Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCI451301598224824813190.0
CCI451291617237224813190.0
CCA189011617237324712341e-171
CCI4512816170183124813381e-171
PYAP_16572159824132479533e-128
PYIR_22643159824022469385e-126
PYAR_24297159823862459322e-125
PYIW_17753159823982469244e-124
PYU1_G001972159824002469193e-123
PHYRA_84731159823712458964e-120
PHYCA_123086159822712468804e-119
PYVX_14608159823852628905e-119
H310_07576161723512428859e-119
PHALS_05194159823632468851e-118
SPRG_12487161723462468752e-117
H257_07371161723512428753e-117
PPTG_10185159823632458712e-116
SDRG_05001161723462468692e-116
PHYSO_471886159822462458444e-114
PITG_20313159822462458411e-113
PITG_20630161722462458393e-113
PHYKE_10819159823442457484e-98
HYAP_13828159823732576967e-90
PYU1_G008337151514142345345e-65
PYIR_23853151514202375346e-65
SPRG_06805151513412345201e-63
PYU1_G008336836514062435171e-62
SDRG_12928151513412345103e-62
PHYSO_552775151513952345119e-62
PHYCA_543819151514462345062e-60
PHYRA_9659388456132345101e-59
PHYRA_83397151513842344951e-59
PYVX_16542151513882344952e-59
PHYCA_533347836514172344972e-59
PPTG_17622151513952344952e-59
PYVX_16559836513762334872e-58
PYIR_21123836513882244724e-56
PITG_19056151513902344561e-53
PYAR_21138151514552734286e-49
PYAR_21139836513572304104e-47
PYIW_28078167629108782704e-29
PYIW_26705836512301632524e-25
PYIW_27182151512761552397e-23
PYAP_18437151514511011433e-09
PYAR_21141884513964910.004
CCA18823910432247870.034
PYIW_2067611371946101820.17
PYIR_144271968902108820.20
PYIW_198341968947113780.60
PYAR_2615610683829284731.9
PYU1_G00182891031857713.2
PYVX_233357696144345713.9
PYIR_1774015913289104694.8
HYAP_06227910251108695.2
PYIW_2132691051760705.5
HYAP_112001388434048687.8
H310_0013212741856864688.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCI45130

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CCI45130                                                              512     0.0   
CCI45129                                                              512     0.0   
CCA18901                                                              479     1e-171
CCI45128                                                              520     1e-171
PYAP_16572                                                            371     3e-128
PYIR_22643                                                            365     5e-126
PYAR_24297                                                            363     2e-125
PYIW_17753                                                            360     4e-124
PYU1_G001972                                                          358     3e-123
PHYRA_84731                                                           349     4e-120
PHYCA_123086                                                          343     4e-119
PYVX_14608                                                            347     5e-119
H310_07576                                                            345     9e-119
PHALS_05194                                                           345     1e-118
SPRG_12487                                                            341     2e-117
H257_07371                                                            341     3e-117
PPTG_10185                                                            340     2e-116
SDRG_05001                                                            339     2e-116
PHYSO_471886                                                          329     4e-114
PITG_20313                                                            328     1e-113
PITG_20630                                                            327     3e-113
PHYKE_10819                                                           292     4e-98 
HYAP_13828                                                            272     7e-90 
PYU1_G008337                                                          210     5e-65 
PYIR_23853                                                            210     6e-65 
SPRG_06805                                                            204     1e-63 
PYU1_G008336                                                          203     1e-62 
SDRG_12928                                                            201     3e-62 
PHYSO_552775                                                          201     9e-62 
PHYCA_543819                                                          199     2e-60 
PHYRA_96593                                                           201     1e-59 
PHYRA_83397                                                           195     1e-59 
PYVX_16542                                                            195     2e-59 
PHYCA_533347                                                          196     2e-59 
PPTG_17622                                                            195     2e-59 
PYVX_16559                                                            192     2e-58 
PYIR_21123                                                            186     4e-56 
PITG_19056                                                            180     1e-53 
PYAR_21138                                                            169     6e-49 
PYAR_21139                                                            162     4e-47 
PYIW_28078                                                            108     4e-29 
PYIW_26705                                                            101     4e-25 
PYIW_27182                                                            96.7    7e-23 
PYAP_18437                                                            59.7    3e-09 
PYAR_21141                                                            39.7    0.004 
CCA18823                                                              38.1    0.034 
PYIW_20676                                                            36.2    0.17  
PYIR_14427                                                            36.2    0.20  
PYIW_19834                                                            34.7    0.60  
PYAR_26156                                                            32.7    1.9   
PYU1_G001828                                                          32.0    3.2   
PYVX_23335                                                            32.0    3.9   
PYIR_17740                                                            31.2    4.8   
HYAP_06227                                                            31.2    5.2   
PYIW_21326                                                            31.6    5.5   
HYAP_11200                                                            30.8    7.8   
H310_00132                                                            30.8    8.4   

>CCI45130
Length=248

 Score = 512 bits (1319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/248 (100%), Positives = 248/248 (100%), Gaps = 0/248 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI
Sbjct  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV
Sbjct  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH
Sbjct  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT
Sbjct  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240

Query  241  LRRSTSSC  248
            LRRSTSSC
Sbjct  241  LRRSTSSC  248

>CCI45129
Length=372

 Score = 512 bits (1319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/248 (100%), Positives = 248/248 (100%), Gaps = 0/248 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI
Sbjct  125  MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  184

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV
Sbjct  185  AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  244

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH
Sbjct  245  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  304

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT
Sbjct  305  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  364

Query  241  LRRSTSSC  248
            LRRSTSSC
Sbjct  365  LRRSTSSC  372

>CCA18901
Length=373

 Score = 479 bits (1234),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 228/247 (92%), Positives = 240/247 (97%), Gaps = 0/247 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPSS+YPAGRRRLEPI VIISATLMGMAALEVIQKAVETLIIGYEGTLP+I M Q TI
Sbjct  126  MHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTI  185

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVLLFAISTKTILWYLC+RIGLTSPTA+A+AQDHRNDVLSN AAVITSLT K+H NLWY+
Sbjct  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFI+KLR+FTNNHHP+MQADIIRAYH
Sbjct  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FGSNYLVEVEVILPEKMSVREAHDISLDLQ+KIEEFD+VERAFVHVDYLARGYDEHKDPT
Sbjct  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPT  365

Query  241  LRRSTSS  247
            LRRSTSS
Sbjct  366  LRRSTSS  372

>CCI45128
Length=1831

 Score = 520 bits (1338),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 248/248 (100%), Positives = 248/248 (100%), Gaps = 0/248 (0%)

Query  1     MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
             MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI
Sbjct  1584  MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  1643

Query  61    AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV
Sbjct  1644  AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  1703

Query  121   DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
             DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH
Sbjct  1704  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  1763

Query  181   FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
             FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT
Sbjct  1764  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  1823

Query  241   LRRSTSSC  248
             LRRSTSSC
Sbjct  1824  LRRSTSSC  1831

>PYAP_16572
Length=413

 Score = 371 bits (953),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 171/247 (69%), Positives = 206/247 (83%), Gaps = 0/247 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTP+  YPAGRRRLEPIA+IISATLMGMAA+EV+QK++ETL+ G+ G+LP ++MT  T+
Sbjct  167  MHTPNVNYPAGRRRLEPIALIISATLMGMAAIEVVQKSIETLVSGFAGSLPDLDMTPFTV  226

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VLLFAI  K +LW++C RI   S +A ALAQDHRNDV SN  AV TSL +    +LWYV
Sbjct  227  GVLLFAICIKIVLWWICARISTNSSSADALAQDHRNDVFSNTVAVSTSLLSHWKRDLWYV  286

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DS+GAI IS+YIA SWLATG EQV+RL+GL+ADP FIE++R+ T+ HHP M++DIIRAYH
Sbjct  287  DSIGAIAISVYIAFSWLATGKEQVERLIGLRADPDFIEQIRELTDLHHPLMKSDIIRAYH  346

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILP  M VREAHDISL LQ K+EE D+VERAFVHVDYL+R YDEHKDPT
Sbjct  347  FGNNYLVELEVILPADMCVREAHDISLALQNKVEELDNVERAFVHVDYLSRDYDEHKDPT  406

Query  241  LRRSTSS  247
            LRR +SS
Sbjct  407  LRRDSSS  413

>PYIR_22643
Length=402

 Score = 365 bits (938),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 201/246 (82%), Gaps = 0/246 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EV+QK+VETL+ G++G LP +NMT +TI
Sbjct  156  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVMQKSVETLVAGFKGNLPDLNMTLITI  215

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             +L  AI  K +LWY+C RI   SP+A ALAQDHRNDV SN+ AV+TS       +LWY+
Sbjct  216  VILCVAICVKLVLWYICSRIATNSPSADALAQDHRNDVFSNVVAVVTSALAHWQRDLWYL  275

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DS+G ILIS+YIA+SWLATG EQV++LVGLQADP FI ++    + HHP M++DI+RAYH
Sbjct  276  DSIGGILISMYIALSWLATGKEQVEKLVGLQADPDFINQIYGLADLHHPLMKSDIVRAYH  335

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE+M V+EAHDISL LQ K+E  D VERAFVHVDY  R YDEHKDPT
Sbjct  336  FGNNYLVELEVILPEQMCVKEAHDISLALQDKVEALDCVERAFVHVDYAPRDYDEHKDPT  395

Query  241  LRRSTS  246
            +RR ++
Sbjct  396  IRRDSA  401

>PYAR_24297
Length=386

 Score = 363 bits (932),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 199/245 (81%), Gaps = 0/245 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTP+  YPAGRRRLEPIAV+ISATLMGMAA+EV+QK++ETL+ GY G+LP ++MT LTI
Sbjct  141  MHTPNVNYPAGRRRLEPIAVVISATLMGMAAIEVVQKSIETLVTGYNGSLPDLDMTPLTI  200

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VL+FAI+ K +LW +C RI   S +A ALAQDHRNDV SN  AV TSL      +LWY 
Sbjct  201  GVLVFAIAIKLVLWSICARIAANSSSADALAQDHRNDVFSNSVAVTTSLIAHYRRDLWYT  260

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DS+GAI IS+YI  SWLATG EQV+RL+GL A+P FIE++R   + HHP MQ+DI+RAYH
Sbjct  261  DSLGAIAISVYIGFSWLATGKEQVERLIGLGAEPDFIERIRALVDLHHPLMQSDIVRAYH  320

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILP  M VREAHDISL LQ K+EE D+VERAFVHVDYLAR YDEHKDPT
Sbjct  321  FGNNYLVELEVILPATMCVREAHDISLALQNKVEELDNVERAFVHVDYLARDYDEHKDPT  380

Query  241  LRRST  245
            +RR +
Sbjct  381  IRRDS  385

>PYIW_17753
Length=398

 Score = 360 bits (924),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 198/246 (80%), Gaps = 0/246 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EV+QK+ ETL+ G  G LP +NMT  TI
Sbjct  152  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVMQKSGETLVAGVNGHLPDLNMTTSTI  211

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VL  AI  K +LWY+C RI   SP+A ALAQDHRNDV SN+ AV+TS+       LWY+
Sbjct  212  VVLCVAICVKLVLWYICSRIAKNSPSADALAQDHRNDVFSNVVAVVTSVLAHWQRQLWYL  271

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVG I+ISLYIA+SWLATG EQV++LVGL+ADP FI ++    + HHP M++DI+RAYH
Sbjct  272  DSVGGIVISLYIALSWLATGKEQVEKLVGLKADPDFIAQIHGLVDLHHPLMKSDIVRAYH  331

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE+M VREAHDISL LQ K+E  D VERAFVHVDY +R YDEHKDPT
Sbjct  332  FGNNYLVELEVILPEQMCVREAHDISLALQDKVEALDCVERAFVHVDYASRDYDEHKDPT  391

Query  241  LRRSTS  246
            +RR ++
Sbjct  392  IRRDSA  397

>PYU1_G001972
Length=400

 Score = 358 bits (919),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 163/246 (66%), Positives = 199/246 (81%), Gaps = 0/246 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS RYPAGRRRLEPIAVIISATLMGMAA+EVIQK+ ETLI G +G LP +NM+ LTI
Sbjct  154  MHTPSVRYPAGRRRLEPIAVIISATLMGMAAVEVIQKSTETLIAGTKGNLPDLNMSALTI  213

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             +L  AI  K +LW++C RI   SP+A ALAQDHRNDV SN  AV+TS+      +LWY+
Sbjct  214  LILCVAICVKLVLWFICSRIAKNSPSADALAQDHRNDVFSNAVAVLTSVIAHYQRDLWYL  273

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DS+G ILISLYIA+SWLATG EQV++L GLQAD  FI+++ +  + HHP +++DI+RAYH
Sbjct  274  DSIGGILISLYIALSWLATGKEQVEKLAGLQADSAFIDEIYELVDVHHPLLRSDIVRAYH  333

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+E  D+VERAFVHVDY  R YDEHKDPT
Sbjct  334  FGNNYLVELEVILPETMCVKDAHDISLALQHKVEALDAVERAFVHVDYAPRDYDEHKDPT  393

Query  241  LRRSTS  246
            +RR ++
Sbjct  394  IRRDSA  399

>PHYRA_84731
Length=371

 Score = 349 bits (896),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 195/245 (80%), Gaps = 0/245 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE L+ G+ G    +N++  T+
Sbjct  126  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFNGHQRELNISTFTV  185

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVLL AI  K  LWY+C +I   SP+A ALAQDHRNDV SN  AV  +     H NLWY 
Sbjct  186  AVLLVAIVIKLALWYVCAKIAAHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSNLWYF  245

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  246  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  305

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+EE D VERAFVHVDYL R YDEHKDPT
Sbjct  306  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDQVERAFVHVDYLERNYDEHKDPT  365

Query  241  LRRST  245
            LRR +
Sbjct  366  LRRDS  370

>PHYCA_123086
Length=271

 Score = 343 bits (880),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 196/246 (80%), Gaps = 0/246 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE L+ G+ G    + ++  T+
Sbjct  25   MHTPSVQYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFNGHQRELEISAFTM  84

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VLL AI  K ILWY C +I   SP+A ALAQDHRNDV SN  AV  +     H +LWY+
Sbjct  85   LVLLVAIVIKLILWYFCAKIASHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSSLWYL  144

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  145  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  204

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+EE D+VERAFVHVDYL R YDEHKDPT
Sbjct  205  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  264

Query  241  LRRSTS  246
            LRR+ S
Sbjct  265  LRRNDS  270

>PYVX_14608
Length=385

 Score = 347 bits (890),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 202/262 (77%), Gaps = 16/262 (6%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGM----------------AALEVIQKAVETLII  44
            MHT   +YPAGRRRLEPIAVIISATLMGM                AA+EVIQK+VETL++
Sbjct  124  MHTRDVKYPAGRRRLEPIAVIISATLMGMTGECVPSLSLLTQWVLAAIEVIQKSVETLVM  183

Query  45   GYEGTLPSINMTQLTIAVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAA  104
            G++GTLP +N++ +T+AVLL AI TK +LWY+C  I   SP+A ALAQDHRNDV SN  A
Sbjct  184  GWKGTLPDMNISIITLAVLLAAIITKLVLWYICRLISTQSPSADALAQDHRNDVYSNSIA  243

Query  105  VITSLTTKVHENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFT  164
            +I +     H+NLWY+DS GAI+IS+YIA+SWL TG EQV+RLVGLQA   FI+++R   
Sbjct  244  IIAACLANWHKNLWYLDSAGAIVISVYIAVSWLETGKEQVERLVGLQASQEFIDEIRKLA  303

Query  165  NNHHPQMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFV  224
            + HH  M+ADI+RAYHFG+NYLVE+EVILPE M VREAHDISL LQK +EE D+VERAFV
Sbjct  304  DTHHSLMKADIVRAYHFGNNYLVEIEVILPESMRVREAHDISLSLQKAVEELDTVERAFV  363

Query  225  HVDYLARGYDEHKDPTLRRSTS  246
            HVDYL R YDEHKD T+RR +S
Sbjct  364  HVDYLPRDYDEHKDTTIRRDSS  385

>H310_07576
Length=351

 Score = 345 bits (885),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 198/242 (82%), Gaps = 0/242 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTP+ +YPAGRRRLEPIAV++SATLMGMA+LEV+QK+V TLI G+ G LP ++M+ LTI
Sbjct  108  MHTPNEKYPAGRRRLEPIAVVVSATLMGMASLEVVQKSVTTLIEGFGGHLPELDMSILTI  167

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVL  AI+ K +LW++C +I   SP+A ALAQDHRNDV SN+ AV TSL    +  LWY 
Sbjct  168  AVLGVAITVKLMLWFICGQIAYVSPSAAALAQDHRNDVFSNLVAVSTSLMAHYYSGLWYF  227

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            D +GAI IS+YI +SW+ATG EQV+RLVGLQAD  FIE++R   + HHP++Q+DIIRAYH
Sbjct  228  DPIGAIAISIYITLSWVATGKEQVERLVGLQADEDFIERVRAIADAHHPKLQSDIIRAYH  287

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+N+LVE+EV+LP+ MSV+E+HDISL LQ K+E  D VERAFVHVDY +R YDEHKDPT
Sbjct  288  FGNNFLVELEVVLPKDMSVQESHDISLALQIKVEALDEVERAFVHVDYQSRDYDEHKDPT  347

Query  241  LR  242
            +R
Sbjct  348  VR  349

>PHALS_05194
Length=363

 Score = 345 bits (885),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 196/246 (80%), Gaps = 0/246 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++V+ L+ G+ G L  I+++  T+
Sbjct  118  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVKALVKGFNGHLREIDISSFTL  177

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VLL AI  K  LWY+C +I   SP+A ALAQDHRNDV SN+ AV  +     H +LW +
Sbjct  178  IVLLVAIVVKLFLWYICAKIASHSPSADALAQDHRNDVYSNLVAVSAAFVAHKHPSLWCL  237

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DS+GAI+IS+YIA+SWLATG EQV+RLVGLQA+  FI+ +R   + HHP M+ DI+RAYH
Sbjct  238  DSIGAIVISVYIAVSWLATGKEQVERLVGLQAEQEFIDHIRTLGDVHHPLMKTDIVRAYH  297

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V+EAHDISL LQ K+E  D+VERAFVHVDYL R YDEHKDPT
Sbjct  298  FGNNYLVEMEVILPEDMCVKEAHDISLSLQIKVEGLDNVERAFVHVDYLERNYDEHKDPT  357

Query  241  LRRSTS  246
            LRR +S
Sbjct  358  LRRDSS  363

>SPRG_12487
Length=346

 Score = 341 bits (875),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 195/246 (79%), Gaps = 0/246 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS  YPAGRRRLEPIAV++SATLMGMA+LEV+QK++ TLI G+ G LP ++M+ LTI
Sbjct  101  MHTPSPDYPAGRRRLEPIAVVVSATLMGMASLEVVQKSIATLIEGFNGHLPELDMSILTI  160

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVL  AI  K ILW+LC +I   SP+A ALAQDHRNDV SN  AV TS+    +  +WY+
Sbjct  161  AVLAIAIVVKLILWFLCAQIAHVSPSAAALAQDHRNDVFSNAVAVTTSMIAHYNVEMWYL  220

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            D +GAI IS+YI  SWL TG EQV RLVG+QAD  FI ++    + HHP MQ+DI+RAYH
Sbjct  221  DPIGAICISIYITWSWLETGKEQVDRLVGIQADEDFIARIDGIADTHHPDMQSDIVRAYH  280

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+N+LVE+EVI+P+ M+V +AHDISL LQKK+EE D+VERAFVHVDY +R YDEHKDPT
Sbjct  281  FGNNFLVELEVIMPKSMTVGDAHDISLALQKKVEELDAVERAFVHVDYESRDYDEHKDPT  340

Query  241  LRRSTS  246
            +R+ +S
Sbjct  341  IRKDSS  346

>H257_07371
Length=351

 Score = 341 bits (875),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 195/242 (81%), Gaps = 0/242 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTP+++YPAGRRRLEPIAV++SATLMGMAALEV+QK+V TLI G+ G LP ++M+  T+
Sbjct  108  MHTPNAKYPAGRRRLEPIAVVVSATLMGMAALEVVQKSVTTLIEGFGGQLPELDMSIPTV  167

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVL  AI  K +LW+LC +I   SP+A ALAQDHRNDV SN  AV TSL    +  LWY 
Sbjct  168  AVLGIAIIVKLMLWFLCGQIAYVSPSAAALAQDHRNDVFSNAVAVTTSLVAHYNSELWYF  227

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            D +GAI IS+YI +SW+ATG EQV+RLVGLQAD  FI+++R   + HHP++Q+DIIRAYH
Sbjct  228  DPIGAIAISIYITLSWVATGKEQVERLVGLQADQDFIDRVRTIADAHHPKLQSDIIRAYH  287

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+N+LVE+EV+LP+ MSV+E+HDISL LQ K+E  D VERAFVHVDY +R YDEHKDPT
Sbjct  288  FGNNFLVELEVVLPKDMSVQESHDISLALQIKVEALDEVERAFVHVDYQSRDYDEHKDPT  347

Query  241  LR  242
             R
Sbjct  348  AR  349

>PPTG_10185
Length=363

 Score = 340 bits (871),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 196/245 (80%), Gaps = 0/245 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE L+ G++G    ++ +  T+
Sbjct  118  MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFKGHQRELDFSSFTM  177

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VLL AI  K +LW++C +I   SP+A ALAQDHRNDV SN  AV  +     H NLWY+
Sbjct  178  IVLLVAIVIKLLLWHICTKIASHSPSADALAQDHRNDVFSNSVAVAAAFAAHWHSNLWYL  237

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DS+GAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  238  DSIGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  297

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+E  D+VERAFVHVDYL R YDEHKDPT
Sbjct  298  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  357

Query  241  LRRST  245
            +RR +
Sbjct  358  IRRDS  362

>SDRG_05001
Length=346

 Score = 339 bits (869),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 197/246 (80%), Gaps = 0/246 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS  YPAGRRRLEPIAV++SATLMGMA+LEV+QK++ TLI G+ G +P ++M+ LTI
Sbjct  101  MHTPSPDYPAGRRRLEPIAVVVSATLMGMASLEVVQKSIATLIEGFNGHVPELDMSILTI  160

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVL  AI  K ILW+LC +I   SP+A ALAQDHRNDV SN  AV TS+    + + WY+
Sbjct  161  AVLAVAIVVKLILWFLCAQIAHVSPSAAALAQDHRNDVFSNGVAVTTSMIAHYNIDAWYL  220

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            D +GAI IS+YI  SWL TG EQV RLVG+QAD  FI+++    ++HHP MQ+DI+RAYH
Sbjct  221  DPIGAICISIYITWSWLETGKEQVDRLVGIQADEDFIQRIHAIADSHHPDMQSDIVRAYH  280

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+N+LVE+EV++P+ M+V +AHDISL LQKK+EE D+VERAFVHVDY +R YDEHKDPT
Sbjct  281  FGNNFLVELEVVMPKSMTVGDAHDISLALQKKVEELDAVERAFVHVDYESRDYDEHKDPT  340

Query  241  LRRSTS  246
            +R+ +S
Sbjct  341  IRKDSS  346

>PHYSO_471886
Length=246

 Score = 329 bits (844),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 0/245 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE LI G+ G    + ++  T+
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTM  60

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VLL A+  K  LWY+C +I   SP+A ALAQDHRNDV SN  AV  +     H +LWY+
Sbjct  61   VVLLVAMVVKLALWYVCAKIASHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSSLWYL  120

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+EE D+VERAFVHVDYL R YDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240

Query  241  LRRST  245
            +RR +
Sbjct  241  IRRDS  245

>PITG_20313
Length=246

 Score = 328 bits (841),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 0/245 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE L+ G +G    + +T  T+
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGLKGHQRELEITSFTV  60

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VLL AI  K +LWY+C +I   SP+A ALAQDHRNDV SN  AV  +     H +LWY+
Sbjct  61   IVLLVAIVVKLLLWYICAKIASHSPSADALAQDHRNDVFSNFVAVAAAFAAHWHSSLWYL  120

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRVLGDVHHPMMRTDIVRAYH  180

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+E  D+VERAFVHVDYL R YDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  240

Query  241  LRRST  245
            +RR +
Sbjct  241  VRRDS  245

>PITG_20630
Length=246

 Score = 327 bits (839),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 0/245 (0%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEPIAVIISATLMGMAA+EVIQ++VE L+ G +G    + +T  T+
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVEGLKGHQRELEITSFTV  60

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
             VLL AI  K +LWY+C +I   SP+A ALAQDHRNDV SN  AV  +     H +LWY+
Sbjct  61   IVLLVAIVVKLLLWYICAKIASHSPSADALAQDHRNDVFSNSVAVAAAFAAHWHSSLWYL  120

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FI+++R   + HHP M+ DI+RAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRVLGDVHHPMMRTDIVRAYH  180

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+E  D+VERAFVHVDYL R YDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  240

Query  241  LRRST  245
            +RR +
Sbjct  241  VRRDS  245

>PHYKE_10819
Length=344

 Score = 292 bits (748),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 175/245 (71%), Gaps = 26/245 (11%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60
            MHTPS +YPAGRRRLEP+AVIISATLMGMAA+EVIQ+AVE+L+ G  G    ++++  T+
Sbjct  125  MHTPSVKYPAGRRRLEPVAVIISATLMGMAAIEVIQQAVESLVKGLNGHQRQLDISTFTM  184

Query  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120
            AVLL AI  K                           VL N  AV  +     H NLWY+
Sbjct  185  AVLLVAIVVKL--------------------------VLCNTVAVGAAFAAHWHSNLWYL  218

Query  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQA   FI+++R   + HHP M+ DI+RAYH
Sbjct  219  DSVGAIVISVYIAVSWLATGKEQVERLVGLQASQEFIDEIRLLGDIHHPMMRTDIVRAYH  278

Query  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240
            FG+NYLVE+EVILPE M V++AHDISL LQ K+E  D+VERAFVHVDYL R YDEHKDPT
Sbjct  279  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  338

Query  241  LRRST  245
            LRR +
Sbjct  339  LRRDS  343

>HYAP_13828
Length=373

 Score = 272 bits (696),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 175/257 (68%), Gaps = 18/257 (7%)

Query  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAAL---EVIQKAVETLIIGYEGTLPSINMTQ  57
            MHTPS  YPAGRRRLEPIAVI+SATLMGMA        Q A    +  ++G     + +Q
Sbjct  124  MHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQWQAARGRHLDFHDGRAARCDSSQ  183

Query  58   LTIAVLLFAISTKTILWYLC--------YRIGLTSPTAKALAQDHRNDVLSNIAAVITSL  109
                V       +    YL         ++I +T+       QDHRNDV SN  A++ + 
Sbjct  184  ARAMV-------RVPRCYLLPDARLRSRHQISVTNDFGLHCLQDHRNDVFSNTIAIVAAF  236

Query  110  TTKVHENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHP  169
             T  H + WY+DS+GA++IS+YIA+SWLATG EQV+RLVGLQA   FI+++R   + HHP
Sbjct  237  ATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQATQEFIDQIRLLGDVHHP  296

Query  170  QMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYL  229
             M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDISL+LQ K+EE D+VERAFVHVDYL
Sbjct  297  MMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQHKVEELDNVERAFVHVDYL  356

Query  230  ARGYDEHKDPTLRRSTS  246
             R YDEHKDPT+RR ++
Sbjct  357  ERNYDEHKDPTIRRDSA  373

>PYU1_G008337
Length=414

 Score = 210 bits (534),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 154/234 (66%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSI-NMTQLTIAVLL  64
            ++YPAG  R EP+A+I++A++M + ++  IQ+ V  L+ G+    P    ++   + ++ 
Sbjct  126  AKYPAGTSRFEPVAIIVAASIMVLVSVVFIQEGVTKLVDGFAHGQPEAPKLSAAAVVIVT  185

Query  65   FAISTKT-ILWYLCYRIGLT-SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             A+  K  +++Y  + +  T S + +A+  D+RND +SN  A+I  + + V E LWYVD 
Sbjct  186  LAVLVKIGLIFYSRWVLKFTFSASVEAIQDDNRNDTISNAFAIIAYIISSVDEGLWYVDP  245

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAILI L+I  +W   G EQV +LVG+ A   F+ ++++   +HHP M  DI+RAYHFG
Sbjct  246  AGAILIFLFIMFAWGKMGKEQVAQLVGVCASEEFMTEVKELCASHHPSMSLDIMRAYHFG  305

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            S YLVE+EV++P  M+V+ AHDI+L LQ K+E  + VERAFVHVDY +R YDEH
Sbjct  306  SKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKSRDYDEH  359

>PYIR_23853
Length=420

 Score = 210 bits (534),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 152/237 (64%), Gaps = 9/237 (4%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGY---EGTLPSINMTQLTIAV  62
            ++YPAG  R EP+A+I+++++M + ++  IQ+ V  L+ G    +   P ++ T + I  
Sbjct  125  AKYPAGTSRFEPVAIIVASSIMVLVSVVFIQEGVTKLVDGLAHGQPEAPKLSATAVIIVC  184

Query  63   LLFAISTKTIL---WYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWY  119
            L   +    I    W L +     S + +A+  D+RND +SN  A+I  + + V E+LWY
Sbjct  185  LAVLVKIGLIFYSRWVLTFTY---SASVEAIQDDNRNDTISNAFAIIAYIISSVDEDLWY  241

Query  120  VDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAY  179
            VD  GAILI L+I  +W   G EQV +LVG+ A   F+ ++++  ++HHP M  DIIRAY
Sbjct  242  VDPAGAILIFLFIMFAWGKMGKEQVAQLVGVCASKEFMAEVKELCSHHHPSMALDIIRAY  301

Query  180  HFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            HFGS YLVE+EV++P  M+V+ AHDI+L LQ K+E  + VERAFVHVDY AR YDEH
Sbjct  302  HFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKARDYDEH  358

>SPRG_06805
Length=341

 Score = 204 bits (520),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 151/234 (65%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSIN-MTQLTIAVLL  64
            +++PAG  R EPI V++SAT+M + ++ VI ++   L  G+    P +  M+   IA+  
Sbjct  67   AKFPAGTSRFEPILVVLSATIMSVISVIVIYESSMRLHDGFASGEPDVAVMSTAAIAICS  126

Query  65   FAISTKT-ILWYLCYRIGLT-SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             AI+ K  ++ Y  + + LT S + KA+ QD+ ND +SN  A++  +      +LWY+D 
Sbjct  127  CAIAIKVGLVIYAGFALRLTQSSSVKAIQQDNINDTVSNAFAIVVYVIAASDPSLWYIDP  186

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAILI L I + W+ T  EQV +LVG+ A P FI+ +++   NHH     DIIRAYHFG
Sbjct  187  AGAILIFLAILVIWVRTAKEQVLQLVGVSASPDFIDVVKELCENHHASFALDIIRAYHFG  246

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            + YLVE+EV+ P  M+V++AHDISL LQ KIE+ + VERAFVHVDY  R YDEH
Sbjct  247  NKYLVELEVVAPATMTVKQAHDISLQLQFKIEQLEDVERAFVHVDYQTRAYDEH  300

>PYU1_G008336
Length=406

 Score = 203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 156/243 (64%), Gaps = 21/243 (9%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGY-EGTLPSINMTQLTIAVLL  64
            ++YPAG  R EP+A+I+++++M + ++  IQ+ V  L+ G+  G   S  ++  TIA++L
Sbjct  110  AKYPAGTSRFEPVAIIVASSIMVLVSVTFIQEGVTKLVDGFAHGNPESPKLS--TIAIVL  167

Query  65   FAISTKTILWYLCYRIGLT-----------SPTAKALAQDHRNDVLSNIAAVITSLTTKV  113
                + TI+     +IGL            S  A A+  D+RNDV+SN  A+   + +  
Sbjct  168  ----SSTIV---VIKIGLVAYSYWTIKRTYSAAAHAIGDDNRNDVVSNSFAICAYIISSS  220

Query  114  HENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQA  173
             E+LWYVD++GAI+I L I  +W   G EQV +LVG+ A   F+ ++++   +HHP M  
Sbjct  221  DEDLWYVDALGAIVIFLLIMFAWAKMGKEQVAQLVGVSASEEFMTEVKELCASHHPTMSL  280

Query  174  DIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGY  233
            DI+RAYHFGS YLVE+EV++P  M+V+ AHDI+L LQ K+E  + VERAFVHVDY +R Y
Sbjct  281  DIMRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKSRDY  340

Query  234  DEH  236
            DEH
Sbjct  341  DEH  343

>SDRG_12928
Length=341

 Score = 201 bits (510),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 149/234 (64%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLP-SINMTQLTIAVLL  64
            +++PAG  R EPI V++SAT+M + ++ VI ++   L  G+    P    M+   I +  
Sbjct  67   AKFPAGTSRFEPILVVLSATIMSVISVIVIYESSMRLHDGFASGEPDGAVMSTTAIVICS  126

Query  65   FAISTKT-ILWYLCYRIGLT-SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             A++ K  ++ Y  + + +T S + KA+ QD+ ND +SN  A+I         +LWY+D 
Sbjct  127  CAVAIKIGLVIYAGFALRITQSSSVKAIQQDNINDTVSNAFAIIVYAIAASDPSLWYIDP  186

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAILI L I + W+ T  EQV +LVG+ A P FI+ +++  +NHH     DIIRAYHFG
Sbjct  187  AGAILIFLAILVIWVRTAKEQVLQLVGVSASPDFIDVVKELCDNHHASFALDIIRAYHFG  246

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            + YLVE+EV+ P  M+V++AHDISL LQ KIE+ D VERAFVHVDY  R YDEH
Sbjct  247  NKYLVELEVVAPATMTVKQAHDISLQLQFKIEQLDDVERAFVHVDYQTRAYDEH  300

>PHYSO_552775
Length=395

 Score = 201 bits (511),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 157/234 (67%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLP-SINMTQLTIAVLL  64
            ++YPAG  R EP+A+I++A++M +A++  IQ+AV+ L+ G+    P + +++   IA+ +
Sbjct  101  AKYPAGTSRFEPVAIIVAASVMVLASIVFIQEAVKKLVDGFSSDEPEAPHLSAAAIAIAV  160

Query  65   FAISTKT-ILWYLCYRIGLTSPTA-KALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             A+  K  +++Y  + +  T   A +A+ QD+ ND LSN  AV   +   V    WYVD 
Sbjct  161  TAVVVKIGLMFYSAWILKSTVSVAVEAIHQDNLNDTLSNSFAVAAYIIAAVEPKAWYVDP  220

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAILI +YI ++W     EQV +LVG+ A   FIE+++D  N HHP M  DI+RAYHFG
Sbjct  221  AGAILIFVYIMVAWGKMAWEQVTQLVGVCASEEFIEEVKDLCNRHHPSMSLDIVRAYHFG  280

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            S YLVE+EV++P +MSV+ AHDI+L +Q K+E  + VERAFVHVDY AR YDEH
Sbjct  281  SKYLVELEVVVPGEMSVKLAHDIALQMQFKVENLEEVERAFVHVDYQARDYDEH  334

>PHYCA_543819
Length=446

 Score = 199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 157/234 (67%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLP-SINMTQLTIAVLL  64
            ++YPAG  R EP+A+I++A++M +A++  I +AV+ LI G+    P + N++   IA+ +
Sbjct  152  AKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAVQKLIDGFSSDEPEAPNLSAAAIAIAV  211

Query  65   FAISTKT-ILWYLCYRIGLTSPTA-KALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             A+  K  +++Y  + +  T   A +A+ QD+ ND+LSN  AV   +   V    WYVD 
Sbjct  212  TAVVVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYVDP  271

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAI+I +YI +SW     EQV +LVG+ A   FI +++D  N HHP M+ DI+RAYHFG
Sbjct  272  AGAIIIFVYIMVSWGKMAWEQVTQLVGVCASEEFIGEVKDLCNRHHPSMKLDIVRAYHFG  331

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            S YLVE+EV++P +MSV+ AHDI+L +Q K+E  + VERAFVHVDY +R YDEH
Sbjct  332  SKYLVELEVVVPGEMSVKLAHDIALQMQFKVENLEEVERAFVHVDYQSRDYDEH  385

>PHYRA_96593
Length=613

 Score = 201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 152/234 (65%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPS--INMTQLTIAVL  63
            ++YPAG  R EP+A+I++A++M +A++  IQ++   LI G+    P   I  T   + V+
Sbjct  342  AKYPAGTSRFEPVAIIVAASVMVLASIVFIQESARKLIDGFTSGEPEAPILSTAAIVIVV  401

Query  64   LFAISTKTILWYLCYRIGLT-SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
            +  +    ++ Y  + +  T S   +A+ QD+ ND +SN  AV   + + V    WYVD 
Sbjct  402  MAVVVKIGLMLYSAWILKSTFSAAVEAIHQDNLNDTISNSFAVAAYIVSAVESEAWYVDP  461

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAILI LYI +SW     EQV +LVG+ A   F++++++  ++HHP M  DI+RAYHFG
Sbjct  462  AGAILIFLYIMVSWGKMAWEQVTQLVGVCASEDFVQEVKELCSHHHPSMVLDIVRAYHFG  521

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            S YLVE+EV++P +MSV+ AHDI+L LQ K+E  + VERAFVHVDY +R YDEH
Sbjct  522  SKYLVELEVVVPAEMSVKAAHDIALQLQFKVENLEEVERAFVHVDYQSRDYDEH  575

>PHYRA_83397
Length=384

 Score = 195 bits (495),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 157/234 (67%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLP-SINMTQLTIAVLL  64
            ++YPAG  R EP+A+I++A++M +A++  I +AV  L  G+    P + N++   IA+ +
Sbjct  90   AKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAVVKLADGFSSDEPEAPNLSAAAIAIAV  149

Query  65   FAISTK-TILWYLCYRIGLT-SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             A+  K  +++Y  + +  T S   +A+ QD+ ND+LSN  AV   +   V    WYVD 
Sbjct  150  TAVVVKIGLMFYSAWILKTTVSAAVEAIHQDNFNDMLSNSFAVAAYIVAAVESEAWYVDP  209

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAI+I +YI ++W     EQ+ +LVG+ A+  FIE++++    HHP M+ DI+RAYHFG
Sbjct  210  AGAIIIFVYIMVAWGKMAWEQITQLVGVCANEDFIEEVKELCRQHHPSMELDIVRAYHFG  269

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            S YLVE+EV++P +MSV+ AHDI+L +Q K+E+ + VERAFVHVDY AR YDEH
Sbjct  270  SKYLVELEVVVPGEMSVKLAHDIALQMQFKVEKLEEVERAFVHVDYQARDYDEH  323

>PYVX_16542
Length=388

 Score = 195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 154/234 (66%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGY-EGTLPSINMTQLTIAVLL  64
            ++YPAG  R EP+A+I++A++M +AA+  IQ++V  +  G       + +++   I +++
Sbjct  82   AKYPAGTSRFEPVAIIVAASIMVLAAVYFIQESVTKIFNGLVHDDFEAPDLSVAAIVIVV  141

Query  65   FAISTKT-ILWYLCYRIGLT-SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             A+ TK  +++Y  + +  T S   +A+ QD+ ND +SN  A+   +   V  + WYVD 
Sbjct  142  LAVVTKIGLVFYSGWILKSTFSAAVEAIHQDNINDTMSNSIAIAAYIVAAVKPSAWYVDP  201

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GA+LI +YI  SW     EQVQ+LVG+ AD  FI++++D    HHP M  DI+RAYHFG
Sbjct  202  AGAMLIFVYIMYSWGKMAKEQVQQLVGVSADEEFIQEVKDLCARHHPLMALDIVRAYHFG  261

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            + YLVE+EV++P  MSV+ AHDI+L LQ K+E  D VERAFVHVDY +R YDEH
Sbjct  262  NKYLVELEVVVPGDMSVKMAHDIALQLQFKVENLDQVERAFVHVDYQSRDYDEH  315

>PHYCA_533347
Length=417

 Score = 196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 149/234 (64%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGY---EGTLPSINMTQLTIAV  62
            ++YPAG  R EP+A+I++A++M +A++  IQ++   LI G+   E   PS++   + I V
Sbjct  111  AKYPAGTSRFEPVAIIVAASVMVLASIVFIQESARKLIDGFTSGEPEAPSLSTAAIVIVV  170

Query  63   LLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
                +    +++         S   +A+ QD+ ND +SN  A+   +   V    WYVD 
Sbjct  171  TAVIVKIGLMIYSAWILKSTFSAAVEAIHQDNLNDTISNSFAIAAYIVAAVESEAWYVDP  230

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAILI +YI +SW     EQV +LVG+ A   F+ ++++ + +HHP M  DI+RAYHFG
Sbjct  231  AGAILIFIYIMVSWGKMAWEQVTQLVGVCASEDFVLQVKELSRHHHPSMTLDIVRAYHFG  290

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            S YLVE+EV++P +MSV++AHDI+L LQ K+E  D VERAFVHVDY +R YDEH
Sbjct  291  SKYLVELEVVVPAEMSVKDAHDIALQLQFKVENLDEVERAFVHVDYQSRDYDEH  344

>PPTG_17622
Length=395

 Score = 195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 157/234 (67%), Gaps = 3/234 (1%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLP-SINMTQLTIAVLL  64
            ++YPAG  R EP+A+I++A++M +A++  I +A + L+ G+    P + N++   IA+ +
Sbjct  101  AKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAAQKLVDGFSSDEPEAPNLSAAAIAIAV  160

Query  65   FAISTKT-ILWYLCYRIGLTSPTA-KALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             A+  K  +++Y  + +  T   A +A+ QD+ ND+LSN  AV   +   V    WYVD 
Sbjct  161  TAVVVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYVDP  220

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAI+I +YI ++W     EQ+ +LVG+ A   FIE++++  + HHP M+ DI+RAYHFG
Sbjct  221  AGAIIIFVYIMVAWGKMAWEQITQLVGVCASEEFIEEVKELCSRHHPSMELDIVRAYHFG  280

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            S YLVE+EV++P +MSV+ AHDI+L +Q K+E  + VERAFVHVDY AR YDEH
Sbjct  281  SKYLVELEVVVPGEMSVKLAHDIALQVQFKVENLEEVERAFVHVDYQARDYDEH  334

>PYVX_16559
Length=376

 Score = 192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 150/233 (64%), Gaps = 5/233 (2%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTIAVLLF  65
            ++YPAG  R EP+A+I++A++M + A+  IQ   E+          + +++   I ++  
Sbjct  80   AKYPAGTSRFEPVAIIVAASIMVLVAVFFIQ---ESGXXXXXDDFEAPDLSAAAIVIVSL  136

Query  66   AISTKT-ILWYLCYRIGLT-SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDSV  123
            A+ +K  +++Y  + +  T S   +A+ QD+ ND +SN  AVI  +   V  + WYVD  
Sbjct  137  AVVSKIGLIFYSGWILKSTYSAAVEAIHQDNINDTMSNSIAVIAYIIAAVKPSAWYVDPA  196

Query  124  GAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFGS  183
            GA+LI +YI  SW     EQVQ+LVG+ AD  FI++++D    HHP M  DI+RAYHFG+
Sbjct  197  GAMLIFVYIMYSWGKMAKEQVQQLVGVSADEEFIQEVKDLCARHHPLMALDIVRAYHFGN  256

Query  184  NYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
             YLVE+EV++P  MSV+ AHDI+L LQ K+E  + VERAFVHVDY +R YDEH
Sbjct  257  KYLVELEVVVPGDMSVKMAHDIALQLQFKVENLEPVERAFVHVDYRSRDYDEH  309

>PYIR_21123
Length=388

 Score = 186 bits (472),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 140/224 (63%), Gaps = 19/224 (8%)

Query  24   ATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTIAVLLFAISTKTILWYLCYRIGLT  83
            A +M + A+  IQ+ V  L+ G+    P     +L+ A ++ + S   I      +IGL+
Sbjct  110  ANIMVLVAITFIQEGVTKLVDGFAHGNP--EAPKLSTAAVVLSSSIVVI------KIGLS  161

Query  84   -----------SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDSVGAILISLYI  132
                       S  A A+  D+RNDV SN  A+   + +  +E+LWYVD+ GAI++ L+I
Sbjct  162  AYSYWTIKRTYSAAAHAIGDDNRNDVFSNSFAIAAYIISSANEDLWYVDACGAIVVFLFI  221

Query  133  AISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFGSNYLVEVEVI  192
             ++W   G +QV +LVG+ A+  F+ ++++  ++HHP M  DIIRAYHFGS YLVE+EV+
Sbjct  222  MVAWAKMGKDQVAQLVGVSANEEFMTEVKELCSHHHPSMALDIIRAYHFGSKYLVELEVV  281

Query  193  LPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            +P  M+V+ AHDI+L LQ K+E  + VERAFVHVDY AR YDEH
Sbjct  282  VPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKARDYDEH  325

>PITG_19056
Length=390

 Score = 180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 146/234 (62%), Gaps = 4/234 (2%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTIAVLLF  65
            ++YPAG    +  A+I++A++M +A++  IQ+AV  L+ G+    P   +       +  
Sbjct  98   AKYPAGTSPCQR-AIIVAASVMVLASIVFIQEAVTKLVDGFSSDEPEAPVLSAAAIAIAA  156

Query  66   AISTKTI--LWYLCYRIGLTSPTA-KALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
                  I  ++Y  + +  T   A +A+ QD+ ND+LSN  AV   +   V    WYVD 
Sbjct  157  TAVIVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYVDP  216

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFG  182
             GAI+I +YI ++W     EQ+ +LVG+ A   FI+++++  + HHP M+ DI+RAYHFG
Sbjct  217  AGAIIIFVYIMVAWGKMAWEQITQLVGVCASEEFIKEVKELCSRHHPSMELDIVRAYHFG  276

Query  183  SNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            S YLVE+EV++P +MSV+ AHDI+L +Q K+E  + VERAFVHVDY AR YDEH
Sbjct  277  SKYLVELEVVVPGEMSVKLAHDIALQVQFKVENLEEVERAFVHVDYQARDYDEH  330

>PYAR_21138
Length=455

 Score = 169 bits (428),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 156/273 (57%), Gaps = 47/273 (17%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTIAVLL-  64
            +++PAG  R EP+AVI+++++M + ++  IQ+  + L  G+    P+     LT+  L+ 
Sbjct  110  AKFPAGTSRFEPVAVIVASSVMVVVSIVFIQEGSKKLYDGFAHGNPA--KPDLTVEALII  167

Query  65   --FAISTKTIL-----WYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENL  117
               +I+TK  L     W L      +S   +A+  D+RNDVLSN  A+I  +    +E L
Sbjct  168  SGLSITTKIFLMLYSRWVLKSH---SSVAVEAIQDDNRNDVLSNSFAIIAYIIASANEKL  224

Query  118  WYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFT-------------  164
            WYVD  GAI + L+I ++W   G EQV +LVG+ A   FI+++++               
Sbjct  225  WYVDPAGAIAVFLFIMVAWARMGKEQVMQLVGVTASAEFIDEVKELCRSHNAKLSLDIEQ  284

Query  165  ---------------------NNHHPQMQADIIRAYHFGSNYLVEVEVILPEKMSVREAH  203
                                 N+H+ ++  DI+RAYHFGS YLVEVEV++P  M+V++AH
Sbjct  285  VMQLVGVTASEEFIGEVKQLCNSHNNKLSLDIVRAYHFGSKYLVEVEVVVPGDMTVQDAH  344

Query  204  DISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            DI+L LQ K+E+ + VERAFVHVDY AR YDEH
Sbjct  345  DIALQLQFKVEQLEDVERAFVHVDYKAREYDEH  377

>PYAR_21139
Length=357

 Score = 162 bits (410),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 131/230 (57%), Gaps = 34/230 (15%)

Query  7    RYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTIAVLLFA  66
            R+PAG  RLEP+AV+++++ M + ++  IQ+  + L  G+    P               
Sbjct  105  RFPAGTSRLEPVAVVVASSTMMVLSVVFIQEGAKKLYDGFVHGDP---------------  149

Query  67   ISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDSVGAI  126
               K  L            T +A+ QD    VL      +   +  +  NLWYVD  GAI
Sbjct  150  --VKPHL------------TVEAIHQDLLGTVLP-----LDPQSPYISRNLWYVDPAGAI  190

Query  127  LISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFGSNYL  186
            +I L I ++W   G EQV +LVG+ A+  FI++++     H   +  DI+RAYHFG+ YL
Sbjct  191  VIFLLIMVAWGRMGKEQVMQLVGVAANDEFIDQVKQLCRGHDANLSLDILRAYHFGTKYL  250

Query  187  VEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEH  236
            VE+EVI+P  M+V++AHDI+L LQ K+E+ + VERAFVHVDY AR YDEH
Sbjct  251  VELEVIVPGDMAVQDAHDIALRLQFKVEKLEDVERAFVHVDYQAREYDEH  300

>PYIW_28078
Length=108

 Score = 108 bits (270),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 0/78 (0%)

Query  159  KLRDFTNNHHPQMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDS  218
            ++++  + HHP M  DI RAYHFGS YLVE+EV++P  M+V+ AHDI+L LQ K+E  D 
Sbjct  3    EVKELASGHHPSMSLDITRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLDD  62

Query  219  VERAFVHVDYLARGYDEH  236
            VERAFVHVDY AR YDEH
Sbjct  63   VERAFVHVDYKARDYDEH  80

>PYIW_26705
Length=230

 Score = 101 bits (252),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 93/163 (57%), Gaps = 19/163 (12%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTIAVLLF  65
            ++YPAG  R EP+A+I+++++M + A+  IQ+ V  L+ G+    P     +L+ A ++ 
Sbjct  75   AKYPAGTSRFEPVAIIVASSVMVLVAITFIQEGVTKLVNGFAHGNP--EAPKLSTAAVVL  132

Query  66   AISTKTILWYLCYRIGLT-----------SPTAKALAQDHRNDVLSNIAAVITSLTTKVH  114
            + S   I      +IGL+           S  A A+  D+RNDV SN  A+   + +  +
Sbjct  133  SSSIVVI------KIGLSAYSYWTIKRTYSAAAHAIGDDNRNDVFSNSFAIAAYIISSAN  186

Query  115  ENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFI  157
            E+LWYVD+ GAIL+ L+I  +W   G +QV +LVG++A   F+
Sbjct  187  EDLWYVDACGAILVFLFIMFAWAKMGKDQVAQLVGVRASEEFM  229

>PYIW_27182
Length=276

 Score = 96.7 bits (239),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 95/155 (61%), Gaps = 3/155 (2%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSI-NMTQLTIAVLL  64
            ++YPAG  R EP+A+I++A++M + ++  IQ+ V  L+ G     P    ++   + +++
Sbjct  120  AKYPAGTSRFEPVAIIVAASIMVLVSVVFIQEGVTKLVDGLAHGQPEAPKLSAAAVVIVV  179

Query  65   FAISTKT-ILWYLCYRIGLT-SPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDS  122
             A+  K  +++Y  + +  T S + +A+  D+RND +SN  A++  + + V+E+LWYVD 
Sbjct  180  LAVLVKIGLIFYARWVLTFTYSASVEAIMDDNRNDTISNAFAIVAYIISSVNEDLWYVDP  239

Query  123  VGAILISLYIAISWLATGSEQVQRLVGLQADPVFI  157
             GAILI L+I  +W   G EQV +LVG+ A   F+
Sbjct  240  AGAILIFLFIMFAWGKMGKEQVAQLVGVCASEEFM  274

>PYAP_18437
Length=451

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 60/101 (59%), Gaps = 7/101 (7%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGY---EGTLPSINMTQLTIAV  62
            +++PAG  R EP+AVI+++++M + ++  IQ+ ++ L+ G    E   P +++  + I  
Sbjct  337  AKFPAGTSRFEPVAVIVASSIMVLVSVFFIQEGIKKLVDGLVHGEPEKPELSVAAVVITS  396

Query  63   LLFAISTKTILWYLCYRI--GLTSPTAKALAQDHRNDVLSN  101
            L  AISTK  L     R+    TS   +A+  D+RNDV+SN
Sbjct  397  L--AISTKVFLMMYASRVLKTHTSAAVEAIQDDNRNDVVSN  435

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 60/106 (57%), Gaps = 9/106 (8%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSI-NMTQLTIAVLL  64
            +++PAG  R EP+AVI+++++M + ++  IQ+  + L+ G+    P   N+T   + +  
Sbjct  111  AKFPAGTSRFEPVAVIVASSVMVLVSVVFIQEGAKKLVDGFAHDNPEKPNLTIEALVIAG  170

Query  65   FAISTKTIL-----WYLCYRIGLTSPTAKALAQDHRNDVLSNIAAV  105
             AISTK  L     W L      TS   +A+  D+RNDV+SN  A+
Sbjct  171  MAISTKVFLILYSRWVLKTH---TSAAVEAIQDDNRNDVVSNSFAI  213

>PYAR_21141
Length=139

 Score = 39.7 bits (91),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 39/64 (61%), Gaps = 8/64 (13%)

Query  6    SRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGY--------EGTLPSINMTQ  57
            +++PAG  R EP+AVI+++++M + +L  IQ+ V  ++ G         E ++P++ +  
Sbjct  74   AKFPAGTSRFEPVAVIVASSIMVLVSLFFIQEGVTKIVDGVIHKNPEKPELSVPAVVIVS  133

Query  58   LTIA  61
            L I+
Sbjct  134  LAIS  137

>CCA18823
Length=432

 Score = 38.1 bits (87),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 51/247 (21%), Positives = 102/247 (41%), Gaps = 32/247 (13%)

Query  4    PSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLII--GYEGTLPSINM-TQLTI  60
            P  ++P G  + E +  +   TL+      V   + + L +     G++  +   TQL +
Sbjct  88   PDIQHPYGYGKYEAVGSLTVGTLLLFCGAGVAIDSFQALWVEPSVSGSIAGLQRETQLAL  147

Query  61   AVLL--FAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAA---VITSLTTKVHE  115
            A  +   +I+ K +L+    R+ + +      A  HR D LS+I A   ++ S+      
Sbjct  148  AASMAGVSITAKELLYRATVRVLIAN------AWHHRTDALSSIVALGGIVGSICGAP--  199

Query  116  NLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDF------------  163
               ++D    IL++  IA + ++   + V+ L     +   +  +RD             
Sbjct  200  ---FLDPAAGILVAAMIAKTGISVSMDSVRELTDKTVEDDVLNLVRDLVRVSSRSSHSLQ  256

Query  164  TNNHHPQMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKI-EEFDSVERA  222
            + +    +    +RA   G   LV++ V L  + SV  A  ++  L+  I  +  S+   
Sbjct  257  SRDVEDVLHVSHVRARRMGPYTLVDLRVYLHARASVSMAQQVTARLRAHITRQLPSISEL  316

Query  223  FVHVDYL  229
             VH+D +
Sbjct  317  SVHIDVM  323

>PYIW_20676
Length=946

 Score = 36.2 bits (82),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 25/101 (25%), Positives = 50/101 (50%), Gaps = 7/101 (7%)

Query  96   NDVLSNIAAVITSLTTKVHENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPV  155
            N  LS + +V+ +L T  +   W++  +  +L+S Y++  +    S ++QRL  +   P+
Sbjct  501  NGFLSTLVSVLVTLVTISYITPWFMVILAPVLLSYYVSQRYFIKTSRELQRLDSISRSPI  560

Query  156  FIEKLRDFTNNHHPQMQADIIRAYHFGSNYLVEVEVILPEK  196
            F   L   T +  P      IRAY   +N++   +++L + 
Sbjct  561  F--ALLSETLDGLP-----TIRAYGVENNFMGRNQLLLDKN  594

>PYIR_14427
Length=902

 Score = 36.2 bits (82),  Expect = 0.20, Method: Composition-based stats.
 Identities = 30/108 (28%), Positives = 56/108 (52%), Gaps = 7/108 (6%)

Query  138  ATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFGSNYLVEVEVILPEK-  196
            + G+EQ Q L  LQ DP  +EK  D  +     ++ +I +A       +VE++ I+ E+ 
Sbjct  214  SCGTEQKQ-LAQLQNDPERMEKQADVVHKAVANLEREIAKA----REKIVELDAIIDEQT  268

Query  197  MSVREAHDISLDLQKKIE-EFDSVERAFVHVDYLARGYDEHKDPTLRR  243
            +  REA D+  +L  K++   D++++    VD++     E ++  L R
Sbjct  269  IKAREAEDVQKELSHKLDVHRDTIDQRQRDVDHVNLHLREEQNTHLLR  316

>PYIW_19834
Length=947

 Score = 34.7 bits (78),  Expect = 0.60, Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 53/113 (47%), Gaps = 12/113 (11%)

Query  140  GSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYHFGSNYLVEVEVILPEK-MS  198
            G+E  Q LV LQ+DP  +EK  D        ++ +I +A       LVE++  + E+ + 
Sbjct  218  GAEHKQ-LVQLQSDPERMEKQADVVQKAVANLEREIAKA----REKLVELDATVDEQNVK  272

Query  199  VREAHDISLDLQKKI----EEFDSVERAFVHVDYLARGYDEHKDPTLRRSTSS  247
             REA D+  +L  K+    +  D  +R   HV+   R  +E     LR S  +
Sbjct  273  TREAEDVQKELSHKLDVHRDTIDQRQRDVDHVNLHLR--EEQNTHVLRLSEKT  323

>PYAR_26156
Length=292

 Score = 32.7 bits (73),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 3/84 (4%)

Query  97   DVLSNIAAVITSLTTKVHENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVF  156
            D++ ++A+   SL      +LW   S   +L+   +   +    S +V+RL G+   PVF
Sbjct  140  DLVESLASFFGSLVVCAFASLWIAVSYLPMLLIFVLTGLYFKRTSREVKRLEGITRTPVF  199

Query  157  I---EKLRDFTNNHHPQMQADIIR  177
                E L         QMQ D +R
Sbjct  200  NLFGETLNGLATIRAFQMQRDFVR  223

>PYU1_G001828
Length=318

 Score = 32.0 bits (71),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (53%), Gaps = 0/57 (0%)

Query  179  YHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDE  235
            Y  G   +V+V +++   + V +AH ++   +K IEE   +  A +H++ L    DE
Sbjct  259  YINGCGTVVDVAIVVHPDLKVGDAHSVAKRARKAIEEISYISEADIHLELLDNDNDE  315

>PYVX_23335
Length=1443

 Score = 32.0 bits (71),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (9%)

Query  194   PEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKD  238
             P++ +VR  HD SLD+ ++I   D + ++F  V  L R   EHKD
Sbjct  1393  PKRSAVRSRHDPSLDV-RRIHNPDDIPKSFRAVLQLKR---EHKD  1433

>PYIR_17740
Length=289

 Score = 31.2 bits (69),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 14/104 (13%)

Query  21   IISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTIAVLLFAISTKTILWYLCYRI  80
            IIS TL+G  A++V       +I+ +   +P   M  L+ ++L             C  +
Sbjct  78   IISVTLLG--AIDVFLAVAGYVILRFRFRIPLPAMDALSSSLLF------------CATL  123

Query  81   GLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYVDSVG  124
             + SP  + L + + ND +S +A+ +  L    H+  +    +G
Sbjct  124  SILSPVLRTLTKSYANDTISALASFLAFLHIVSHDYNYVNSGIG  167

>HYAP_06227
Length=251

 Score = 31.2 bits (69),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 21/108 (19%), Positives = 50/108 (46%), Gaps = 6/108 (6%)

Query  4    PSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEG----TLPSINMTQLT  59
            P  ++P G  + E +  +    ++ +  + +    ++ +   + G    TLP +N+  L+
Sbjct  45   PDQKHPYGYGKYEAVGSLSVGAILVLCGVGIGADGLQAMQQIWSGEIATTLPDLNLLYLS  104

Query  60   IAVLLFAISTKTILWYLCYRIGLTSPTAKALAQD--HRNDVLSNIAAV  105
                  +I+ K  L+ +  +IG  + +   +A    HR D +S++ A+
Sbjct  105  AGAAGLSIAAKEALFRVTVKIGQQAKSKVLIANAWHHRTDAISSVVAL  152

>PYIW_21326
Length=517

 Score = 31.6 bits (70),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 4/60 (7%)

Query  179  YHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKD  238
            Y  GS  +V+V +++   + V +AH ++   +K IE    V  A +H++ L    DE+++
Sbjct  458  YLNGSGTVVDVAIVVHPDLKVGDAHSVAKRARKAIEAISYVSEADIHLELL----DEYRE  513

>HYAP_11200
Length=340

 Score = 30.8 bits (68),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query  60   IAVLLFAISTKTILWYLCYRIGLTSPTAKALAQ---DHRNDVLSNIAA  104
            +A+LLF   T   L +LC+R G+ S   +  A     HRN +L+++ A
Sbjct  9    VALLLFIPVTLVALLFLCFRAGIDSENTRRGAPHTLSHRNFLLAHVFA  56

>H310_00132
Length=568

 Score = 30.8 bits (68),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 30/64 (47%), Gaps = 0/64 (0%)

Query  4    PSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTIAVL  63
            P   Y A R+  +   ++  AT++ M ++ V   A + LI G EG LP +      +A  
Sbjct  180  PQCVYYALRQYFQAQEIVTPATVINMLSVGVCIGANQVLIYGIEGVLPGLGFIGSPLAQF  239

Query  64   LFAI  67
              AI
Sbjct  240  AAAI  243

Lambda      K        H        a         alpha
   0.321    0.134    0.387    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13427522280

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40