLSHLPRFCDFYICELDLTSQLSPSTLNLFRNEL  468

Query  227  ATRRRQREAKKKLLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDE  286
              R +QR+ K++  +       +  +     +   + +   SP       E  + +  +E
Sbjct  469  KKRTKQRKQKQRQQNATTPSSPIFKSNAAAFSLEQEGMTWPSP------YEQAIAESLEE  522

Query  287  LRLQNTRI--AQISDDTSSSYATITRNSGYFPALEGSTPQAPASAP-AFEQPIVPWGRNR  343
              L N+ +  A +S D  SS+A +T NSGYFPAL G  P+ P + P AF  P   WG   
Sbjct  523  FHLSNSELDSAAVSPDVESSFARVTENSGYFPAL-GGEPRTPVADPIAFGSPAA-WG---  577

Query  344  EATHEVYGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
             A+              K KG  K    VFST+QRRSYR
Sbjct  578  NASTSPPAAAWGSGKGGKKKGAGKKGVSVFSTTQRRSYR  616

>PYIR_15178
Length=638

 Score = 191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 131/357 (37%), Positives = 188/357 (53%), Gaps = 39/357 (11%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +PSVYDP + +SR++++ REY   +L+ +++ L +L  E  S G+V+ LPF+EEA+  T+
Sbjct  233  LPSVYDPAATYSRILESNREYLTHILMDEMRDLEALDAEFHSSGDVDSLPFVEEAMRATS  292

Query  65   SRL-------DSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCL  117
             RL              D N    M   + A+   +V YS+YQL NG YVVLHP+NMKCL
Sbjct  293  GRLAQNGSGKGQGPPDNDTNRSGAMTSGSKADSGSEV-YSFYQLANGIYVVLHPLNMKCL  351

Query  118  LKE-ALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVL  176
            LKE A  + + ++++ ER+      + +     A +S     G   ++D LP+ + G VL
Sbjct  352  LKEFAEPKPKEEDEVQERDEVNAAWAEASSLSSASSSDTPAVG--VRYDLLPERIHGRVL  409

Query  177  CVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAK  236
             VEH VMDDE Q+RYRFLSHLPK+CDFYLCELDLS +LS  TL + + E+  R RQR+ K
Sbjct  410  DVEHVVMDDEMQKRYRFLSHLPKFCDFYLCELDLSEFLSPATLGAFRGEIKKRERQRKQK  469

Query  237  KKLLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDE----------  286
            +K    +     +        +   + +   +P       E +L D F+E          
Sbjct  470  QKSKQSKSANSPIYKGAMSGFSLEQEGMAWPAP------AEMSLSDAFEESVSLNDHHNG  523

Query  287  ---------LRLQNTRIAQISDDTSSSYATITRNSGYFPALE---GSTPQAPASAPA  331
                     L   + +         SS+ATITR SGY+P L     S   AP SA A
Sbjct  524  GEHDHHHANLESTSPQSPYFGSYDESSFATITRQSGYYPPLSRAGSSDSGAPTSAAA  580

>PHYSO_315018
Length=636

 Score = 191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 149/404 (37%), Positives = 219/404 (54%), Gaps = 37/404 (9%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +P V D ++ +SR+++A  +Y  ++L  +++ L+S+  E RS G+V+ LPF+EEA+  T+
Sbjct  244  LPRVDDVDATYSRILEATPDYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTS  303

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDVL--------------YSWYQLENGTYVVLH  110
             RL   +    G   +     NNA G                   YS+YQ+ NGTYVVLH
Sbjct  304  GRLAKSDDFSHGTYGSN--HANNAIGSGSATGVKGKPHQNEGGDAYSFYQIANGTYVVLH  361

Query  111  PVNMKCLLKEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSST-QHDALPD  169
            P+NMKCLLKE     E ++++   +GD    +  +  E A T  AS       ++  LP+
Sbjct  362  PLNMKCLLKE--YSDEHQHELEGDHGD---DAHQKELEAAWTPSASSEPLPVDRYHLLPE  416

Query  170  VVQGEVLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATR  229
             ++G VL +EH VMD+E+Q+RYRFLSHLP++CDFY+CELDL+  LS  TL S + +L  R
Sbjct  417  QIRGRVLDIEHVVMDEEAQKRYRFLSHLPRFCDFYICELDLTSQLSPSTLNSFRNDLKKR  476

Query  230  RRQREAKKKLLDEQLDGDELI--HALPYTSTFTNDLIPSNSPRA-AEELKESNLVD----  282
             +QR+ K++  +       +   +A  ++      + PS   +A AE L+E +L +    
Sbjct  477  AKQRKQKQRQQNAPSPSSPIFKSNAAAFSLEQEGMMWPSPYEQALAESLEEFHLTNASSV  536

Query  283  EFD-ELRLQNTRIAQISDDTSSSYATITRNSGYFPALEG--STPQAPASAP-AFEQPIVP  338
            EF+ E+    T  +  SDD   S+A +T NSGYFP L G  S  +A  + P AF  P   
Sbjct  537  EFEGEVHAAATPASPYSDDVGRSFARVTENSGYFPVLGGGPSETRAHVTDPIAFGSPAA-  595

Query  339  WGRNREATHEVYGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
            WG    +   V     S     K KG  K    VFST+QRRSYR
Sbjct  596  WGNPSTSPPAVAW---SSGKGGKKKGAGKKGVSVFSTTQRRSYR  636

>HYAP_08501
Length=352

 Score = 154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 128/362 (35%), Positives = 187/362 (52%), Gaps = 23/362 (6%)

Query  34   LQQLRSLADESRSCGEVNELPFIEEAILYTTSRLDSVEVIQDGNEPTQMEDINNA-----  88
            ++ L+S+  E RS G++  LPF+EEA+  T+ RL +       NE  +   I        
Sbjct  1    MRDLQSMDAEFRSSGDIENLPFVEEALQCTSERL-AKSADARKNETHRSITIPRVKGELE  59

Query  89   EGKKDVLYSWYQLENGTYVVLHPVNMKCLLKEALLQSEWKNKISERNGDFDVKSSSEMAE  148
            EG     YS+YQ+ NGTYV+LHP+N+KCLLKE   Q + + +    N   D   +   A 
Sbjct  60   EGGSGDAYSFYQIANGTYVILHPLNVKCLLKEFSDQKQPQQQGESIN---DAHKTDLEAV  116

Query  149  YALTSVASGAGSSTQHDALPDVVQGEVLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCEL  208
            +     +S      ++  LP+ + G VL +EH VM+DE+ +RYRFLSHLP++CDFY+CEL
Sbjct  117  WIQEVASSETIRPNRYHLLPERISGRVLDIEHMVMNDEALKRYRFLSHLPRFCDFYICEL  176

Query  209  DLSHYLSKKTLQSSKKELATRRRQREAKKKLLDEQLDGDELIH--ALPYTSTFTNDLIPS  266
            DL+  LS  TL + + EL  R +QR+ K KL         +    A  ++      + PS
Sbjct  177  DLTSQLSPPTLNAFQNELKKRSKQRKQKLKLHSATTPLSPIAKRDASAFSLEQEGTMWPS  236

Query  267  NSPRAAEELKESNLVDEF--DELRLQNTRIAQISDDTSSSYATITRNSGYFPALEG-STP  323
               +A  E  E   +DEF  D    ++   A + ++   S+  +T NSG FPAL G ST 
Sbjct  237  PYEQALIESMEDIALDEFSLDTAEQESQSYASVVEEEQQSFERVTENSGLFPALGGASTS  296

Query  324  QA---PASAPAFEQPIVPWGRNREATHEVYGHIPSESGHkkmkgkkknckEVFSTSQRRS  380
             A    +++  F  P   WG    +   V     + +  KK KG  K    +FST+QRRS
Sbjct  297  DARPFGSNSIVFGSPSA-WGSASSSPPAV-----AWTPGKKKKGAGKKGVSLFSTTQRRS  350

Query  381  YR  382
            YR
Sbjct  351  YR  352

>SPRG_06313
Length=515

 Score = 129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 121/234 (52%), Gaps = 48/234 (21%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +PSV+  + +FSR+++A   Y  +++  +L  L+ L  E+ S GE N LP I+E I +  
Sbjct  221  VPSVHSDDGRFSRILEASASYLREMVEGELLDLQRLHVEAESSGERNMLPVIQEGITFCE  280

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKEALLQ  124
             +L+  +     + P +  D + +E     LY++YQL NG  V LHP+ M+CL KE    
Sbjct  281  KQLEK-QGSASASVPIKTSDDDASE-----LYTFYQLANGHTVFLHPITMRCLAKEF---  331

Query  125  SEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVLCVEHRVMD  184
                                                    DALP  + G+VL +EH VM+
Sbjct  332  ---------------------------------------GDALPSSLGGKVLELEHVVMN  352

Query  185  DESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAKKK  238
            D++++R+RFLSHLP  CDFYL E++L   +S +TL   + +L  R R R+AKK+
Sbjct  353  DDARKRFRFLSHLPGLCDFYLAEIELKDTVSPETLLHFQSDLKKRARARQAKKR  406

>SDRG_01805
Length=519

 Score = 121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 117/234 (50%), Gaps = 47/234 (20%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +PSV+  + +FSR+++A   Y  +++  +L  L+ L  E+ S GE N LP I+E I +  
Sbjct  224  VPSVHSDDGRFSRILEASASYLREMVEGELLDLQRLYVEAESSGERNMLPVIQEGITFCE  283

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKEALLQ  124
             +L+        +      D + +E     LY++YQL +G  V LHP+ M+CL KE    
Sbjct  284  KQLEKQASASIASASITTSDDDASE-----LYTFYQLASGHTVFLHPITMRCLTKEF---  335

Query  125  SEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVLCVEHRVMD  184
                                                    DALP  + G+VL +EH VM+
Sbjct  336  ---------------------------------------GDALPSSLSGKVLELEHVVMN  356

Query  185  DESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAKKK  238
            D++++R+RFLSHLP   DFYL E++L   +S +TL   + +L  R R R+AKK+
Sbjct  357  DDARKRFRFLSHLPGLGDFYLAEIELKDTVSPETLLHFQSDLKKRARARQAKKR  410

>H310_01471
Length=560

 Score = 112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 98/399 (25%), Positives = 173/399 (43%), Gaps = 76/399 (19%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            IPSV+  N+ +SR++++   Y   ++  ++  L +LA E++S G+ + LP ++EA+ Y  
Sbjct  217  IPSVHCSNAAYSRILESTPSYLQAMIEFEMHDLHTLAAEAQSSGDDHALPVVQEALAYCE  276

Query  65   SRLDSVEVIQ----DGNEPTQMEDINNAEGKKDVL--------YSWYQLENGTYVVLHPV  112
             RL  +        DG        ++ +   K  +        Y++YQL NG   +LHP+
Sbjct  277  KRLAKLFATTSSEGDGVAADASGIVSRSAATKAAIDASDDEPPYTFYQLHNGHTAILHPL  336

Query  113  NMKCLLKEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHD-ALPDVV  171
             M+ L +E                                           HD + P  +
Sbjct  337  CMRALTRE-----------------------------------------FGHDNSFPYDI  355

Query  172  QGEVLCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRR  231
               VL +EH VM+D+ ++R+R+++HLP +CD +L E+DL+  +S  T+   + E   R R
Sbjct  356  TATVLEIEHVVMNDDVRKRFRYMAHLPSHCDLFLVEVDLAGIVSPDTMSHFQTEFKKRAR  415

Query  232  QREAKK---KLLDEQLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDELR  288
             R+  K   KL  ++   D    +L       ND   ++ P+  + +      D+  EL 
Sbjct  416  ARQLAKRHQKLDKKKTRSDSFEVSLMLQLALDND---THYPQ-LQNVAVGAPPDKDGELE  471

Query  289  LQNTRIAQISDDTSSSYATITRNSGYFPAL-----EGSTPQAPASAPAFEQPIVPWGRNR  343
              +T      +   +++A++T N GY+PA      +G++   P          VP+  + 
Sbjct  472  RFDTPDESPYNSPYATFASVTTNQGYYPAFNVGGRDGTSMSTPGWPNVGSAMAVPFNLD-  530

Query  344  EATHEVYGHIPSESGHkkmkgkkknckEVFSTSQRRSYR  382
            E   E+  +     G             +F+TSQRRSYR
Sbjct  531  ELQKELGPNGKKAKG---------KGVSLFATSQRRSYR  560

>H257_00314
Length=563

 Score = 107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 100/390 (26%), Positives = 168/390 (43%), Gaps = 64/390 (16%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            IPSV+  N+ FSR++++   Y   ++  + + L +LA E++S G+ + LP I+EA+ Y  
Sbjct  226  IPSVHGANAVFSRILESTPSYLESMIQSETEDLDALAAEAKSSGDDHALPVIQEALAYCE  285

Query  65   SRLDSVEVIQDG-NEPT--------QMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMK  115
             RL  +       +EP         +     +   +++  YS+YQL+NG   +LHP+ ++
Sbjct  286  KRLAKLRGPSTAPDEPVPTTTAKATKKTSSPSEHEEEEAPYSFYQLDNGHAAILHPLCLR  345

Query  116  CLLKEALLQSEWKNKISERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEV  175
             L +E                                      GS+    + P  +   V
Sbjct  346  ALTREF-------------------------------------GST---HSFPHTITATV  365

Query  176  LCVEHRVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREA  235
            L +EH V+ D+ +RR+R+++HLP +CD +L E+DLS  +S  T      ++  R R R+A
Sbjct  366  LEIEHMVVTDDVRRRFRYMAHLPSHCDLFLVEVDLSPVVSPATYSHFYSDIKKRARGRQA  425

Query  236  KKKLLDE---QLDGDELIHALPYTSTFTNDLIPSNSPRAAEELKESNLVDEFDELRLQNT  292
            K+    +   Q   D     L       ND    + P     L+++   D+    RL + 
Sbjct  426  KRHPHHDKKPQPRSDSFDMCLMLQLALDND---DHYP----HLQDTAASDDKTSRRLDDE  478

Query  293  RIAQISDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIVPWGRNREATHEVYGH  352
                      +S+A +T N GY+P+          +A A       W  N   + +V   
Sbjct  479  GATGDYSSPYASFANVTTNQGYYPSFNADGDDRRPAAAAAPG----WP-NVNGSTDVPFD  533

Query  353  IPSESGHkkmkgkkknckEVFSTSQRRSYR  382
            I       +   K K    +F+TSQRRSYR
Sbjct  534  IDELKKESQQGKKAKKGVSLFATSQRRSYR  563

>PHYKE_5842
Length=550

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 1/116 (1%)

Query  5    IPSVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTT  64
            +PSV D ++ +SR++++  EY  ++L  +++ L+S+  E RS G+V+ LPF+EEA+  T+
Sbjct  81   LPSVNDADATYSRILESTPEYLKELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTS  140

Query  65   SRLDSVEVIQDGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKE  120
             RL        G         N+A     V       EN     L P  + C   E
Sbjct  141  GRLAKSGDFAQGTHGGH-HAANHANSTSGVSKEKTHHENDLTSQLSPSTLNCFHNE  195

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 25/54 (46%), Gaps = 6/54 (11%)

Query  298  SDDTSSSYATITRNSGYFPALEG----STPQAPASAP-AFEQPIVPWGRNREAT  346
            S D   S+A +T NSGYFPAL      S     AS P  F  P   WG    +T
Sbjct  269  STDQEGSFARVTENSGYFPALGSEAGESRAHGTASGPFGFGSPSA-WGSANPST  321

>PYIR_13489
Length=831

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 88/195 (45%), Gaps = 18/195 (9%)

Query  19   MQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPF--IEEAI--LYTTSRLDSVEVIQ  74
             + PR   +QV+V  +     + D  R+   V+ELP+  IE  +  +Y  + L +V +++
Sbjct  82   FEPPRPSLVQVIVTLIAYFLLITDIPRAGSSVDELPYKQIEPNVYSMYGPTILPTVTLVR  141

Query  75   --DGNEPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKEALLQSEWKNKIS  132
              D  +PT+   I++      V  + ++ E  +Y       ++ +L E +    W   ++
Sbjct  142  TFDAADPTK-STISSPTNSNGVSTASFKFETSSY------GLRSILAERVDSMTWPKCMA  194

Query  133  ERNGDFD----VKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVLCVEHRVMDDESQ  188
              +   D    +    EM E  + ++   AG++T + ++ D+ Q   L  ++  ++  + 
Sbjct  195  NYDETCDDVLALDLVFEMIENLVETIVDNAGNTTSYKSMSDLTQ-STLGAQYSSLNGSTV  253

Query  189  RRYRFLSHLPKYCDF  203
                +LS LP+   F
Sbjct  254  ITREYLSTLPQRVRF  268

>PYU1_G002378
Length=834

 Score = 38.1 bits (87),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 41/196 (21%), Positives = 84/196 (43%), Gaps = 19/196 (10%)

Query  19   MQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPF--IEEAIL--YTTSRLDSVEVIQ  74
             + PR   +QV+V  +     + D  R+   V+++PF  IE  +   Y  + L ++ +++
Sbjct  76   FEPPRVSLVQVVVTLIAYFLFVTDIPRAGSSVDDVPFKQIEPNVYSNYGPTILPTMTLVR  135

Query  75   DGN---EPTQMEDINNAEGKKDVLYSWYQLENGTYVVLHPVNMKCLLKEALLQSEWKNKI  131
              N    PT    ++   G   V  + ++    +Y       M+ +L E      W   +
Sbjct  136  TANANSNPTTYTLMSPTHG-DGVSPTAFKYATSSY------GMRAILAERTDDMHWPACM  188

Query  132  S----ERNGDFDVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVLCVEHRVMDDES  187
            S    E N    + ++  M E  +T++   A ++T +  + DV Q  +L  ++  ++  +
Sbjct  189  SRYDDECNATLSLATAFAMLESLVTTIRDNAANTTSYKTMSDVTQ-SLLGAQYGSLNGST  247

Query  188  QRRYRFLSHLPKYCDF  203
                 +LS LP+   F
Sbjct  248  VITREYLSTLPQRVRF  263

>PHYRA_93522
Length=621

 Score = 35.4 bits (80),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 60/112 (54%), Gaps = 14/112 (13%)

Query  29   VLVKDLQQLRSLADESRSCGEVNELPFIEEAILYTTSRLDSVEVIQDGNEPT-QMEDINN  87
            V  K L+QLR++ D  R+ G+   LP     + YT S+L  ++++  G+E +   E + N
Sbjct  403  VKAKSLEQLRTIYDTWRTSGDTKHLP-----LQYTLSQL--LQLVIKGSETSINPEPLKN  455

Query  88   AEGKKDVLYSWYQLENGTYVVLHPVN------MKCLLKEALLQSEWKNKISE  133
              GKK+ +++ +  ++    +L+ V       ++ +  E L+Q +++ ++ E
Sbjct  456  VMGKKNAMFATHFQQDAHEFLLNLVTEYEKELVETIELETLIQKQFETEVLE  507

>PYAP_18882
Length=392

 Score = 35.0 bits (79),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 84/225 (37%), Gaps = 41/225 (18%)

Query  139  DVKSSSEMAEYALTSVASGAGSSTQHDALPDVVQGEVLCVEHRVMDDESQRRY---RFLS  195
            DV + +E   +A  ++A+    ST HD L            H+  D   Q      R L+
Sbjct  187  DVNAWNEFCAHANENIAT----STAHDLLTHFTGNP----WHKAQDKAEQVGIVLARVLA  238

Query  196  HLPKYCDFYLCELDLSHYLSKKTLQSSKKELATRRRQREAKKKLLDEQLDGDELI-HALP  254
              P +C      L L H L    + S+ +ELA R RQ        +  L G+ L+ +AL 
Sbjct  239  SRPSFCRGRKLSL-LGHSLGGAVIYSTLQELA-RLRQ--------EGSLIGEPLVQNALF  288

Query  255  YTSTFTNDLIPSNSPRAAEELKESNLVDEFDELRLQNTRIAQISDDTSSSYATITRNSGY  314
            +   F   L P       +E+  S  V      R          DD  S    + +    
Sbjct  289  FAGAFV--LTPKGLTCMGQEVSRSGKVINIFSRR----------DDVLSKLFWVIQ----  332

Query  315  FPALEGSTPQAPASAPAFEQPIVPWGRNREATHEVYGHIPSESGH  359
               L G+ P A   AP     +V  G N E +  V   +P++ GH
Sbjct  333  ---LHGNDPVAAGCAPIDYCGVVQHGVNVEVSDLVPPRVPNQFGH  374

>PHYSO_486766
Length=892

 Score = 33.1 bits (74),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 54/103 (52%), Gaps = 15/103 (15%)

Query  2    LATIP----SVYDPNSKFSRVMQAPREYFIQVLVKDLQQLRSLADESRSCGEVNELPFIE  57
            LA +P    +V D N+    +++ P+     V  K L+QL+++ D+ R+ G+   LP   
Sbjct  404  LAALPEFVSAVQDENNLLKIILKQPQS---SVRAKSLEQLKAVFDDWRTSGDTKHLP---  457

Query  58   EAILYTTSRLDSVEVIQDGNEPT-QMEDINNAEGKKDVLYSWY  99
              + YT  +L  + ++ +G+E +   E +    GKK+ +++ +
Sbjct  458  --LQYTLGQL--LHLVINGSETSINPEPLKAVMGKKNAIFATH  496

>PHALS_10324
Length=69

 Score = 29.6 bits (65),  Expect = 4.9, Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (2%)

Query  297  ISDDTSSSYATITRNSGYFPALEGSTPQAPASAPAFEQPIVPWGRNREATH  347
            +S  +++S A I  N G FP ++GS P    SAP  + P  P  R     H
Sbjct  1    MSAASNTSAAGICTN-GLFPVIQGSGPPLRGSAPNAKTPNRPRDRRERIFH  50

>PPTG_02678
Length=884

 Score = 32.0 bits (71),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 36/69 (52%), Gaps = 6/69 (9%)

Query  31   VKDLQQLRSLADESRSCGEVNELPFIEEAILYTTSRLDSVEVIQDGNEPTQMEDINNAEG  90
            VK ++QL+++ D  R+ G+   LP     + YT S+L   +VI         E + N  G
Sbjct  418  VKTMEQLKTIFDNWRTSGDTKHLP-----LQYTLSQLLQ-QVINGSETSINPEPLKNIMG  471

Query  91   KKDVLYSWY  99
            KK+ +++ +
Sbjct  472  KKNPIFATH  480

>CCA27083
Length=124

 Score = 30.4 bits (67),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 46/93 (49%), Gaps = 7/93 (8%)

Query  96   YSWYQLENGTYVVLHPVNMKCLLKEALLQS--EWKNKISERNGDFDVKSSS----EMAEY  149
            Y +  ++  +Y  L P  M   +KE+LL++  +WK ++SE+  D D ++SS    E+ E 
Sbjct  21   YYYNMVQGRSYWNLSPEVM-SQVKESLLKTARQWKTELSEKENDIDRQTSSKAGNEIEEN  79

Query  150  ALTSVASGAGSSTQHDALPDVVQGEVLCVEHRV  182
                + S   +  + D      +   +C++ R+
Sbjct  80   KSVDIPSDKAAGKESDVAYSSHKNTTVCLQDRI  112

>PHALS_04136
Length=434

 Score = 32.0 bits (71),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 60/151 (40%), Gaps = 19/151 (13%)

Query  107  VVLHPVNMKCLLKEALLQSE-----WKNKISERNGDFDVKSSSEMAEYALTSVASGAGSS  161
             V H    +C  +E    ++     W +   ++ G +D    S+ A+     +A G G  
Sbjct  80   CVTHGGGKRCQTQECTKSAQSGGFCWVHGGGKKCG-YD--GCSKRAQSGGACIAHGGGKR  136

Query  162  TQHDALPDVVQGEVLCVEH----RVMDDESQRRYRFLSHLPKYCDFYLCELDLSHYLSKK  217
             + +    VVQ + LCV H    R   +   RR     +  ++    +C+L+   +  K+
Sbjct  137  CRVNRCNKVVQYDGLCVRHGGYRRCTHERCDRRAMANDYCQQHGGSSICKLE---HCCKR  193

Query  218  TLQSSKKELATRRRQREAKKKLLDEQLDGDE  248
             ++         R + EA  +    +L GDE
Sbjct  194  AVRGG----MCSRHKGEASLQAAPSKLSGDE  220

Lambda      K        H        a         alpha
   0.313    0.129    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 26018655060

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40