Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCA189011617237337318760.0
CCI451291617237237216400.0
CCI451301598224824712326e-171
CCI4512816170183125713111e-165
PYAP_165721598241335111045e-149
PYIW_177531598239833710982e-148
PYIR_226431598240234410932e-147
PYU1_G0019721598240035510852e-146
PYAR_242971598238634310807e-146
H257_073711617235132310333e-139
SPRG_124871617234632710323e-139
SDRG_050011617234632710239e-138
H310_075761617235132610101e-135
PHALS_051941598236333010102e-135
PHYRA_847311598237133010102e-135
PPTG_101851598236334310041e-134
PYVX_146081598238534310035e-134
PHYCA_123086159822712569455e-127
PHYKE_10819159823443308866e-117
PHYSO_471886159822462458574e-114
PITG_20630161722462458558e-114
PITG_20313159822462458514e-113
HYAP_13828159823733357931e-102
PYIR_23853151514202995729e-69
PYU1_G008337151514142995701e-68
SPRG_06805151513412515614e-68
PYU1_G008336836514063055622e-67
SDRG_12928151513412515511e-66
PHYSO_552775151513952965482e-65
PHYCA_543819151514462965486e-65
PHYCA_533347836514172965422e-64
PHYRA_83397151513842965367e-64
PPTG_17622151513952965351e-63
PHYRA_9659388456132965473e-63
PYVX_16542151513882965281e-62
PYVX_16559836513762955035e-59
PITG_19056151513902965002e-58
PYIR_21123836513883024844e-56
PYAR_21138151514553354493e-50
PYAR_21139836513572934259e-48
PYIW_28078167629108802723e-28
PYIW_27182151512762222713e-26
PYIW_26705836512302262674e-26
PYAP_18437151514511641572e-10
PYAR_2114188451391281059e-05
PYIW_2067611371946100780.99
PYVX_233357696144345762.0
PYU1_G0002961065550953752.1
PHYSO_3152634963874891717.7
HYAP_112001388434045708.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCA18901

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CCA18901                                                              727     0.0   
CCI45129                                                              636     0.0   
CCI45130                                                              479     6e-171
CCI45128                                                              509     1e-165
PYAP_16572                                                            429     5e-149
PYIW_17753                                                            427     2e-148
PYIR_22643                                                            425     2e-147
PYU1_G001972                                                          422     2e-146
PYAR_24297                                                            420     7e-146
H257_07371                                                            402     3e-139
SPRG_12487                                                            402     3e-139
SDRG_05001                                                            398     9e-138
H310_07576                                                            393     1e-135
PHALS_05194                                                           393     2e-135
PHYRA_84731                                                           393     2e-135
PPTG_10185                                                            391     1e-134
PYVX_14608                                                            390     5e-134
PHYCA_123086                                                          368     5e-127
PHYKE_10819                                                           345     6e-117
PHYSO_471886                                                          334     4e-114
PITG_20630                                                            333     8e-114
PITG_20313                                                            332     4e-113
HYAP_13828                                                            310     1e-102
PYIR_23853                                                            224     9e-69 
PYU1_G008337                                                          224     1e-68 
SPRG_06805                                                            220     4e-68 
PYU1_G008336                                                          221     2e-67 
SDRG_12928                                                            216     1e-66 
PHYSO_552775                                                          215     2e-65 
PHYCA_543819                                                          215     6e-65 
PHYCA_533347                                                          213     2e-64 
PHYRA_83397                                                           211     7e-64 
PPTG_17622                                                            210     1e-63 
PHYRA_96593                                                           215     3e-63 
PYVX_16542                                                            207     1e-62 
PYVX_16559                                                            198     5e-59 
PITG_19056                                                            197     2e-58 
PYIR_21123                                                            191     4e-56 
PYAR_21138                                                            177     3e-50 
PYAR_21139                                                            168     9e-48 
PYIW_28078                                                            109     3e-28 
PYIW_27182                                                            108     3e-26 
PYIW_26705                                                            107     4e-26 
PYAP_18437                                                            65.1    2e-10 
PYAR_21141                                                            45.1    9e-05 
PYIW_20676                                                            34.7    0.99  
PYVX_23335                                                            33.9    2.0   
PYU1_G000296                                                          33.5    2.1   
PHYSO_315263                                                          32.0    7.7   
HYAP_11200                                                            31.6    8.0   

>CCA18901
Length=373

 Score = 727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%), Gaps = 0/373 (0%)

Query  1    MQYGPIDNENESVLESARLSAFCGNLPVYKDAASPLLGEHRENRRSQIAHSLIHKQNGEE  60
            MQYGPIDNENESVLESARLSAFCGNLPVYKDAASPLLGEHRENRRSQIAHSLIHKQNGEE
Sbjct  1    MQYGPIDNENESVLESARLSAFCGNLPVYKDAASPLLGEHRENRRSQIAHSLIHKQNGEE  60

Query  61   IEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFW  120
            IEIVPAATSRHVGSVIRASLIANIILACGKLYAAINSGSLAVLSSLVDSILDLTSQGLFW
Sbjct  61   IEIVPAATSRHVGSVIRASLIANIILACGKLYAAINSGSLAVLSSLVDSILDLTSQGLFW  120

Query  121  FSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKM  180
            FSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKM
Sbjct  121  FSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKM  180

Query  181  NQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHT  240
            NQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHT
Sbjct  181  NQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHT  240

Query  241  NLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADI  300
            NLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADI
Sbjct  241  NLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADI  300

Query  301  IRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDE  360
            IRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDE
Sbjct  301  IRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDE  360

Query  361  HKDPTLRRSTSSS  373
            HKDPTLRRSTSSS
Sbjct  361  HKDPTLRRSTSSS  373

>CCI45129
Length=372

 Score = 636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/372 (88%), Positives = 351/372 (94%), Gaps = 1/372 (0%)

Query  1    MQYGPIDNENESVLESARLSAFCGNLPVYKDAASPLLGEHRENRRSQIAHSLIHKQNGEE  60
            M +G  DNE+ +  ES  L A+   LP+YKDAASPLLGEHRE RRSQIAHSLIHKQNGEE
Sbjct  1    MNHG-YDNESATEFESTHLPAYLLALPIYKDAASPLLGEHREIRRSQIAHSLIHKQNGEE  59

Query  61   IEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFW  120
            ++++PAATSRHVGS+IRAS IANI+LACGKLYAAI+SGSL+VLSSLVDSILDLTSQGLFW
Sbjct  60   VQMIPAATSRHVGSIIRASFIANILLACGKLYAAISSGSLSVLSSLVDSILDLTSQGLFW  119

Query  121  FSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKM  180
            FSDKRMHTPSS+YPAGRRRLEPI VIISATLMGMAALEVIQKAVETLIIGYEGTLP+I M
Sbjct  120  FSDKRMHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINM  179

Query  181  NQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHT  240
             Q TIAVLLFAISTKTILWYLC+RIGLTSPTA+A+AQDHRNDVLSN AAVITSLT K+H 
Sbjct  180  TQLTIAVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHE  239

Query  241  NLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADI  300
            NLWY+DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFI+KLR+FTNNHHP+MQADI
Sbjct  240  NLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADI  299

Query  301  IRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDE  360
            IRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQ+KIEEFD+VERAFVHVDYLARGYDE
Sbjct  300  IRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDE  359

Query  361  HKDPTLRRSTSS  372
            HKDPTLRRSTSS
Sbjct  360  HKDPTLRRSTSS  371

>CCI45130
Length=248

 Score = 479 bits (1232),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 228/247 (92%), Positives = 240/247 (97%), Gaps = 0/247 (0%)

Query  126  MHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTI  185
            MHTPSS+YPAGRRRLEPI VIISATLMGMAALEVIQKAVETLIIGYEGTLP+I M Q TI
Sbjct  1    MHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTLPSINMTQLTI  60

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
            AVLLFAISTKTILWYLC+RIGLTSPTA+A+AQDHRNDVLSN AAVITSLT K+H NLWY+
Sbjct  61   AVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLTTKVHENLWYV  120

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFI+KLR+FTNNHHP+MQADIIRAYH
Sbjct  121  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQMQADIIRAYH  180

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPT  365
            FGSNYLVEVEVILPEKMSVREAHDISLDLQ+KIEEFD+VERAFVHVDYLARGYDEHKDPT
Sbjct  181  FGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLARGYDEHKDPT  240

Query  366  LRRSTSS  372
            LRRSTSS
Sbjct  241  LRRSTSS  247

>CCI45128
Length=1831

 Score = 509 bits (1311),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 238/257 (93%), Positives = 250/257 (97%), Gaps = 0/257 (0%)

Query  116   QGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTL  175
             QGLFWFSDKRMHTPSS+YPAGRRRLEPI VIISATLMGMAALEVIQKAVETLIIGYEGTL
Sbjct  1574  QGLFWFSDKRMHTPSSRYPAGRRRLEPIAVIISATLMGMAALEVIQKAVETLIIGYEGTL  1633

Query  176   PNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLT  235
             P+I M Q TIAVLLFAISTKTILWYLC+RIGLTSPTA+A+AQDHRNDVLSN AAVITSLT
Sbjct  1634  PSINMTQLTIAVLLFAISTKTILWYLCYRIGLTSPTAKALAQDHRNDVLSNIAAVITSLT  1693

Query  236   AKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPK  295
              K+H NLWY+DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFI+KLR+FTNNHHP+
Sbjct  1694  TKVHENLWYVDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIEKLRDFTNNHHPQ  1753

Query  296   MQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLA  355
             MQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQ+KIEEFD+VERAFVHVDYLA
Sbjct  1754  MQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQKKIEEFDSVERAFVHVDYLA  1813

Query  356   RGYDEHKDPTLRRSTSS  372
             RGYDEHKDPTLRRSTSS
Sbjct  1814  RGYDEHKDPTLRRSTSS  1830

>PYAP_16572
Length=413

 Score = 429 bits (1104),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 226/351 (64%), Positives = 274/351 (78%), Gaps = 16/351 (5%)

Query  38   GEHRENRRSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANI-------------  84
            G  R NRRSQ+AH+L+HKQ+  E++ +  ATS  V + IRASL+ N+             
Sbjct  63   GGARRNRRSQVAHALLHKQSDTELQSMAPATSAKVQTAIRASLVINVVRDRDTADDESKG  122

Query  85   ---ILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLE  141
               ILA  K YAAI SGSLAVLSSLVDSILDLTSQ LFW+SDK MHTP+  YPAGRRRLE
Sbjct  123  CDDILAIAKTYAAIASGSLAVLSSLVDSILDLTSQWLFWYSDKHMHTPNVNYPAGRRRLE  182

Query  142  PIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYL  201
            PI +IISATLMGMAA+EV+QK++ETL+ G+ G+LP++ M  FT+ VLLFAI  K +LW++
Sbjct  183  PIALIISATLMGMAAIEVVQKSIETLVSGFAGSLPDLDMTPFTVGVLLFAICIKIVLWWI  242

Query  202  CFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISW  261
            C RI   S +A A+AQDHRNDV SN+ AV TSL +    +LWY+DS+GAI IS+YIA SW
Sbjct  243  CARISTNSSSADALAQDHRNDVFSNTVAVSTSLLSHWKRDLWYVDSIGAIAISVYIAFSW  302

Query  262  LATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEK  321
            LATG EQV+RL+GL+ADP FI+++R  T+ HHP M++DIIRAYHFG+NYLVE+EVILP  
Sbjct  303  LATGKEQVERLIGLRADPDFIEQIRELTDLHHPLMKSDIIRAYHFGNNYLVELEVILPAD  362

Query  322  MSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPTLRRSTSS  372
            M VREAHDISL LQ K+EE DNVERAFVHVDYL+R YDEHKDPTLRR +SS
Sbjct  363  MCVREAHDISLALQNKVEELDNVERAFVHVDYLSRDYDEHKDPTLRRDSSS  413

>PYIW_17753
Length=398

 Score = 427 bits (1098),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/337 (66%), Positives = 265/337 (79%), Gaps = 0/337 (0%)

Query  35   PLLGEHRENRRSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKLYAA  94
            P+  +    RRSQ+AHSL+HKQN  E +++PA+ S  V   I ASL  N++LA  K YAA
Sbjct  61   PIASQRDTMRRSQVAHSLLHKQNDLEAQLIPASASLRVQLAINASLAINVVLAVAKTYAA  120

Query  95   INsgslavlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGM  154
            + SGSLAVLSSLVDSILDLTSQGLFW+SDKRMHTPS KYPAGRRRLEPI VIISATLMGM
Sbjct  121  VTSGSLAVLSSLVDSILDLTSQGLFWYSDKRMHTPSVKYPAGRRRLEPIAVIISATLMGM  180

Query  155  AALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARA  214
            AA+EV+QK+ ETL+ G  G LP++ M   TI VL  AI  K +LWY+C RI   SP+A A
Sbjct  181  AAIEVMQKSGETLVAGVNGHLPDLNMTTSTIVVLCVAICVKLVLWYICSRIAKNSPSADA  240

Query  215  IAQDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVG  274
            +AQDHRNDV SN  AV+TS+ A     LWY+DSVG I+ISLYIA+SWLATG EQV++LVG
Sbjct  241  LAQDHRNDVFSNVVAVVTSVLAHWQRQLWYLDSVGGIVISLYIALSWLATGKEQVEKLVG  300

Query  275  LQADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDL  334
            L+ADP FI ++    + HHP M++DI+RAYHFG+NYLVE+EVILPE+M VREAHDISL L
Sbjct  301  LKADPDFIAQIHGLVDLHHPLMKSDIVRAYHFGNNYLVELEVILPEQMCVREAHDISLAL  360

Query  335  QRKIEEFDNVERAFVHVDYLARGYDEHKDPTLRRSTS  371
            Q K+E  D VERAFVHVDY +R YDEHKDPT+RR ++
Sbjct  361  QDKVEALDCVERAFVHVDYASRDYDEHKDPTIRRDSA  397

>PYIR_22643
Length=402

 Score = 425 bits (1093),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/344 (64%), Positives = 273/344 (79%), Gaps = 2/344 (1%)

Query  30   KDAASP-LLGEHREN-RRSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILA  87
            K+  SP L+ + R+  RRSQ+AHSL+HKQ+  E +++P + S  V   I ASL+ N++LA
Sbjct  58   KNYDSPQLVPQQRDTVRRSQVAHSLLHKQSELEAQLIPPSASLRVQLAINASLVINVLLA  117

Query  88   CGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVII  147
              K+YAA  SGSLAVLSSLVDSILDLTSQ LFW+SDKRMHTPS KYPAGRRRLEPI VII
Sbjct  118  IAKVYAAATSGSLAVLSSLVDSILDLTSQALFWYSDKRMHTPSVKYPAGRRRLEPIAVII  177

Query  148  SATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGL  207
            SATLMGMAA+EV+QK+VETL+ G++G LP++ M   TI +L  AI  K +LWY+C RI  
Sbjct  178  SATLMGMAAIEVMQKSVETLVAGFKGNLPDLNMTLITIVILCVAICVKLVLWYICSRIAT  237

Query  208  TSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSE  267
             SP+A A+AQDHRNDV SN  AV+TS  A    +LWY+DS+G ILIS+YIA+SWLATG E
Sbjct  238  NSPSADALAQDHRNDVFSNVVAVVTSALAHWQRDLWYLDSIGGILISMYIALSWLATGKE  297

Query  268  QVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREA  327
            QV++LVGLQADP FI+++    + HHP M++DI+RAYHFG+NYLVE+EVILPE+M V+EA
Sbjct  298  QVEKLVGLQADPDFINQIYGLADLHHPLMKSDIVRAYHFGNNYLVELEVILPEQMCVKEA  357

Query  328  HDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPTLRRSTS  371
            HDISL LQ K+E  D VERAFVHVDY  R YDEHKDPT+RR ++
Sbjct  358  HDISLALQDKVEALDCVERAFVHVDYAPRDYDEHKDPTIRRDSA  401

>PYU1_G001972
Length=400

 Score = 422 bits (1085),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/355 (62%), Positives = 272/355 (77%), Gaps = 7/355 (2%)

Query  24   GNLPVYKDAAS-------PLLGEHRENRRSQIAHSLIHKQNGEEIEIVPAATSRHVGSVI  76
            G +P+ +D A          L      RRSQ+AH+L+HKQN  E + +PA+ S  V   I
Sbjct  45   GAIPLARDTAESSDADDFAALIPREPARRSQVAHALLHKQNDLEAQQIPASASHRVQLAI  104

Query  77   RASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPSSKYPAG  136
             ASL+ N++LA  KLYAAI+SGSLAVLSSLVDSILDLTSQ LFW+SDKRMHTPS +YPAG
Sbjct  105  NASLVINVMLATAKLYAAISSGSLAVLSSLVDSILDLTSQVLFWYSDKRMHTPSVRYPAG  164

Query  137  RRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKT  196
            RRRLEPI VIISATLMGMAA+EVIQK+ ETLI G +G LP++ M+  TI +L  AI  K 
Sbjct  165  RRRLEPIAVIISATLMGMAAVEVIQKSTETLIAGTKGNLPDLNMSALTILILCVAICVKL  224

Query  197  ILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLY  256
            +LW++C RI   SP+A A+AQDHRNDV SN+ AV+TS+ A    +LWY+DS+G ILISLY
Sbjct  225  VLWFICSRIAKNSPSADALAQDHRNDVFSNAVAVLTSVIAHYQRDLWYLDSIGGILISLY  284

Query  257  IAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEV  316
            IA+SWLATG EQV++L GLQAD  FID++    + HHP +++DI+RAYHFG+NYLVE+EV
Sbjct  285  IALSWLATGKEQVEKLAGLQADSAFIDEIYELVDVHHPLLRSDIVRAYHFGNNYLVELEV  344

Query  317  ILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPTLRRSTS  371
            ILPE M V++AHDISL LQ K+E  D VERAFVHVDY  R YDEHKDPT+RR ++
Sbjct  345  ILPETMCVKDAHDISLALQHKVEALDAVERAFVHVDYAPRDYDEHKDPTIRRDSA  399

>PYAR_24297
Length=386

 Score = 420 bits (1080),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 221/343 (64%), Positives = 268/343 (78%), Gaps = 1/343 (0%)

Query  28   VYKDAASPLLGEHRENRRSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILA  87
            V +DA +   G  R+ RRSQ+AH+L+  Q+  E++ +  A S  V + IRASL+ N+ILA
Sbjct  44   VLRDADAGNKGSRRD-RRSQVAHALLRNQSATELQHMAPAASAKVQTAIRASLVINVILA  102

Query  88   CGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVII  147
              K YAA  SGSLAVLSSLVDSILDLTSQ LFW+SDK MHTP+  YPAGRRRLEPI V+I
Sbjct  103  VAKTYAAFASGSLAVLSSLVDSILDLTSQWLFWYSDKHMHTPNVNYPAGRRRLEPIAVVI  162

Query  148  SATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGL  207
            SATLMGMAA+EV+QK++ETL+ GY G+LP++ M   TI VL+FAI+ K +LW +C RI  
Sbjct  163  SATLMGMAAIEVVQKSIETLVTGYNGSLPDLDMTPLTIGVLVFAIAIKLVLWSICARIAA  222

Query  208  TSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSE  267
             S +A A+AQDHRNDV SNS AV TSL A    +LWY DS+GAI IS+YI  SWLATG E
Sbjct  223  NSSSADALAQDHRNDVFSNSVAVTTSLIAHYRRDLWYTDSLGAIAISVYIGFSWLATGKE  282

Query  268  QVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREA  327
            QV+RL+GL A+P FI+++R   + HHP MQ+DI+RAYHFG+NYLVE+EVILP  M VREA
Sbjct  283  QVERLIGLGAEPDFIERIRALVDLHHPLMQSDIVRAYHFGNNYLVELEVILPATMCVREA  342

Query  328  HDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPTLRRST  370
            HDISL LQ K+EE DNVERAFVHVDYLAR YDEHKDPT+RR +
Sbjct  343  HDISLALQNKVEELDNVERAFVHVDYLARDYDEHKDPTIRRDS  385

>H257_07371
Length=351

 Score = 402 bits (1033),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/323 (65%), Positives = 256/323 (79%), Gaps = 0/323 (0%)

Query  45   RSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgslavls  104
            RS +AHSLI +Q   E   +P A S+ V   I +S+I N+ILA  K YAAI SGSLAVLS
Sbjct  27   RSAVAHSLILQQEAGEARCIPEAASQKVQLAITSSIIINVILAIAKTYAAITSGSLAVLS  86

Query  105  slvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAV  164
            SLVDSILDLTSQGLFWFSD+ MHTP++KYPAGRRRLEPI V++SATLMGMAALEV+QK+V
Sbjct  87   SLVDSILDLTSQGLFWFSDRYMHTPNAKYPAGRRRLEPIAVVVSATLMGMAALEVVQKSV  146

Query  165  ETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVL  224
             TLI G+ G LP + M+  T+AVL  AI  K +LW+LC +I   SP+A A+AQDHRNDV 
Sbjct  147  TTLIEGFGGQLPELDMSIPTVAVLGIAIIVKLMLWFLCGQIAYVSPSAAALAQDHRNDVF  206

Query  225  SNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDK  284
            SN+ AV TSL A  ++ LWY D +GAI IS+YI +SW+ATG EQV+RLVGLQAD  FID+
Sbjct  207  SNAVAVTTSLVAHYNSELWYFDPIGAIAISIYITLSWVATGKEQVERLVGLQADQDFIDR  266

Query  285  LRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNV  344
            +R   + HHPK+Q+DIIRAYHFG+N+LVE+EV+LP+ MSV+E+HDISL LQ K+E  D V
Sbjct  267  VRTIADAHHPKLQSDIIRAYHFGNNFLVELEVVLPKDMSVQESHDISLALQIKVEALDEV  326

Query  345  ERAFVHVDYLARGYDEHKDPTLR  367
            ERAFVHVDY +R YDEHKDPT R
Sbjct  327  ERAFVHVDYQSRDYDEHKDPTAR  349

>SPRG_12487
Length=346

 Score = 402 bits (1032),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 257/327 (79%), Gaps = 0/327 (0%)

Query  45   RSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgslavls  104
            RS +AHSL+H+Q+  E+  +P ATS+ V   I AS++ NIILA  K YAA+ SGSLAVLS
Sbjct  20   RSAVAHSLLHQQDANEVRCLPQATSQRVQLAISASIVINIILAIAKTYAAVVSGSLAVLS  79

Query  105  slvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAV  164
            SLVDSILDLTSQGLFWF+D+ MHTPS  YPAGRRRLEPI V++SATLMGMA+LEV+QK++
Sbjct  80   SLVDSILDLTSQGLFWFTDRYMHTPSPDYPAGRRRLEPIAVVVSATLMGMASLEVVQKSI  139

Query  165  ETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVL  224
             TLI G+ G LP + M+  TIAVL  AI  K ILW+LC +I   SP+A A+AQDHRNDV 
Sbjct  140  ATLIEGFNGHLPELDMSILTIAVLAIAIVVKLILWFLCAQIAHVSPSAAALAQDHRNDVF  199

Query  225  SNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDK  284
            SN+ AV TS+ A  +  +WY+D +GAI IS+YI  SWL TG EQV RLVG+QAD  FI +
Sbjct  200  SNAVAVTTSMIAHYNVEMWYLDPIGAICISIYITWSWLETGKEQVDRLVGIQADEDFIAR  259

Query  285  LRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNV  344
            +    + HHP MQ+DI+RAYHFG+N+LVE+EVI+P+ M+V +AHDISL LQ+K+EE D V
Sbjct  260  IDGIADTHHPDMQSDIVRAYHFGNNFLVELEVIMPKSMTVGDAHDISLALQKKVEELDAV  319

Query  345  ERAFVHVDYLARGYDEHKDPTLRRSTS  371
            ERAFVHVDY +R YDEHKDPT+R+ +S
Sbjct  320  ERAFVHVDYESRDYDEHKDPTIRKDSS  346

>SDRG_05001
Length=346

 Score = 398 bits (1023),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 204/327 (62%), Positives = 257/327 (79%), Gaps = 0/327 (0%)

Query  45   RSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgslavls  104
            RS +AHSL+H+Q+  E+  +P ATS+ V   I AS++ NIILA  K YAA+ SGSLAVLS
Sbjct  20   RSAVAHSLLHQQDANEVRCLPQATSQRVQLAISASIVINIILAIAKTYAAVVSGSLAVLS  79

Query  105  slvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAV  164
            SLVDSILDLTSQGLFWF+D+ MHTPS  YPAGRRRLEPI V++SATLMGMA+LEV+QK++
Sbjct  80   SLVDSILDLTSQGLFWFTDRYMHTPSPDYPAGRRRLEPIAVVVSATLMGMASLEVVQKSI  139

Query  165  ETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVL  224
             TLI G+ G +P + M+  TIAVL  AI  K ILW+LC +I   SP+A A+AQDHRNDV 
Sbjct  140  ATLIEGFNGHVPELDMSILTIAVLAVAIVVKLILWFLCAQIAHVSPSAAALAQDHRNDVF  199

Query  225  SNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDK  284
            SN  AV TS+ A  + + WY+D +GAI IS+YI  SWL TG EQV RLVG+QAD  FI +
Sbjct  200  SNGVAVTTSMIAHYNIDAWYLDPIGAICISIYITWSWLETGKEQVDRLVGIQADEDFIQR  259

Query  285  LRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNV  344
            +    ++HHP MQ+DI+RAYHFG+N+LVE+EV++P+ M+V +AHDISL LQ+K+EE D V
Sbjct  260  IHAIADSHHPDMQSDIVRAYHFGNNFLVELEVVMPKSMTVGDAHDISLALQKKVEELDAV  319

Query  345  ERAFVHVDYLARGYDEHKDPTLRRSTS  371
            ERAFVHVDY +R YDEHKDPT+R+ +S
Sbjct  320  ERAFVHVDYESRDYDEHKDPTIRKDSS  346

>H310_07576
Length=351

 Score = 393 bits (1010),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 258/326 (79%), Gaps = 0/326 (0%)

Query  42   ENRRSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgsla  101
            ++ RS ++HSLI +Q   E   +P A S+ V   I +S++ N++LA  K YAA++SGSLA
Sbjct  24   KHTRSAVSHSLILQQEAGEARCLPEAASQKVQLAITSSIVINVLLAIAKTYAAVSSGSLA  83

Query  102  vlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQ  161
            VLSSLVDSILDLTSQ LFWFSD+ MHTP+ KYPAGRRRLEPI V++SATLMGMA+LEV+Q
Sbjct  84   VLSSLVDSILDLTSQALFWFSDRYMHTPNEKYPAGRRRLEPIAVVVSATLMGMASLEVVQ  143

Query  162  KAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRN  221
            K+V TLI G+ G LP + M+  TIAVL  AI+ K +LW++C +I   SP+A A+AQDHRN
Sbjct  144  KSVTTLIEGFGGHLPELDMSILTIAVLGVAITVKLMLWFICGQIAYVSPSAAALAQDHRN  203

Query  222  DVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVF  281
            DV SN  AV TSL A  ++ LWY D +GAI IS+YI +SW+ATG EQV+RLVGLQAD  F
Sbjct  204  DVFSNLVAVSTSLMAHYYSGLWYFDPIGAIAISIYITLSWVATGKEQVERLVGLQADEDF  263

Query  282  IDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEF  341
            I+++R   + HHPK+Q+DIIRAYHFG+N+LVE+EV+LP+ MSV+E+HDISL LQ K+E  
Sbjct  264  IERVRAIADAHHPKLQSDIIRAYHFGNNFLVELEVVLPKDMSVQESHDISLALQIKVEAL  323

Query  342  DNVERAFVHVDYLARGYDEHKDPTLR  367
            D VERAFVHVDY +R YDEHKDPT+R
Sbjct  324  DEVERAFVHVDYQSRDYDEHKDPTVR  349

>PHALS_05194
Length=363

 Score = 393 bits (1010),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 211/330 (64%), Positives = 258/330 (78%), Gaps = 3/330 (1%)

Query  45   RSQIAHS-LIHKQNGEEIEIV--PAATSRHVGSVIRASLIANIILACGKLYAAINsgsla  101
            RSQ++H+ L+ K+   E++ +  P++ +  V   I ASL AN++L   K+YAA+ SGSLA
Sbjct  34   RSQVSHAFLLKKEEDAEVQHLSSPSSAALRVQVAINASLAANVVLTIVKIYAALTSGSLA  93

Query  102  vlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQ  161
            VLSSLVDSILDLTSQ LFW+SDKRMHTPS KYPAGRRRLEPI VIISATLMGMAA+EVIQ
Sbjct  94   VLSSLVDSILDLTSQALFWYSDKRMHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQ  153

Query  162  KAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRN  221
            ++V+ L+ G+ G L  I ++ FT+ VLL AI  K  LWY+C +I   SP+A A+AQDHRN
Sbjct  154  QSVKALVKGFNGHLREIDISSFTLIVLLVAIVVKLFLWYICAKIASHSPSADALAQDHRN  213

Query  222  DVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVF  281
            DV SN  AV  +  A  H +LW +DS+GAI+IS+YIA+SWLATG EQV+RLVGLQA+  F
Sbjct  214  DVYSNLVAVSAAFVAHKHPSLWCLDSIGAIVISVYIAVSWLATGKEQVERLVGLQAEQEF  273

Query  282  IDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEF  341
            ID +R   + HHP M+ DI+RAYHFG+NYLVE+EVILPE M V+EAHDISL LQ K+E  
Sbjct  274  IDHIRTLGDVHHPLMKTDIVRAYHFGNNYLVEMEVILPEDMCVKEAHDISLSLQIKVEGL  333

Query  342  DNVERAFVHVDYLARGYDEHKDPTLRRSTS  371
            DNVERAFVHVDYL R YDEHKDPTLRR +S
Sbjct  334  DNVERAFVHVDYLERNYDEHKDPTLRRDSS  363

>PHYRA_84731
Length=371

 Score = 393 bits (1010),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 214/330 (65%), Positives = 258/330 (78%), Gaps = 3/330 (1%)

Query  44   RRSQIAHSLIHKQNGE-EIEIV--PAATSRHVGSVIRASLIANIILACGKLYAAINsgsl  100
            RRSQ++H+ + K+  + E + +  P+A +  V   I  SL AN+ LA  K+YAA  SGSL
Sbjct  41   RRSQVSHAFLLKKEADVEAQHLASPSAFTLRVQVAINVSLAANVALALVKIYAAFTSGSL  100

Query  101  avlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVI  160
            AVLSSLVDSILDLTSQ LFW+SDKRMHTPS KYPAGRRRLEPI VIISATLMGMAA+EVI
Sbjct  101  AVLSSLVDSILDLTSQALFWYSDKRMHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVI  160

Query  161  QKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHR  220
            Q++VE L+ G+ G    + ++ FT+AVLL AI  K  LWY+C +I   SP+A A+AQDHR
Sbjct  161  QQSVEALVKGFNGHQRELNISTFTVAVLLVAIVIKLALWYVCAKIAAHSPSADALAQDHR  220

Query  221  NDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPV  280
            NDV SN+ AV  +  A  H+NLWY DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  
Sbjct  221  NDVFSNTVAVAAAFAAHWHSNLWYFDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQE  280

Query  281  FIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEE  340
            FID++R   + HHP M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDISL LQ K+EE
Sbjct  281  FIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEE  340

Query  341  FDNVERAFVHVDYLARGYDEHKDPTLRRST  370
             D VERAFVHVDYL R YDEHKDPTLRR +
Sbjct  341  LDQVERAFVHVDYLERNYDEHKDPTLRRDS  370

>PPTG_10185
Length=363

 Score = 391 bits (1004),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 215/343 (63%), Positives = 264/343 (77%), Gaps = 6/343 (2%)

Query  34   SPLLGEHREN---RRSQIAHSLIHKQNGEEIEIVPAATSRHVGSV---IRASLIANIILA  87
            +P LG  + +   RRSQ++H+ + K+  +  E   A+ S  +  V   I ASL AN+ LA
Sbjct  20   TPTLGSTKADDRYRRSQVSHAFLLKKEADVEEQRLASPSNAILRVQVAINASLAANVALA  79

Query  88   CGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVII  147
              K+YAA  SGSLAVLSSLVDSILDLTSQ LFW+SDKRMHTPS KYPAGRRRLEPI VII
Sbjct  80   IVKIYAAFTSGSLAVLSSLVDSILDLTSQALFWYSDKRMHTPSVKYPAGRRRLEPIAVII  139

Query  148  SATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGL  207
            SATLMGMAA+EVIQ++VE L+ G++G    +  + FT+ VLL AI  K +LW++C +I  
Sbjct  140  SATLMGMAAIEVIQQSVEALVKGFKGHQRELDFSSFTMIVLLVAIVIKLLLWHICTKIAS  199

Query  208  TSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSE  267
             SP+A A+AQDHRNDV SNS AV  +  A  H+NLWY+DS+GAI+IS+YIA+SWLATG E
Sbjct  200  HSPSADALAQDHRNDVFSNSVAVAAAFAAHWHSNLWYLDSIGAIVISVYIAVSWLATGKE  259

Query  268  QVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREA  327
            QV+RLVGLQAD  FID++R   + HHP M+ DI+RAYHFG+NYLVE+EVILPE M V++A
Sbjct  260  QVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDA  319

Query  328  HDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPTLRRST  370
            HDISL LQ K+E  DNVERAFVHVDYL R YDEHKDPT+RR +
Sbjct  320  HDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPTIRRDS  362

>PYVX_14608
Length=385

 Score = 390 bits (1003),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 213/343 (62%), Positives = 255/343 (74%), Gaps = 17/343 (5%)

Query  46   SQIAHSLI-HKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgslavls  104
            S +AH+   H  + E     P + SR V   I ASL  NI+LA  K YAA++SGSLAVLS
Sbjct  43   SPLAHAFFPHTNDLETRADAPPSMSRKVQLAINASLGVNILLAIAKTYAALSSGSLAVLS  102

Query  105  slvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGM----------  154
            SLVDS+LDL SQ LFW+SDKRMHT   KYPAGRRRLEPI VIISATLMGM          
Sbjct  103  SLVDSVLDLASQALFWYSDKRMHTRDVKYPAGRRRLEPIAVIISATLMGMTGECVPSLSL  162

Query  155  ------AALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLT  208
                  AA+EVIQK+VETL++G++GTLP++ ++  T+AVLL AI TK +LWY+C  I   
Sbjct  163  LTQWVLAAIEVIQKSVETLVMGWKGTLPDMNISIITLAVLLAAIITKLVLWYICRLISTQ  222

Query  209  SPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQ  268
            SP+A A+AQDHRNDV SNS A+I +  A  H NLWY+DS GAI+IS+YIA+SWL TG EQ
Sbjct  223  SPSADALAQDHRNDVYSNSIAIIAACLANWHKNLWYLDSAGAIVISVYIAVSWLETGKEQ  282

Query  269  VQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAH  328
            V+RLVGLQA   FID++R   + HH  M+ADI+RAYHFG+NYLVE+EVILPE M VREAH
Sbjct  283  VERLVGLQASQEFIDEIRKLADTHHSLMKADIVRAYHFGNNYLVEIEVILPESMRVREAH  342

Query  329  DISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPTLRRSTS  371
            DISL LQ+ +EE D VERAFVHVDYL R YDEHKD T+RR +S
Sbjct  343  DISLSLQKAVEELDTVERAFVHVDYLPRDYDEHKDTTIRRDSS  385

>PHYCA_123086
Length=271

 Score = 368 bits (945),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 174/256 (68%), Positives = 209/256 (82%), Gaps = 0/256 (0%)

Query  116  QGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTL  175
            Q LFW+SDKRMHTPS +YPAGRRRLEPI VIISATLMGMAA+EVIQ++VE L+ G+ G  
Sbjct  15   QALFWYSDKRMHTPSVQYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGFNGHQ  74

Query  176  PNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLT  235
              ++++ FT+ VLL AI  K ILWY C +I   SP+A A+AQDHRNDV SN+ AV  +  
Sbjct  75   RELEISAFTMLVLLVAIVIKLILWYFCAKIASHSPSADALAQDHRNDVFSNTVAVAAAFA  134

Query  236  AKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPK  295
            A  H++LWY+DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FID++R   + HHP 
Sbjct  135  AHWHSSLWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPM  194

Query  296  MQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLA  355
            M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDISL LQ K+EE DNVERAFVHVDYL 
Sbjct  195  MRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLE  254

Query  356  RGYDEHKDPTLRRSTS  371
            R YDEHKDPTLRR+ S
Sbjct  255  RNYDEHKDPTLRRNDS  270

>PHYKE_10819
Length=344

 Score = 345 bits (886),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 197/330 (60%), Positives = 237/330 (72%), Gaps = 29/330 (9%)

Query  44   RRSQIAHSLIHKQNG---EEIEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgsl  100
            RRSQ++H+ + K+     E+    P +++  V   I  SLIAN++LA  K YAA  SGSL
Sbjct  40   RRSQVSHAFLLKKEADIEEQHMTSPTSSTLRVQVAINVSLIANVVLAIVKTYAACMSGSL  99

Query  101  avlsslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVI  160
            AVLSSLVDSILDLTSQ LFW+SDKRMHTPS KYPAGRRRLEP+ VIISATLMGMAA+EVI
Sbjct  100  AVLSSLVDSILDLTSQLLFWYSDKRMHTPSVKYPAGRRRLEPVAVIISATLMGMAAIEVI  159

Query  161  QKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHR  220
            Q+AVE+L+ G  G    + ++ FT+AVLL AI  K                         
Sbjct  160  QQAVESLVKGLNGHQRQLDISTFTMAVLLVAIVVKL------------------------  195

Query  221  NDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPV  280
              VL N+ AV  +  A  H+NLWY+DSVGAI+IS+YIA+SWLATG EQV+RLVGLQA   
Sbjct  196  --VLCNTVAVGAAFAAHWHSNLWYLDSVGAIVISVYIAVSWLATGKEQVERLVGLQASQE  253

Query  281  FIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEE  340
            FID++R   + HHP M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDISL LQ K+E 
Sbjct  254  FIDEIRLLGDIHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEA  313

Query  341  FDNVERAFVHVDYLARGYDEHKDPTLRRST  370
             DNVERAFVHVDYL R YDEHKDPTLRR +
Sbjct  314  LDNVERAFVHVDYLERNYDEHKDPTLRRDS  343

>PHYSO_471886
Length=246

 Score = 334 bits (857),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 199/245 (81%), Gaps = 0/245 (0%)

Query  126  MHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTI  185
            MHTPS KYPAGRRRLEPI VIISATLMGMAA+EVIQ++VE LI G+ G    ++++ FT+
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALIKGFNGHQRVLEISNFTM  60

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
             VLL A+  K  LWY+C +I   SP+A A+AQDHRNDV SN+ AV  +  A  H++LWY+
Sbjct  61   VVLLVAMVVKLALWYVCAKIASHSPSADALAQDHRNDVFSNTVAVAAAFAAHWHSSLWYL  120

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FID++R   + HHP M+ DI+RAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRLLGDVHHPMMRTDIVRAYH  180

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPT  365
            FG+NYLVE+EVILPE M V++AHDISL LQ K+EE DNVERAFVHVDYL R YDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEELDNVERAFVHVDYLERNYDEHKDPT  240

Query  366  LRRST  370
            +RR +
Sbjct  241  IRRDS  245

>PITG_20630
Length=246

 Score = 333 bits (855),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 198/245 (81%), Gaps = 0/245 (0%)

Query  126  MHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTI  185
            MHTPS KYPAGRRRLEPI VIISATLMGMAA+EVIQ++VE L+ G +G    +++  FT+
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVEGLKGHQRELEITSFTV  60

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
             VLL AI  K +LWY+C +I   SP+A A+AQDHRNDV SNS AV  +  A  H++LWY+
Sbjct  61   IVLLVAIVVKLLLWYICAKIASHSPSADALAQDHRNDVFSNSVAVAAAFAAHWHSSLWYL  120

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FID++R   + HHP M+ DI+RAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRVLGDVHHPMMRTDIVRAYH  180

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPT  365
            FG+NYLVE+EVILPE M V++AHDISL LQ K+E  DNVERAFVHVDYL R YDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  240

Query  366  LRRST  370
            +RR +
Sbjct  241  VRRDS  245

>PITG_20313
Length=246

 Score = 332 bits (851),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 197/245 (80%), Gaps = 0/245 (0%)

Query  126  MHTPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTI  185
            MHTPS KYPAGRRRLEPI VIISATLMGMAA+EVIQ++VE L+ G +G    +++  FT+
Sbjct  1    MHTPSVKYPAGRRRLEPIAVIISATLMGMAAIEVIQQSVEALVKGLKGHQRELEITSFTV  60

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
             VLL AI  K +LWY+C +I   SP+A A+AQDHRNDV SN  AV  +  A  H++LWY+
Sbjct  61   IVLLVAIVVKLLLWYICAKIASHSPSADALAQDHRNDVFSNFVAVAAAFAAHWHSSLWYL  120

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            DSVGAI+IS+YIA+SWLATG EQV+RLVGLQAD  FID++R   + HHP M+ DI+RAYH
Sbjct  121  DSVGAIVISVYIAVSWLATGKEQVERLVGLQADQEFIDQIRVLGDVHHPMMRTDIVRAYH  180

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKDPT  365
            FG+NYLVE+EVILPE M V++AHDISL LQ K+E  DNVERAFVHVDYL R YDEHKDPT
Sbjct  181  FGNNYLVEMEVILPEDMCVKDAHDISLSLQDKVEALDNVERAFVHVDYLERNYDEHKDPT  240

Query  366  LRRST  370
            +RR +
Sbjct  241  VRRDS  245

>HYAP_13828
Length=373

 Score = 310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 232/335 (69%), Gaps = 11/335 (3%)

Query  45   RSQIAHS-LIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKLYAAINsgslavl  103
            RSQ++H+ L+ K+  + +      ++  V + I ASL AN+ LA  K+YAA  S SLAVL
Sbjct  42   RSQVSHAFLLKKEETQHLAASSLGSTLPVLAAINASLSANVTLALVKIYAAWTSNSLAVL  101

Query  104  sslvdsildltsQGLFWFSDKRMHTPSSKYPAGRRRLEPIVVIISATLMGMAAL---EVI  160
            SSLVDSILDLTSQ LFW+SDK MHTPS +YPAGRRRLEPI VI+SATLMGMA        
Sbjct  102  SSLVDSILDLTSQALFWYSDKHMHTPSVEYPAGRRRLEPIAVIVSATLMGMAGSCRGAQW  161

Query  161  QKAVETLIIGYEGTLPNIKMNQFTIAVLLFAISTKTILWYLCFR----IGLTSPTARAIA  216
            Q A    +  ++G       +Q   A  +  +    +L     R    I +T+       
Sbjct  162  QAARGRHLDFHDGRAARCDSSQ---ARAMVRVPRCYLLPDARLRSRHQISVTNDFGLHCL  218

Query  217  QDHRNDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQ  276
            QDHRNDV SN+ A++ +     H++ WY+DS+GA++IS+YIA+SWLATG EQV+RLVGLQ
Sbjct  219  QDHRNDVFSNTIAIVAAFATHCHSSFWYLDSIGAVVISVYIAVSWLATGKEQVERLVGLQ  278

Query  277  ADPVFIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQR  336
            A   FID++R   + HHP M+ DI+RAYHFG+NYLVE+EVILPE M V++AHDISL+LQ 
Sbjct  279  ATQEFIDQIRLLGDVHHPMMRTDIVRAYHFGNNYLVEMEVILPEDMCVKDAHDISLNLQH  338

Query  337  KIEEFDNVERAFVHVDYLARGYDEHKDPTLRRSTS  371
            K+EE DNVERAFVHVDYL R YDEHKDPT+RR ++
Sbjct  339  KVEELDNVERAFVHVDYLERNYDEHKDPTIRRDSA  373

>PYIR_23853
Length=420

 Score = 224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 188/299 (63%), Gaps = 11/299 (4%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV +V++ SL  NI++       AI S SLA+LS+LV++++DL  QGL W++  R     
Sbjct  63   HVATVLKTSLTTNIVIVXXXXSVAIASHSLALLSALVENMVDLLVQGLLWYAGTRSGKKQ  122

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNI-KMNQFTIAV  187
              +KYPAG  R EP+ +I+++++M + ++  IQ+ V  L+ G     P   K++   + +
Sbjct  123  DYAKYPAGTSRFEPVAIIVASSIMVLVSVVFIQEGVTKLVDGLAHGQPEAPKLSATAVII  182

Query  188  LLFAISTKTIL-----WYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNL  242
            +  A+  K  L     W L F     S +  AI  D+RND +SN+ A+I  + + +  +L
Sbjct  183  VCLAVLVKIGLIFYSRWVLTFTY---SASVEAIQDDNRNDTISNAFAIIAYIISSVDEDL  239

Query  243  WYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIR  302
            WY+D  GAILI L+I  +W   G EQV +LVG+ A   F+ +++   ++HHP M  DIIR
Sbjct  240  WYVDPAGAILIFLFIMFAWGKMGKEQVAQLVGVCASKEFMAEVKELCSHHHPSMALDIIR  299

Query  303  AYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            AYHFGS YLVE+EV++P  M+V+ AHDI+L LQ K+E  ++VERAFVHVDY AR YDEH
Sbjct  300  AYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKARDYDEH  358

>PYU1_G008337
Length=414

 Score = 224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 187/299 (63%), Gaps = 11/299 (4%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V+++SLI NI +       AI S SLA+LS+LV++++DL  QGL W++  R     
Sbjct  64   HVAMVLKSSLITNICIVLVMTSVAIASHSLALLSALVENMVDLFVQGLLWYAGTRSGKKQ  123

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNI-KMNQFTIAV  187
              +KYPAG  R EP+ +I++A++M + ++  IQ+ V  L+ G+    P   K++   + +
Sbjct  124  DYAKYPAGTSRFEPVAIIVAASIMVLVSVVFIQEGVTKLVDGFAHGQPEAPKLSAAAVVI  183

Query  188  LLFAISTKTIL-----WYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNL  242
            +  A+  K  L     W L F     S +  AI  D+RND +SN+ A+I  + + +   L
Sbjct  184  VTLAVLVKIGLIFYSRWVLKFTF---SASVEAIQDDNRNDTISNAFAIIAYIISSVDEGL  240

Query  243  WYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIR  302
            WY+D  GAILI L+I  +W   G EQV +LVG+ A   F+ +++    +HHP M  DI+R
Sbjct  241  WYVDPAGAILIFLFIMFAWGKMGKEQVAQLVGVCASEEFMTEVKELCASHHPSMSLDIMR  300

Query  303  AYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            AYHFGS YLVE+EV++P  M+V+ AHDI+L LQ K+E  ++VERAFVHVDY +R YDEH
Sbjct  301  AYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKSRDYDEH  359

>SPRG_06805
Length=341

 Score = 220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 165/251 (66%), Gaps = 5/251 (2%)

Query  116  QGLFWFSDKRM-HTPS-SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEG  173
            QGL W+++ +  + P  +K+PAG  R EPI+V++SAT+M + ++ VI ++   L  G+  
Sbjct  50   QGLLWYANYQASNAPDMAKFPAGTSRFEPILVVLSATIMSVISVIVIYESSMRLHDGFAS  109

Query  174  TLPNIK-MNQFTIAVLLFAISTKT-ILWYLCFRIGLT-SPTARAIAQDHRNDVLSNSAAV  230
              P++  M+   IA+   AI+ K  ++ Y  F + LT S + +AI QD+ ND +SN+ A+
Sbjct  110  GEPDVAVMSTAAIAICSCAIAIKVGLVIYAGFALRLTQSSSVKAIQQDNINDTVSNAFAI  169

Query  231  ITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTN  290
            +  + A    +LWYID  GAILI L I + W+ T  EQV +LVG+ A P FID ++    
Sbjct  170  VVYVIAASDPSLWYIDPAGAILIFLAILVIWVRTAKEQVLQLVGVSASPDFIDVVKELCE  229

Query  291  NHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVH  350
            NHH     DIIRAYHFG+ YLVE+EV+ P  M+V++AHDISL LQ KIE+ ++VERAFVH
Sbjct  230  NHHASFALDIIRAYHFGNKYLVELEVVAPATMTVKQAHDISLQLQFKIEQLEDVERAFVH  289

Query  351  VDYLARGYDEH  361
            VDY  R YDEH
Sbjct  290  VDYQTRAYDEH  300

>PYU1_G008336
Length=406

 Score = 221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 193/305 (63%), Gaps = 23/305 (8%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V+++SLI NI +       AI S SLA+LS+LV++++DL  QGL W++  R     
Sbjct  48   HVAMVLKSSLITNICIVLVMTSVAIGSRSLALLSTLVENMVDLFVQGLLWYAGTRSGKKQ  107

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY-EGTLPNIKMNQFTIAV  187
              +KYPAG  R EP+ +I+++++M + ++  IQ+ V  L+ G+  G   + K++  TIA+
Sbjct  108  DYAKYPAGTSRFEPVAIIVASSIMVLVSVTFIQEGVTKLVDGFAHGNPESPKLS--TIAI  165

Query  188  LLFAISTKTILWYLCFRIGLT-----------SPTARAIAQDHRNDVLSNSAAVITSLTA  236
            +L    + TI+     +IGL            S  A AI  D+RNDV+SNS A+   + +
Sbjct  166  VL----SSTIV---VIKIGLVAYSYWTIKRTYSAAAHAIGDDNRNDVVSNSFAICAYIIS  218

Query  237  KLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKM  296
                +LWY+D++GAI+I L I  +W   G EQV +LVG+ A   F+ +++    +HHP M
Sbjct  219  SSDEDLWYVDALGAIVIFLLIMFAWAKMGKEQVAQLVGVSASEEFMTEVKELCASHHPTM  278

Query  297  QADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLAR  356
              DI+RAYHFGS YLVE+EV++P  M+V+ AHDI+L LQ K+E  ++VERAFVHVDY +R
Sbjct  279  SLDIMRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKSR  338

Query  357  GYDEH  361
             YDEH
Sbjct  339  DYDEH  343

>SDRG_12928
Length=341

 Score = 216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/251 (46%), Positives = 163/251 (65%), Gaps = 5/251 (2%)

Query  116  QGLFWFSDKRM-HTPS-SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEG  173
            QGL W+++ +  + P  +K+PAG  R EPI+V++SAT+M + ++ VI ++   L  G+  
Sbjct  50   QGLLWYANYQASNAPDMAKFPAGTSRFEPILVVLSATIMSVISVIVIYESSMRLHDGFAS  109

Query  174  TLPN-IKMNQFTIAVLLFAISTKT-ILWYLCFRIGLT-SPTARAIAQDHRNDVLSNSAAV  230
              P+   M+   I +   A++ K  ++ Y  F + +T S + +AI QD+ ND +SN+ A+
Sbjct  110  GEPDGAVMSTTAIVICSCAVAIKIGLVIYAGFALRITQSSSVKAIQQDNINDTVSNAFAI  169

Query  231  ITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTN  290
            I    A    +LWYID  GAILI L I + W+ T  EQV +LVG+ A P FID ++   +
Sbjct  170  IVYAIAASDPSLWYIDPAGAILIFLAILVIWVRTAKEQVLQLVGVSASPDFIDVVKELCD  229

Query  291  NHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVH  350
            NHH     DIIRAYHFG+ YLVE+EV+ P  M+V++AHDISL LQ KIE+ D+VERAFVH
Sbjct  230  NHHASFALDIIRAYHFGNKYLVELEVVAPATMTVKQAHDISLQLQFKIEQLDDVERAFVH  289

Query  351  VDYLARGYDEH  361
            VDY  R YDEH
Sbjct  290  VDYQTRAYDEH  300

>PHYSO_552775
Length=395

 Score = 215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/296 (44%), Positives = 185/296 (63%), Gaps = 5/296 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ASL  NI++       AI S SLA++S+LV++++DL  QGL W++  R     
Sbjct  39   HVAVVLKASLCTNILIVIVMTSVAIASNSLALISALVENMVDLFVQGLLWYAGTRSGKKQ  98

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +KYPAG  R EP+ +I++A++M +A++  IQ+AV+ L+ G+   E   P++      I
Sbjct  99   DYAKYPAGTSRFEPVAIIVAASVMVLASIVFIQEAVKKLVDGFSSDEPEAPHLSAAAIAI  158

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
            AV    +    + +         S    AI QD+ ND LSNS AV   + A +    WY+
Sbjct  159  AVTAVVVKIGLMFYSAWILKSTVSVAVEAIHQDNLNDTLSNSFAVAAYIIAAVEPKAWYV  218

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            D  GAILI +YI ++W     EQV +LVG+ A   FI+++++  N HHP M  DI+RAYH
Sbjct  219  DPAGAILIFVYIMVAWGKMAWEQVTQLVGVCASEEFIEEVKDLCNRHHPSMSLDIVRAYH  278

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            FGS YLVE+EV++P +MSV+ AHDI+L +Q K+E  + VERAFVHVDY AR YDEH
Sbjct  279  FGSKYLVELEVVVPGEMSVKLAHDIALQMQFKVENLEEVERAFVHVDYQARDYDEH  334

>PHYCA_543819
Length=446

 Score = 215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 130/296 (44%), Positives = 185/296 (63%), Gaps = 5/296 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ASL  NII+       AI S SLA++S+LV++++DL  QGL W++  R     
Sbjct  90   HVAVVLKASLTTNIIIVIVMTSVAIASNSLALISALVENMVDLFVQGLLWYAGTRSGKKQ  149

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +KYPAG  R EP+ +I++A++M +A++  I +AV+ LI G+   E   PN+      I
Sbjct  150  DYAKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAVQKLIDGFSSDEPEAPNLSAAAIAI  209

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
            AV    +    + +         S    AI QD+ ND+LSNS AV   + A +    WY+
Sbjct  210  AVTAVVVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYV  269

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            D  GAI+I +YI +SW     EQV +LVG+ A   FI ++++  N HHP M+ DI+RAYH
Sbjct  270  DPAGAIIIFVYIMVSWGKMAWEQVTQLVGVCASEEFIGEVKDLCNRHHPSMKLDIVRAYH  329

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            FGS YLVE+EV++P +MSV+ AHDI+L +Q K+E  + VERAFVHVDY +R YDEH
Sbjct  330  FGSKYLVELEVVVPGEMSVKLAHDIALQMQFKVENLEEVERAFVHVDYQSRDYDEH  385

>PHYCA_533347
Length=417

 Score = 213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 184/296 (62%), Gaps = 5/296 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ASL  NII+       AI S SLA+LS+LV++++DL  QGL W++  R     
Sbjct  49   HVAVVLKASLFTNIIIVICMTSIAIASHSLALLSALVENMVDLFVQGLLWYAGTRSGKKQ  108

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +KYPAG  R EP+ +I++A++M +A++  IQ++   LI G+   E   P++      I
Sbjct  109  DYAKYPAGTSRFEPVAIIVAASVMVLASIVFIQESARKLIDGFTSGEPEAPSLSTAAIVI  168

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
             V    +    +++         S    AI QD+ ND +SNS A+   + A + +  WY+
Sbjct  169  VVTAVIVKIGLMIYSAWILKSTFSAAVEAIHQDNLNDTISNSFAIAAYIVAAVESEAWYV  228

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            D  GAILI +YI +SW     EQV +LVG+ A   F+ +++  + +HHP M  DI+RAYH
Sbjct  229  DPAGAILIFIYIMVSWGKMAWEQVTQLVGVCASEDFVLQVKELSRHHHPSMTLDIVRAYH  288

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            FGS YLVE+EV++P +MSV++AHDI+L LQ K+E  D VERAFVHVDY +R YDEH
Sbjct  289  FGSKYLVELEVVVPAEMSVKDAHDIALQLQFKVENLDEVERAFVHVDYQSRDYDEH  344

>PHYRA_83397
Length=384

 Score = 211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 186/296 (63%), Gaps = 5/296 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ASL  NII+       AI+S SLA++S+LV++++DL  QGL W++  R     
Sbjct  28   HVAVVLKASLSTNIIIVIIMTSVAISSNSLALISALVENMVDLFVQGLLWYAGTRSGKKQ  87

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +KYPAG  R EP+ +I++A++M +A++  I +AV  L  G+   E   PN+      I
Sbjct  88   DYAKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAVVKLADGFSSDEPEAPNLSAAAIAI  147

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
            AV    +    + +         S    AI QD+ ND+LSNS AV   + A + +  WY+
Sbjct  148  AVTAVVVKIGLMFYSAWILKTTVSAAVEAIHQDNFNDMLSNSFAVAAYIVAAVESEAWYV  207

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            D  GAI+I +YI ++W     EQ+ +LVG+ A+  FI++++     HHP M+ DI+RAYH
Sbjct  208  DPAGAIIIFVYIMVAWGKMAWEQITQLVGVCANEDFIEEVKELCRQHHPSMELDIVRAYH  267

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            FGS YLVE+EV++P +MSV+ AHDI+L +Q K+E+ + VERAFVHVDY AR YDEH
Sbjct  268  FGSKYLVELEVVVPGEMSVKLAHDIALQMQFKVEKLEEVERAFVHVDYQARDYDEH  323

>PPTG_17622
Length=395

 Score = 210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 184/296 (62%), Gaps = 5/296 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ASL  NI++       AI S SLA++S+LV++++DL  QGL W++  R     
Sbjct  39   HVAVVLKASLTTNIVIVIVMTSVAIASNSLALISALVENMVDLFVQGLLWYAGTRSGKKQ  98

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +KYPAG  R EP+ +I++A++M +A++  I +A + L+ G+   E   PN+      I
Sbjct  99   DYAKYPAGTSRFEPVAIIVAASVMVLASIVFIHEAAQKLVDGFSSDEPEAPNLSAAAIAI  158

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
            AV    +    + +         S    AI QD+ ND+LSNS AV   + A +    WY+
Sbjct  159  AVTAVVVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYV  218

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            D  GAI+I +YI ++W     EQ+ +LVG+ A   FI++++   + HHP M+ DI+RAYH
Sbjct  219  DPAGAIIIFVYIMVAWGKMAWEQITQLVGVCASEEFIEEVKELCSRHHPSMELDIVRAYH  278

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            FGS YLVE+EV++P +MSV+ AHDI+L +Q K+E  + VERAFVHVDY AR YDEH
Sbjct  279  FGSKYLVELEVVVPGEMSVKLAHDIALQVQFKVENLEEVERAFVHVDYQARDYDEH  334

>PHYRA_96593
Length=613

 Score = 215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 186/296 (63%), Gaps = 5/296 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ASL  NII+       AI S SLA++S+LV++++DL  QGL W++  R     
Sbjct  280  HVAVVLKASLSTNIIIVISMTSIAIASHSLALISALVENMVDLFVQGLLWYAGTRSGKKQ  339

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPN--IKMNQFTIA  186
              +KYPAG  R EP+ +I++A++M +A++  IQ++   LI G+    P   I      + 
Sbjct  340  DYAKYPAGTSRFEPVAIIVAASVMVLASIVFIQESARKLIDGFTSGEPEAPILSTAAIVI  399

Query  187  VLLFAISTKTILWYLCFRIGLT-SPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
            V++  +    ++ Y  + +  T S    AI QD+ ND +SNS AV   + + + +  WY+
Sbjct  400  VVMAVVVKIGLMLYSAWILKSTFSAAVEAIHQDNLNDTISNSFAVAAYIVSAVESEAWYV  459

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            D  GAILI LYI +SW     EQV +LVG+ A   F+ +++   ++HHP M  DI+RAYH
Sbjct  460  DPAGAILIFLYIMVSWGKMAWEQVTQLVGVCASEDFVQEVKELCSHHHPSMVLDIVRAYH  519

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            FGS YLVE+EV++P +MSV+ AHDI+L LQ K+E  + VERAFVHVDY +R YDEH
Sbjct  520  FGSKYLVELEVVVPAEMSVKAAHDIALQLQFKVENLEEVERAFVHVDYQSRDYDEH  575

>PYVX_16542
Length=388

 Score = 207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 181/296 (61%), Gaps = 5/296 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ASL  NI++       AI S SLA+LS+LV++++DL  QGL W++  R     
Sbjct  20   HVALVLKASLGTNIVIVLTMATVAIASHSLALLSALVENMVDLFVQGLLWYAGTRSGKKQ  79

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +KYPAG  R EP+ +I++A++M +AA+  IQ++V  +  G    +   P++ +    I
Sbjct  80   DYAKYPAGTSRFEPVAIIVAASIMVLAAVYFIQESVTKIFNGLVHDDFEAPDLSVAAIVI  139

Query  186  AVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
             VL        + +         S    AI QD+ ND +SNS A+   + A +  + WY+
Sbjct  140  VVLAVVTKIGLVFYSGWILKSTFSAAVEAIHQDNINDTMSNSIAIAAYIVAAVKPSAWYV  199

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            D  GA+LI +YI  SW     EQVQ+LVG+ AD  FI ++++    HHP M  DI+RAYH
Sbjct  200  DPAGAMLIFVYIMYSWGKMAKEQVQQLVGVSADEEFIQEVKDLCARHHPLMALDIVRAYH  259

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            FG+ YLVE+EV++P  MSV+ AHDI+L LQ K+E  D VERAFVHVDY +R YDEH
Sbjct  260  FGNKYLVELEVVVPGDMSVKMAHDIALQLQFKVENLDQVERAFVHVDYQSRDYDEH  315

>PYVX_16559
Length=376

 Score = 198 bits (503),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 126/295 (43%), Positives = 183/295 (62%), Gaps = 7/295 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ SL  N+ +       A  +GSLA+LS+LV++++DL  QGL W++  R     
Sbjct  18   HVALVLKTSLGLNVTIVLTMAAVAFAAGSLALLSALVENMIDLFVQGLLWYAGTRSGKKQ  77

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKA-VETLIIGYEGTLPNIKMNQFTIAV  187
              +KYPAG  R EP+ +I++A++M + A+  IQ++        +E   P++      I V
Sbjct  78   DYAKYPAGTSRFEPVAIIVAASIMVLVAVFFIQESGXXXXXDDFEA--PDLSAAAIVI-V  134

Query  188  LLFAISTKTILWYLCFRIGLT-SPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYID  246
             L  +S   +++Y  + +  T S    AI QD+ ND +SNS AVI  + A +  + WY+D
Sbjct  135  SLAVVSKIGLIFYSGWILKSTYSAAVEAIHQDNINDTMSNSIAVIAYIIAAVKPSAWYVD  194

Query  247  SVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYHF  306
              GA+LI +YI  SW     EQVQ+LVG+ AD  FI ++++    HHP M  DI+RAYHF
Sbjct  195  PAGAMLIFVYIMYSWGKMAKEQVQQLVGVSADEEFIQEVKDLCARHHPLMALDIVRAYHF  254

Query  307  GSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            G+ YLVE+EV++P  MSV+ AHDI+L LQ K+E  + VERAFVHVDY +R YDEH
Sbjct  255  GNKYLVELEVVVPGDMSVKMAHDIALQLQFKVENLEPVERAFVHVDYRSRDYDEH  309

>PITG_19056
Length=390

 Score = 197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 181/296 (61%), Gaps = 6/296 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ASL  NII+       AI S SLA++S+LV++++DL  QGL W++  R     
Sbjct  36   HVAVVLKASLTTNIIIVIVMTSVAITSNSLALISALVENMVDLFVQGLLWYAGTRSGKKQ  95

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVL  188
              +KYPAG    +   +I++A++M +A++  IQ+AV  L+ G+    P   +       +
Sbjct  96   DYAKYPAGTSPCQR-AIIVAASVMVLASIVFIQEAVTKLVDGFSSDEPEAPVLSAAAIAI  154

Query  189  LFAISTKTI--LWYLCFRIGLTSPTA-RAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYI  245
                    I  ++Y  + +  T   A  AI QD+ ND+LSNS AV   + A +    WY+
Sbjct  155  AATAVIVKIGLMFYSAWILKSTVSVAVEAIHQDNFNDMLSNSFAVAAYIVAAVEPKAWYV  214

Query  246  DSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYH  305
            D  GAI+I +YI ++W     EQ+ +LVG+ A   FI +++   + HHP M+ DI+RAYH
Sbjct  215  DPAGAIIIFVYIMVAWGKMAWEQITQLVGVCASEEFIKEVKELCSRHHPSMELDIVRAYH  274

Query  306  FGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            FGS YLVE+EV++P +MSV+ AHDI+L +Q K+E  + VERAFVHVDY AR YDEH
Sbjct  275  FGSKYLVELEVVVPGEMSVKLAHDIALQVQFKVENLEEVERAFVHVDYQARDYDEH  330

>PYIR_21123
Length=388

 Score = 191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 176/302 (58%), Gaps = 34/302 (11%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V+++SL  N+ +       AI S SLA+LS+LV++++DL  Q + W++  R     
Sbjct  47   HVAMVLKSSLFTNVCIVLVMTTIAIASKSLALLSTLVENMVDLFVQSMLWYAGTRGGGKK  106

Query  131  SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVLLF  190
              Y               A +M + A+  IQ+ V  L+ G+    P  +  + + A ++ 
Sbjct  107  QDY---------------ANIMVLVAITFIQEGVTKLVDGFAHGNP--EAPKLSTAAVVL  149

Query  191  AISTKTILWYLCFRIGLT-----------SPTARAIAQDHRNDVLSNSAAVITSLTAKLH  239
            + S   I      +IGL+           S  A AI  D+RNDV SNS A+   + +  +
Sbjct  150  SSSIVVI------KIGLSAYSYWTIKRTYSAAAHAIGDDNRNDVFSNSFAIAAYIISSAN  203

Query  240  TNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQAD  299
             +LWY+D+ GAI++ L+I ++W   G +QV +LVG+ A+  F+ +++   ++HHP M  D
Sbjct  204  EDLWYVDACGAIVVFLFIMVAWAKMGKDQVAQLVGVSANEEFMTEVKELCSHHHPSMALD  263

Query  300  IIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYD  359
            IIRAYHFGS YLVE+EV++P  M+V+ AHDI+L LQ K+E  ++VERAFVHVDY AR YD
Sbjct  264  IIRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENLEDVERAFVHVDYKARDYD  323

Query  360  EH  361
            EH
Sbjct  324  EH  325

>PYAR_21138
Length=455

 Score = 177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 190/335 (57%), Gaps = 49/335 (15%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV + ++ SL  NI++       AI S SLA+LS+LV++++DL  QGL  ++  R     
Sbjct  48   HVAAALKLSLGTNIMIVLTMTAVAIGSKSLALLSTLVENMIDLFVQGLLAYAGTRSGKKQ  107

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +K+PAG  R EP+ VI+++++M + ++  IQ+  + L  G+       P++ +    I
Sbjct  108  DYAKFPAGTSRFEPVAVIVASSVMVVVSIVFIQEGSKKLYDGFAHGNPAKPDLTVEALII  167

Query  186  AVLLFAISTKTIL-----WYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHT  240
            + L  +I+TK  L     W L      +S    AI  D+RNDVLSNS A+I  + A  + 
Sbjct  168  SGL--SITTKIFLMLYSRWVLKSH---SSVAVEAIQDDNRNDVLSNSFAIIAYIIASANE  222

Query  241  NLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLR--------------  286
             LWY+D  GAI + L+I ++W   G EQV +LVG+ A   FID+++              
Sbjct  223  KLWYVDPAGAIAVFLFIMVAWARMGKEQVMQLVGVTASAEFIDEVKELCRSHNAKLSLDI  282

Query  287  --------------------NFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVRE  326
                                   N+H+ K+  DI+RAYHFGS YLVEVEV++P  M+V++
Sbjct  283  EQVMQLVGVTASEEFIGEVKQLCNSHNNKLSLDIVRAYHFGSKYLVEVEVVVPGDMTVQD  342

Query  327  AHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
            AHDI+L LQ K+E+ ++VERAFVHVDY AR YDEH
Sbjct  343  AHDIALQLQFKVEQLEDVERAFVHVDYKAREYDEH  377

>PYAR_21139
Length=357

 Score = 168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 165/293 (56%), Gaps = 36/293 (12%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            H  +V++ S+  NI++       A+ S SLA+LS+LV++++DL  QGL  ++  R     
Sbjct  42   HTAAVLKLSVATNILIVLTMTAVAVASKSLALLSTLVENMVDLVVQGLLAYAGTRAGAKQ  101

Query  131  S--KYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAVL  188
               ++PAG  RLEP+ V+++++ M + ++  IQ+  + L  G+    P            
Sbjct  102  DYVRFPAGTSRLEPVAVVVASSTMMVLSVVFIQEGAKKLYDGFVHGDP------------  149

Query  189  LFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNLWYIDSV  248
                  K  L            T  AI QD    VL      +   +  +  NLWY+D  
Sbjct  150  -----VKPHL------------TVEAIHQDLLGTVLP-----LDPQSPYISRNLWYVDPA  187

Query  249  GAILISLYIAISWLATGSEQVQRLVGLQADPVFIDKLRNFTNNHHPKMQADIIRAYHFGS  308
            GAI+I L I ++W   G EQV +LVG+ A+  FID+++     H   +  DI+RAYHFG+
Sbjct  188  GAIVIFLLIMVAWGRMGKEQVMQLVGVAANDEFIDQVKQLCRGHDANLSLDILRAYHFGT  247

Query  309  NYLVEVEVILPEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEH  361
             YLVE+EVI+P  M+V++AHDI+L LQ K+E+ ++VERAFVHVDY AR YDEH
Sbjct  248  KYLVELEVIVPGDMAVQDAHDIALRLQFKVEKLEDVERAFVHVDYQAREYDEH  300

>PYIW_28078
Length=108

 Score = 109 bits (272),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)

Query  282  IDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPEKMSVREAHDISLDLQRKIEEF  341
            + +++   + HHP M  DI RAYHFGS YLVE+EV++P  M+V+ AHDI+L LQ K+E  
Sbjct  1    MTEVKELASGHHPSMSLDITRAYHFGSKYLVELEVVVPADMTVKMAHDIALQLQFKVENL  60

Query  342  DNVERAFVHVDYLARGYDEH  361
            D+VERAFVHVDY AR YDEH
Sbjct  61   DDVERAFVHVDYKARDYDEH  80

>PYIW_27182
Length=276

 Score = 108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 128/222 (58%), Gaps = 11/222 (5%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ SL  NI++       AI S SLA+LS+LV++++DL  QGL W++  R     
Sbjct  58   HVAGVLQTSLTTNIVIVLVMTSVAIASHSLALLSALVENMVDLFVQGLLWYAGTRSGKKQ  117

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNI-KMNQFTIAV  187
              +KYPAG  R EP+ +I++A++M + ++  IQ+ V  L+ G     P   K++   + +
Sbjct  118  DYAKYPAGTSRFEPVAIIVAASIMVLVSVVFIQEGVTKLVDGLAHGQPEAPKLSAAAVVI  177

Query  188  LLFAISTKTIL-----WYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLTAKLHTNL  242
            ++ A+  K  L     W L F     S +  AI  D+RND +SN+ A++  + + ++ +L
Sbjct  178  VVLAVLVKIGLIFYARWVLTFTY---SASVEAIMDDNRNDTISNAFAIVAYIISSVNEDL  234

Query  243  WYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFIDK  284
            WY+D  GAILI L+I  +W   G EQV +LVG+ A   F+ +
Sbjct  235  WYVDPAGAILIFLFIMFAWGKMGKEQVAQLVGVCASEEFMTE  276

>PYIW_26705
Length=230

 Score = 107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 127/226 (56%), Gaps = 22/226 (10%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKR---MH  127
            HV  V+++SL  NI +       AI S SLA+LS+LV++++DL  Q L W++  R     
Sbjct  12   HVAMVLKSSLFTNICIVLVMTTIAIASKSLALLSTLVENMVDLFVQSLLWYAGTRGGGKK  71

Query  128  TPSSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLPNIKMNQFTIAV  187
               +KYPAG  R EP+ +I+++++M + A+  IQ+ V  L+ G+    P  +  + + A 
Sbjct  72   QDYAKYPAGTSRFEPVAIIVASSVMVLVAITFIQEGVTKLVNGFAHGNP--EAPKLSTAA  129

Query  188  LLFAISTKTILWYLCFRIGLT-----------SPTARAIAQDHRNDVLSNSAAVITSLTA  236
            ++ + S   I      +IGL+           S  A AI  D+RNDV SNS A+   + +
Sbjct  130  VVLSSSIVVI------KIGLSAYSYWTIKRTYSAAAHAIGDDNRNDVFSNSFAIAAYIIS  183

Query  237  KLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPVFI  282
              + +LWY+D+ GAIL+ L+I  +W   G +QV +LVG++A   F+
Sbjct  184  SANEDLWYVDACGAILVFLFIMFAWAKMGKDQVAQLVGVRASEEFM  229

>PYAP_18437
Length=451

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 92/164 (56%), Gaps = 9/164 (5%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV  V++ S+  N+++       AI S SLA+LS+LV++++DL  QGL  ++  R     
Sbjct  275  HVSMVLKLSVSTNVLIVVTMTALAIASKSLALLSALVENMIDLFVQGLLAYAGTRSGKKQ  334

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +K+PAG  R EP+ VI+++++M + ++  IQ+ ++ L+ G    E   P + +    I
Sbjct  335  DYAKFPAGTSRFEPVAVIVASSIMVLVSVFFIQEGIKKLVDGLVHGEPEKPELSVAAVVI  394

Query  186  AVLLFAISTKTILWYLCFRI--GLTSPTARAIAQDHRNDVLSNS  227
              L  AISTK  L     R+    TS    AI  D+RNDV+SNS
Sbjct  395  TSL--AISTKVFLMMYASRVLKTHTSAAVEAIQDDNRNDVVSNS  436

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 96/170 (56%), Gaps = 15/170 (9%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTPS  130
            HV +V++ SL  N+I+       A+ S SLA+LS+LV++++DL  QGL  ++  R     
Sbjct  49   HVATVLKMSLGTNVIIVLTMTAVAVASKSLALLSTLVENMIDLFVQGLLAYAGTRSGKKQ  108

Query  131  --SKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGY---EGTLPNIKMNQFTI  185
              +K+PAG  R EP+ VI+++++M + ++  IQ+  + L+ G+       PN+ +    I
Sbjct  109  DYAKFPAGTSRFEPVAVIVASSVMVLVSVVFIQEGAKKLVDGFAHDNPEKPNLTIEALVI  168

Query  186  AVLLFAISTKTIL-----WYLCFRIGLTSPTARAIAQDHRNDVLSNSAAV  230
            A +  AISTK  L     W L      TS    AI  D+RNDV+SNS A+
Sbjct  169  AGM--AISTKVFLILYSRWVLKTH---TSAAVEAIQDDNRNDVVSNSFAI  213

>PYAR_21141
Length=139

 Score = 45.1 bits (105),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 76/128 (59%), Gaps = 3/128 (2%)

Query  71   HVGSVIRASLIANIILACGKLYAAINsgslavlsslvdsildltsQGLFWFSDKRMHTP-  129
            HV  V++ SL+ N+++       AI S SLA+LS+L ++++DL  QGL  ++  R  +  
Sbjct  12   HVTLVLKLSLLTNVLIVATMAGIAIASHSLALLSALAENLIDLFVQGLLAYAGTRSGSKL  71

Query  130  -SSKYPAGRRRLEPIVVIISATLMGMAALEVIQKAVETLIIGYEGTLP-NIKMNQFTIAV  187
              +K+PAG  R EP+ VI+++++M + +L  IQ+ V  ++ G     P   +++   + +
Sbjct  72   DYAKFPAGTSRFEPVAVIVASSIMVLVSLFFIQEGVTKIVDGVIHKNPEKPELSVPAVVI  131

Query  188  LLFAISTK  195
            +  AISTK
Sbjct  132  VSLAISTK  139

>PYIW_20676
Length=946

 Score = 34.7 bits (78),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query  221  NDVLSNSAAVITSLTAKLHTNLWYIDSVGAILISLYIAISWLATGSEQVQRLVGLQADPV  280
            N  LS   +V+ +L    +   W++  +  +L+S Y++  +    S ++QRL  +   P+
Sbjct  501  NGFLSTLVSVLVTLVTISYITPWFMVILAPVLLSYYVSQRYFIKTSRELQRLDSISRSPI  560

Query  281  FIDKLRNFTNNHHPKMQADIIRAYHFGSNYLVEVEVILPE  320
            F   L + T +  P      IRAY   +N++   +++L +
Sbjct  561  F--ALLSETLDGLPT-----IRAYGVENNFMGRNQLLLDK  593

>PYVX_23335
Length=1443

 Score = 33.9 bits (76),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (9%)

Query  319   PEKMSVREAHDISLDLQRKIEEFDNVERAFVHVDYLARGYDEHKD  363
             P++ +VR  HD SLD+ R+I   D++ ++F  V  L R   EHKD
Sbjct  1393  PKRSAVRSRHDPSLDV-RRIHNPDDIPKSFRAVLQLKR---EHKD  1433

>PYU1_G000296
Length=509

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 0/53 (0%)

Query  39  EHRENRRSQIAHSLIHKQNGEEIEIVPAATSRHVGSVIRASLIANIILACGKL  91
           +H E R S+ AH L+H++     E + A  S     ++  +   N IL  G L
Sbjct  19  DHGETRSSRNAHRLLHRKMSLPFEPIAADVSTQYSPLVAYAFTVNYILGVGSL  71

>PHYSO_315263
Length=748

 Score = 32.0 bits (71),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 43/91 (47%), Gaps = 21/91 (23%)

Query  176  PNIKMNQFTIAVLLFAISTKTILWYLCFRIGLTSPTARAIAQDHRNDVLSNSAAVITSLT  235
            P  K +Q   A++LFA +   +LW+         PT  A  + H    L+N  AV+  L 
Sbjct  177  PYSKFSQVRYAIVLFA-TLCYVLWF---------PTELAFPEQHS---LTNVDAVVGVLL  223

Query  236  A-----KLHTNLWYIDSVGAILISLYIAISW  261
            A      LHT   Y+   GAI+IS +  I+W
Sbjct  224  AVDVLFTLHTG--YVTPTGAIVISHWF-IAW  251

>HYAP_11200
Length=340

 Score = 31.6 bits (70),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (56%), Gaps = 3/45 (7%)

Query  185  IAVLLFAISTKTILWYLCFRIGLTSPTARAIAQ---DHRNDVLSN  226
            +A+LLF   T   L +LCFR G+ S   R  A     HRN +L++
Sbjct  9    VALLLFIPVTLVALLFLCFRAGIDSENTRRGAPHTLSHRNFLLAH  53

Lambda      K        H        a         alpha
   0.321    0.134    0.389    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 25135002624

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40