Loading Multiple Sequence Alignment....


Raw alignment output
MUSCLE (3.8) multiple sequence alignment


PYAR_15970        ---------------MLSTSSTDSKPPH------------------GLLRPK--ESKDAP
CCA18902          ------------------MSEVEYSTSS---------------ADIG--DRTH-DPQKSK
CCI45132          ------------------MSGNESNSPS---------------SDIG--DKNAVSSQDFK
PHALS_08787       ---------------MEIERVQTRVNVDGKM-----------LIE---------QPQQTP
PHYKE_3345        MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP
PHYCA_122897      ---------------MEVENTQVHVRSDGKK-----------LIGTT-LRHQGMPPQQAP
PHYSO_472559      ---------------MEVESTRVHVRPDGKK-----------LIDVT-LRRQGVPSQQAP
PITG_01116        ---------------MEVASTQVHVRPDGKK-----------LIDVT-LRRQGMVPEQAA
PPTG_10245        ---------------MEVESTQ--VRPDGKK-----------LIDVT-LRRQGMPPQQAP
SPRG_06208        ---------------MSLVVETKRVSAK---------------MELGPAPP---PRHKAP
SDRG_01907        ---------------MSLVVETKRASAK---------------MELGPAPP---PRHKAP
H257_00385        ---------------MDLHIERKHVTAD---------------VNLRVPSRTKLHVHEAP
H310_01400        ---------------MDLHVETKHVTTD---------------VSLHVPPRHKSHVHEAP
                                                                              

PYAR_15970        TH----------------------------------------------------------
CCA18902          EN----------------------------------------------------------
CCI45132          VS----------------------------------------------------------
PHALS_08787       LI----------------------------------------------------------
PHYKE_3345        LASYVEECCQTLIMEATHKVNDGERVPGASILENDMLGLLYLGGIDISTVGKYRGVKGDG
PHYCA_122897      LV----------------------------------------------------------
PHYSO_472559      LV----------------------------------------------------------
PITG_01116        LV----------------------------------------------------------
PPTG_10245        LV----------------------------------------------------------
SPRG_06208        LA----------------------------------------------------------
SDRG_01907        LA----------------------------------------------------------
H257_00385        LA----------------------------------------------------------
H310_01400        LV----------------------------------------------------------
                                                                              

PYAR_15970        ---------------------------VCAVLRADRSGESGTFDRAIAV-----------
CCA18902          ----------------------------EILESKTNNSSN--------------------
CCI45132          ----------------------------ETLESRTKSSSN--------------------
PHALS_08787       ---------------------------VPSFDDEDDSSCS---DDEPAMTSSNMLN---K
PHYKE_3345        SRVEDGLYALDLPQWRLCWCRSKGMYFIPHFDDDDDSSSDSDLDEPPSKSVSLSTSMNKN
PHYCA_122897      ---------------------------VPRFDDEDDSSSS--GDDEPAFKSLSSL-----
PHYSO_472559      ---------------------------VPRFDDEDDSSSSDSDDEEPAIKSTASLN---K
PITG_01116        ---------------------------VPQFDDDDDSSSS---DDGPAIEFLFASN---K
PPTG_10245        ---------------------------VPQFDDDDDSSSS---DDEPAIESLFQSSLSKK
SPRG_06208        ---------------------------LPEFDDSDSDDDSHALEDIPPV-----------
SDRG_01907        ---------------------------LPEFDDSDSDDDSHALEDVPPA-----------
H257_00385        ---------------------------MPQWDDEDDNSSD---DDQPPT-----------
H310_01400        ---------------------------MPQWDN-DDSSDD---DDGPSP-----------
                                                      .. .                    

PYAR_15970        -------IASDDPKCTAV-----------KYLAPTPDACEDWIRSFHRVQIAQRSGSRED
CCA18902          -------SEEDEESGSAE---------DRVVKSKLPAY--AHQNVKKQREA-DKTFSLSL
CCI45132          -------IEEDGESDSTD---------HRIGKSKVPTYKCSDQEVEQKKEV-EKGSTLSS
PHALS_08787       QRFIDRCNKNNTEYGYEA-QASFRDKCNQDEIQQSLSSDVRWDQVREAEEVTNTNGTSCS
PHYKE_3345        HYGSGSISNNNDEDDHDEDEAADGVKSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTS
PHYCA_122897      -YAYES-ISNNNEEDHDL--------FKLNRQQQTFQGGIQWDRVQELQELTNANATLTS
PHYSO_472559      RHYSIP-SNNNNEDDHGG----ATVSSGKLDQGQTFQGEVQWDHVQELQELTNANATLTS
PITG_01116        QNTSGT-SNNNEENNHDE---CADGRSHSQQQQKPFSGEIQWDRVQELQELTNANATLTA
PPTG_10245        QYTSGS-SNNNDEDNHDE---------NTGEQQKLFQGEIQWDRVQEIQELTNADTTLTS
SPRG_06208        -------IETSSNNQSDF----------------------KWDGISDIQMLKHQNAELVA
SDRG_01907        -------IETSSNNQSDF----------------------KWDGISDIQSLKHQNAELVA
H257_00385        -------RDNHGDASQDD---------DNQPPPPLDPAAFNWDGVGDIQALQLKNSELVA
H310_01400        -------CDMDNEASQDD---------DNQPSPPLDPVAFNWDGVGDIQALQLKNSELVA
                                                                              

PYAR_15970        TVASMPLGSHS------------------DTAATTPSDAYREATSRRAASTASGLSH---
CCA18902          QVIKLKEEIKK---------------CKVQLEALAPVPGLDRNAVEAVLLEADGVDH---
CCI45132          QVIKLKEEIKK---------------HKILLEALAPVPGLDRNILEAVLLEGDAMNH---
PHALS_08787       EIRDLRQQVKA---------------LQIQLEAQAPVPGLDIEAFHEILLDKEELDH---
PHYKE_3345        EARDLRQQVKA---------------LQIQLEAQIPVPGLDIDAVQDMLLDKDSVEH---
PHYCA_122897      EARDLRQQVKM---------------LQIQLEAQTPVPGLDVDAVQDILLEKDNIEHASI
PHYSO_472559      EARDLRQQVKA---------------LQIQLEAQAPVPGLDADAVQDILLEKDILEH---
PITG_01116        EARDLRQQVKA---------------LQIQLEAQAPVPGLDVDAVQDILLEKDSLDH---
PPTG_10245        EIRDLRQQVKA---------------LQIQLEAQAPVPGLDVDAVQDILLEKDNLDH---
SPRG_06208        AIKSQKQQINE---------------LQLLLEAMEPVPGLDVDSFKDILQGSEIVDH---
SDRG_01907        AIKSHKQQINE---------------LQLLLEALEPIPGLDVDAFKDILQGSEIVDH---
H257_00385        TIKDYKHHVTE---------------LQLLLEAVEPIPGLDVNTLRDVLQGAEVVDH---
H310_01400        TIKDYKHQVTEYGLCLISFCGLCVCRLQLMLEAMEPIPGLDVNSLRDVLQGAEVVDH---
                     .                            *  *  .             . :.*   

PYAR_15970        ------------------------------AGSGSRMSDLSDAPSYVSSAYGPTPV-LHH
CCA18902          --DLRDVKIVHQAKQLRQLKQAIQKEQRGARNALNSMKSMEVEKARMERELEAAQLQIKK
CCI45132          --DLRDVKIVHQAKQLRQLKQLIQKEQRVAHNALNSMKLMEVEKVKMERELEAAHLQIKK
PHALS_08787       --DIRDVKIVHQAKSLRTLKRLLQREKQRTADSVKQCIALETTSKHHEQEIDTLKLKLQR
PHYKE_3345        ------------------------------------------------------------
PHYCA_122897      YCDVRDMKIVHQAKTIRALKRSLQREKQLAADADKQCKTMDATNRKLEEQVDILKLKLQR
PHYSO_472559      --DVRDVKIVHQAKTLRTLKRSLQHEKQIAADAVKQCKTFEAANKKLEDEVDTLKLKLQR
PITG_01116        --DIRDVKIVHQAKTLRTLKRSLQREKQLAADGSRQCKELERANKQFEEEVDTLKMKLQR
PPTG_10245        --DVRDVKIVHQAKTLRSLKRQLQREKQLAMDATKQSQALQAANKQLEEEVDTLKLKLQR
SPRG_06208        --DIRNVKIVHQAKKLRQATLAYNKEKSRVAAASAKMAELERAVEAAQTLQGKAERALQR
SDRG_01907        --DIRNVKIVHQAKKLRQATLAYNKEKTRAAAASTKMAEMERAVEAAQTLQLKAERALQR
H257_00385        --DIRDVKIVHQAKKLRQAKIALTKEKSKGAGASGRIAELERQLHDAEERHLKSERLVHK
H310_01400        --DIRDVKIVHQAKKLRQAKIALNKEKVKGAGASGRIAELEKQLHDAEENYHKSQRLVHK
                                                                              

PYAR_15970        APSNSSTSSVTSGSAPGSAAPGNV-----------------------LLFVPAAGSAISV
CCA18902          FKSPVDCTTPKNGSEPNYNNHGGLALHTSSKRTVSPHGANQRNFTTWRTKYDDLKIRNDK
CCI45132          TKFRVESLTLRNGSEVISNNQAEMSPRVSSKRTNSPHAATQRKSSTWRSKYDDLKIHNDK
PHALS_08787       LHARAAGNKTNSLSSVTSSETPTV-----------STNDTCINDENLKKNCEALKLKNTA
PHYKE_3345        -------------------------------------------------MCEELKSKNVA
PHYCA_122897      FQARDVAEK--------------------------------------NSNVDELKLKTAT
PHYSO_472559      FQARAAAD---------------------------------------KKLCEELKSKSTS
PITG_01116        FQARAAAE---------------------------------------KKLCDELKSKNIA
PPTG_10245        FQARVAAEKANNNGAVNQPQLPES-----------PSSDTNSDGGSLKKLVDELKSKNTA
SPRG_06208        LQQLPRPEAAKKVPSPEKEIAA-------------------------SKKLEELKLKCEA
SDRG_01907        LQQQPRPDVAKKVPSPEKEVAA-------------------------SKKLEELKLKCEA
H257_00385        LQLGEKPEPK---HTESANTVP-------------------------LKKFEDLRVKYEA
H310_01400        LQLGEKPEPK---PEATTNTVP-------------------------LKKFEDLRVKYEA
                                                                              

PYAR_15970        SDTKLLEAKKEMDVLVAAGAKRPLR--------GGMENAKETQW-RYGPPEYVL---SDL
CCA18902          LLCDMKKLHRALTQEMGVDASTPLVDLLKVYGPNQSTGSVIGDGGKRTRSQQIIVLKAKV
CCI45132          LQSDMKKLHRALTQELGVDASMPLMELLEMYGPNQSTGSVIGEGGKRTRSQQIIVLKAKV
PHALS_08787       LQQELKTTQRALIREVGDD--VPLEDII-----CNTDSTTSRSA-RRGRAQHIIILKSKV
PHYKE_3345        LQQELKKTQRALVREVGDD--VPLEDIL-----GNTDSTVSGAS-RRGRAQHIVMLKAKV
PHYCA_122897      LQQELKKTQRALAREVGDD--IPLDEIV-----GEKDNSTSGASRRRGRAQQIIILKAKV
PHYSO_472559      LQQELKKTQRALVREVGDD--VPLEDII-----GNTDNTASGAS-RRGRAQHIIMLKAKV
PITG_01116        LQQELKKTQRALVREVGED--VPLEDIV-----GNTDTATSGAS-RRGRAQQIIMLKTKV
PPTG_10245        LQQELKKTQRALVREVGED--VPLEEIV-----GNTDNAASGAS-RRGRAQQIIMLKTKV
SPRG_06208        QAVELKRTQRALQREVGDD--IALSEIL-----DASDSG------KRGRAQQIVMLKAKI
SDRG_01907        QAVELKRTQRALQREVGDD--VALSDIL-----DASDSG------KRGRAQQIVMLKAKI
H257_00385        MAIDLKKTQRALQREVGDD--VPLAEIL-----DGEGGG------KRGRAQQIVMLKAKV
H310_01400        ATIELKKTQRALQREVGDD--VPLADVL-----DGEGG-------KRGRAQQIVMLKAKV
                     .:   :. :   :. .   .*                     .   .: ::   :.:

PYAR_15970        EYIKGK---TRDDETT----------------PLESVRQEYFYIQVNDGERISGHVLKEN
CCA18902          KELKLKCALERRRASSISSHPESTNLSEESLASMDAKVVSEIYKQQEHKQKQLDQLIIDN
CCI45132          KELKRRLALERRRTSSISSNLEATNLYEKPGGSIDAKVGSELVKQHEHKQKQLDQLLSDN
PHALS_08787       KRLQTQLA-NLKQGSIVSDAQSSENSA--TVLDVDKRAQQDLSDQQLHRQKVIDQLSSQR
PHYKE_3345        KKLQTQLV-PLKSGSTSAGSQDSTNVA--TVIDVDQRAQQDLSGQQMHRQKRVDQLTSQR
PHYCA_122897      KKLQAQL----KAGHA---TAEVHDTA--TTLDVDQRAQQELSSQHFHRQKLIDQLTNQR
PHYSO_472559      KKLQAQLA-SVKPGTTSVASQDSADTT--TVLDVDQRAQQDLSGQQIHRQKLLDQLTSQR
PITG_01116        KQLQTRLA-TLRPGTS---STDTHDNG--HVLDVDQRAQQDLSGLQMHRQKLLDQLTSQR
PPTG_10245        KKLQTRLA-TMRPGTT---SPDPHDLG--NVLDVDQRAQQDLSGQQMHRQKLLDQLTTQR
SPRG_06208        KKLERANP-SPLDAPR----------------DVDRKAEDDLAATKLERQKQIDKLLDDS
SDRG_01907        KKLERAQP-SPVDVPR----------------DVDRKAEDDLAASKLERRKQSEKLLEDG
H257_00385        KKLEKELQ-TRTAPDT----------------GVDAKAEVELLALKADKQRQLDHVVADL
H310_01400        KKLEKELQ-SRSEPDT----------------GVDAKAEVELLALKVDKQKLLDQAVADL
                  : ::                             ::      :        .   :   : 

PYAR_15970        D--------LFGMLYLNADQVDMELREGEERKDPCAVL------SEAFTQGFPMEVLDMR
CCA18902          EQYRIRVEHLTGKIKASQSRTHILEQERKENKAKIQALVEKSDTDDKLIDALHAQVLLWK
CCI45132          EQYRIRVEQLIGKLKASQSRTHILEQERKENKAKIQVLAEKSGTDDKLIDALQAQVSLWK
PHALS_08787       DELQDRLHRLTRKYDAIKARVQILDRERQEMRDKFQVLIEKSKTDDALIDALQRQLETWK
PHYKE_3345        DDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWK
PHYCA_122897      DELEERVHRSTRKYDALKARAQILDREKQEIRNKFQVLVEKSRTDDALVDALQRQLETWK
PHYSO_472559      DELQERIHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRTDDALVDALQRQLEAWK
PITG_01116        DELQERLHRLTRKYDALKARAQILDREKNETRDKFQVFVDKSRTDDALVDALQRQLETWK
PPTG_10245        DELQERLHRLTRNYDALKARAQILDREKHETRDKFQVLVDKSRTDDALVDALQRQLETWK
SPRG_06208        NALRESHEKLQKKYDSTKARLHVFEKDASKSKVKISVLLEKSKNDDLLIDRLQSELEAKK
SDRG_01907        NALREGHEKLHKKYEATKARLHVFEKESSKSKVKISVLLEKSKNDDLLIDRLQSELETKK
H257_00385        DALKDANDKLSRKYDAQKARMHTLEKDAGKHKTKLAILLDKSHNDDSLIDALQHEMDDLR
H310_01400        DAFKDANDKLSRKYDAQKARLHTLEKDATKNKAKISVLLDKSKNDDSLIDALQNEMDGLR
                  :                  .     .:  : .     :      .: : : :  ::   .

PYAR_15970        S---------------------------DKLSEIDILGDFGDFNITA-------------
CCA18902          QRTEK---------AKRAHASDGN----NVSVTETIFPSLRSSQSSGVDRRKSI------
CCI45132          EKTQK---------AKRVH-TDGN----NITGTSTILPSLSTSHSTSPRGHKSQNHS---
PHALS_08787       SKLHQ---------ARRARTADGVKN--TNQVEQAELERLRQLVGEHKG-----------
PHYKE_3345        GKLHE---------ARRARTADGSTKGSASQEERTELERLRKIVSAHKGG----------
PHYCA_122897      TKLHE---------ARRARTADSAKF--TSQEERAELEKLRKVVAEHKS-----------
PHYSO_472559      AKLHE---------ARRARTADGMKAS-ANADERAELERLRKIVAEHKS-----------
PITG_01116        TKLHE---------ARRARTADAPKAAGTSQEERVELERLRRIVAEHKS-----------
PPTG_10245        TKLHD---------ARRARTADSSKC--TSQDERVELERLRKIVAEHKS-----------
SPRG_06208        PGPSS-----------RARTAD------SKPLDANELEALKLLCKDQK------------
SDRG_01907        PGPSS-----------RARTAD------SKAPDGDELDALKLLCKDQKRQLAHQASLLES
H257_00385        RQISTNASALAKDQLHRARTADSG----NIIDATNTVEALRTKCLEQKRQLAHQASTIES
H310_01400        RQVTS--SGVSKEQWHRARTADS-----SILTDAAAMDALRTTCAEQKRQLAHQAATIES
                                                      .  :                    

PYAR_15970        --ASVHAPPSVTRSISQPMPMPQASAKRTQLYRQF-------------------------
CCA18902          --KLHESGKSEISSKQVELAIP---VSETARYRQLHVENERLLCVIRELKKQV-------
CCI45132          --RSHHSSTAEVSIKQVEMAIPAIPVSETARYRQLHVENERLLCVIRELKKQH-------
PHALS_08787       --QSGERSASCSLSSDRTMPRP----SEIAQYRAIAVEKERLTELVCSLKSQVENKDKQL
PHYKE_3345        --GGGDRVSTPLTISGGAMPQP----SEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQL
PHYCA_122897      --RGSDWAASPIGPAGGGMPLP----SEASLYRAIIV---RVVD----------------
PHYSO_472559      --RGGDRATVQSNTM---MPQP----SEASQYRAMAVRG--FITLVRSIDDKA-------
PITG_01116        --RAGDRSNT-------AMPQP----SEISQWRRSV------------------------
PPTG_10245        --RGGDRST-------GAMPQP----SEISQYRAIAVEKERLTEVVRSLKAQVEDKDKQL
SPRG_06208        --RQVEIHPTCYELMQ--------------------------------------------
SDRG_01907        FQRDLHAAQSTDLKHTKASVSK----EQFGNYQALAIEKERLVELVKSLQQQLQAAKLDA
H257_00385        FRRDLQQAQKLESTKIGVNGM-----TDTANHQALAIEKERLVELVKSLQHQLTDAKK--
H310_01400        FRRDLQQAEKLQSHRVGGNHGD----AATGN-HSLAIEKERLVELVKSLQQQLDAK----
                                                                              

PYAR_15970        -------------------------------------MPQAHGA----------------
CCA18902          ---------------------IQNDNFRSPAIETESCIPRPKKIQECS------------
CCI45132          ---------------------VKTDITQSPGTATESRIPRPMESREYV------------
PHALS_08787       QSLRERRGNFGAASETLTRI-TPPPSMPVPGDGSVSRIPRLRGSKTPPEGRPFGASMSSL
PHYKE_3345        RVMHEQQGGTGLAPQASSQMAPSLSSLPPIGDESVSRIPRKPGSNCPPSGRRNSSTSSTS
PHYCA_122897      ------------------------------------------------------------
PHYSO_472559      ---------------------HPNVFLVVGMIGGEGALSGGCSRLESP------------
PITG_01116        ------------------------------------------------------------
PPTG_10245        RSLQESHSSSDLLQAT-----PPSPSLPPIGDESVSRLPRRPSRIPLPSGGP--------
SPRG_06208        ------------------------------------------------------------
SDRG_01907        PP-------------------KPSGIPHLRNDASRSRLPSPR------------------
H257_00385        ---------------------ADAAVAPPPKPEIRSRLPRLNGS----------------
H310_01400        ---------------------KADPPPPPPKQEPRSRLPRL-------------------
                                                                              

PYAR_15970        ------------------------------------------------------------
CCA18902          -----DIHATKAIEKMRKRFCKNLEAMDLENAKLPEHKRTLSENSLDEGGAQAMKIYTQQ
CCI45132          -----DINATKTIEKMRTRFCKPLEETDHENTSLP-------------------------
PHALS_08787       -----PASLTVKMEQQQQQLKQEMETLRKTFRESMREKDD--------------------
PHYKE_3345        SSVGPPAPSAMMMEQQNQQLKHEMEILRKTFRESMCEKDE--------------------
PHYCA_122897      ------------------------------------------------------------
PHYSO_472559      -----TRREGQTVAKCAGRIRNTAAYFDPTNSA---------------------------
PITG_01116        ------------------------------------------------------------
PPTG_10245        -----PPPSAVIMEQQQQQLKHEMETLCKTFRETVREKDE--------------------
SPRG_06208        ------------------------------------------------------------
SDRG_01907        -----TLNDVAELDRLRLAVEAKDEEIATWKRAYEAAVSD--------------------
H257_00385        --------DSADVDKLRRAIEAKDEEIGTWKDA---------------------------
H310_01400        -----TPDLSADVDKLRRTIEVKDEEIATWKEA---------------------------
                                                                              

PYAR_15970        ------------------------------------------------------------
CCA18902          GHRIQEAEAKCERHQVLPDGAAHDCDLHQVVLLKKRDLTNGNLEVTNTSNAANKAYNVHW
CCI45132          --------LAPL------------------------------------------------
PHALS_08787       ----RIAELEQQHKLLDQSGTAKMYTAD-GMSQKFQELEEENAFLRQEYNRLKSRYEALA
PHYKE_3345        ----RITQLEHLHHATVHRASADLDINSNGMNQELLDLQEENDFLRQEFDRLKVRYEALV
PHYCA_122897      ------------------------------------------------------------
PHYSO_472559      --------VSCATPDRGRKRITHPCEPSAQHTQCTLVFVTANYYVERVVFAARGDLEARF
PITG_01116        ------------------------------------------------------------
PPTG_10245        ----RIAELEQHRQSTAQSSTTGTDVNA--MSQQLRELQEENDFLRQEFDKLKTRYEALT
SPRG_06208        ------------------------------------------------------------
SDRG_01907        ----KVSCSEELRLLILASQTSTSQHSH-----LIADLEEENAALKDECLKLQNMVRAAR
H257_00385        --------LEQATKASAAQTNSR----------LVADLEEENERLRDQVDELKKQVVLGH
H310_01400        --------YERATTAAARTTPSTMSNSR-----LVADLEEDNERLRSQVDELKRQVALGE
                                                                              

PYAR_15970        ------------------------------------------------------------
CCA18902          GKPDEENEASEGENQEPIEKPNFGLSGALAKDRVTGNTVNGVVMKWSEPINAGIPQCRWR
CCI45132          ------------------------------------------------------------
PHALS_08787       KENERFNSENQQ------------------------------------------------
PHYKE_3345        KSPAVTIKKSSTRSK---------------------------------------------
PHYCA_122897      ------------------------------------------------------------
PHYSO_472559      PSQEGRAREATAQLK---------------------------------------------
PITG_01116        ------------------------------------------------------------
PPTG_10245        KPPASVSRKKSRSKEK--------------------------------------------
SPRG_06208        ------------------------------------------------------------
SDRG_01907        KREETRVS----------------------------------------------------
H257_00385        RPRKHGGSNGSS------------------------------------------------
H310_01400        HHRKHAA-----------------------------------------------------
                                                                              

PYAR_15970        ------------------------------------------------------------
CCA18902          LYVFKGEASIATLHIYSKSAFLVGRDKTVADILTEHSSCSKQHAVIQFRLFQKENKTGTY
CCI45132          ------------------------------------------------------------
PHALS_08787       ------------------------------------------------------------
PHYKE_3345        ------------------------------------------------------------
PHYCA_122897      ------------------------------------------------------------
PHYSO_472559      ------------------------------------------------------------
PITG_01116        ------------------------------------------------------------
PPTG_10245        ------------------------------------------------------------
SPRG_06208        ------------------------------------------------------------
SDRG_01907        ------------------------------------------------------------
H257_00385        ------------------------------------------------------------
H310_01400        ------------------------------------------------------------
                                                                              

PYAR_15970        -----------------------------------------------------
CCA18902          ISEVRPYILDLQSTNGTFLNGERIESSRYIELREKDLLRFGESTREYVLLRAS
CCI45132          -----------------------------------------------------
PHALS_08787       -----------------------------------------------------
PHYKE_3345        -----------------------------------------------------
PHYCA_122897      -----------------------------------------------------
PHYSO_472559      -----------------------------------------------------
PITG_01116        -----------------------------------------------------
PPTG_10245        -----------------------------------------------------
SPRG_06208        -----------------------------------------------------
SDRG_01907        -----------------------------------------------------
H257_00385        -----------------------------------------------------
H310_01400        -----------------------------------------------------
                                                                       

FASTA format
>PYAR_15970
---------------MLSTSSTDSKPPH------------------GLLRPK--ESKDAP
TH----------------------------------------------------------
---------------------------VCAVLRADRSGESGTFDRAIAV-----------
-------IASDDPKCTAV-----------KYLAPTPDACEDWIRSFHRVQIAQRSGSRED
TVASMPLGSHS------------------DTAATTPSDAYREATSRRAASTASGLSH---
------------------------------AGSGSRMSDLSDAPSYVSSAYGPTPV-LHH
APSNSSTSSVTSGSAPGSAAPGNV-----------------------LLFVPAAGSAISV
SDTKLLEAKKEMDVLVAAGAKRPLR--------GGMENAKETQW-RYGPPEYVL---SDL
EYIKGK---TRDDETT----------------PLESVRQEYFYIQVNDGERISGHVLKEN
D--------LFGMLYLNADQVDMELREGEERKDPCAVL------SEAFTQGFPMEVLDMR
S---------------------------DKLSEIDILGDFGDFNITA-------------
--ASVHAPPSVTRSISQPMPMPQASAKRTQLYRQF-------------------------
-------------------------------------MPQAHGA----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>CCA18902
------------------MSEVEYSTSS---------------ADIG--DRTH-DPQKSK
EN----------------------------------------------------------
----------------------------EILESKTNNSSN--------------------
-------SEEDEESGSAE---------DRVVKSKLPAY--AHQNVKKQREA-DKTFSLSL
QVIKLKEEIKK---------------CKVQLEALAPVPGLDRNAVEAVLLEADGVDH---
--DLRDVKIVHQAKQLRQLKQAIQKEQRGARNALNSMKSMEVEKARMERELEAAQLQIKK
FKSPVDCTTPKNGSEPNYNNHGGLALHTSSKRTVSPHGANQRNFTTWRTKYDDLKIRNDK
LLCDMKKLHRALTQEMGVDASTPLVDLLKVYGPNQSTGSVIGDGGKRTRSQQIIVLKAKV
KELKLKCALERRRASSISSHPESTNLSEESLASMDAKVVSEIYKQQEHKQKQLDQLIIDN
EQYRIRVEHLTGKIKASQSRTHILEQERKENKAKIQALVEKSDTDDKLIDALHAQVLLWK
QRTEK---------AKRAHASDGN----NVSVTETIFPSLRSSQSSGVDRRKSI------
--KLHESGKSEISSKQVELAIP---VSETARYRQLHVENERLLCVIRELKKQV-------
---------------------IQNDNFRSPAIETESCIPRPKKIQECS------------
-----DIHATKAIEKMRKRFCKNLEAMDLENAKLPEHKRTLSENSLDEGGAQAMKIYTQQ
GHRIQEAEAKCERHQVLPDGAAHDCDLHQVVLLKKRDLTNGNLEVTNTSNAANKAYNVHW
GKPDEENEASEGENQEPIEKPNFGLSGALAKDRVTGNTVNGVVMKWSEPINAGIPQCRWR
LYVFKGEASIATLHIYSKSAFLVGRDKTVADILTEHSSCSKQHAVIQFRLFQKENKTGTY
ISEVRPYILDLQSTNGTFLNGERIESSRYIELREKDLLRFGESTREYVLLRAS
>CCI45132
------------------MSGNESNSPS---------------SDIG--DKNAVSSQDFK
VS----------------------------------------------------------
----------------------------ETLESRTKSSSN--------------------
-------IEEDGESDSTD---------HRIGKSKVPTYKCSDQEVEQKKEV-EKGSTLSS
QVIKLKEEIKK---------------HKILLEALAPVPGLDRNILEAVLLEGDAMNH---
--DLRDVKIVHQAKQLRQLKQLIQKEQRVAHNALNSMKLMEVEKVKMERELEAAHLQIKK
TKFRVESLTLRNGSEVISNNQAEMSPRVSSKRTNSPHAATQRKSSTWRSKYDDLKIHNDK
LQSDMKKLHRALTQELGVDASMPLMELLEMYGPNQSTGSVIGEGGKRTRSQQIIVLKAKV
KELKRRLALERRRTSSISSNLEATNLYEKPGGSIDAKVGSELVKQHEHKQKQLDQLLSDN
EQYRIRVEQLIGKLKASQSRTHILEQERKENKAKIQVLAEKSGTDDKLIDALQAQVSLWK
EKTQK---------AKRVH-TDGN----NITGTSTILPSLSTSHSTSPRGHKSQNHS---
--RSHHSSTAEVSIKQVEMAIPAIPVSETARYRQLHVENERLLCVIRELKKQH-------
---------------------VKTDITQSPGTATESRIPRPMESREYV------------
-----DINATKTIEKMRTRFCKPLEETDHENTSLP-------------------------
--------LAPL------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>PHALS_08787
---------------MEIERVQTRVNVDGKM-----------LIE---------QPQQTP
LI----------------------------------------------------------
---------------------------VPSFDDEDDSSCS---DDEPAMTSSNMLN---K
QRFIDRCNKNNTEYGYEA-QASFRDKCNQDEIQQSLSSDVRWDQVREAEEVTNTNGTSCS
EIRDLRQQVKA---------------LQIQLEAQAPVPGLDIEAFHEILLDKEELDH---
--DIRDVKIVHQAKSLRTLKRLLQREKQRTADSVKQCIALETTSKHHEQEIDTLKLKLQR
LHARAAGNKTNSLSSVTSSETPTV-----------STNDTCINDENLKKNCEALKLKNTA
LQQELKTTQRALIREVGDD--VPLEDII-----CNTDSTTSRSA-RRGRAQHIIILKSKV
KRLQTQLA-NLKQGSIVSDAQSSENSA--TVLDVDKRAQQDLSDQQLHRQKVIDQLSSQR
DELQDRLHRLTRKYDAIKARVQILDRERQEMRDKFQVLIEKSKTDDALIDALQRQLETWK
SKLHQ---------ARRARTADGVKN--TNQVEQAELERLRQLVGEHKG-----------
--QSGERSASCSLSSDRTMPRP----SEIAQYRAIAVEKERLTELVCSLKSQVENKDKQL
QSLRERRGNFGAASETLTRI-TPPPSMPVPGDGSVSRIPRLRGSKTPPEGRPFGASMSSL
-----PASLTVKMEQQQQQLKQEMETLRKTFRESMREKDD--------------------
----RIAELEQQHKLLDQSGTAKMYTAD-GMSQKFQELEEENAFLRQEYNRLKSRYEALA
KENERFNSENQQ------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>PHYKE_3345
MAKAQQELDALVAKGAKVPSRVMENPSEGKPVEWRYGAPEYVLTDLAYVKGRSREPDGTP
LASYVEECCQTLIMEATHKVNDGERVPGASILENDMLGLLYLGGIDISTVGKYRGVKGDG
SRVEDGLYALDLPQWRLCWCRSKGMYFIPHFDDDDDSSSDSDLDEPPSKSVSLSTSMNKN
HYGSGSISNNNDEDDHDEDEAADGVKSSQNQPRDIFQSEIQWDRVQELQELTNANTTLTS
EARDLRQQVKA---------------LQIQLEAQIPVPGLDIDAVQDMLLDKDSVEH---
------------------------------------------------------------
-------------------------------------------------MCEELKSKNVA
LQQELKKTQRALVREVGDD--VPLEDIL-----GNTDSTVSGAS-RRGRAQHIVMLKAKV
KKLQTQLV-PLKSGSTSAGSQDSTNVA--TVIDVDQRAQQDLSGQQMHRQKRVDQLTSQR
DDLEERLHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRNDDALVDALQRQLETWK
GKLHE---------ARRARTADGSTKGSASQEERTELERLRKIVSAHKGG----------
--GGGDRVSTPLTISGGAMPQP----SEASQYRAMAAEKERLAEVIRGLKSQLEDKDKQL
RVMHEQQGGTGLAPQASSQMAPSLSSLPPIGDESVSRIPRKPGSNCPPSGRRNSSTSSTS
SSVGPPAPSAMMMEQQNQQLKHEMEILRKTFRESMCEKDE--------------------
----RITQLEHLHHATVHRASADLDINSNGMNQELLDLQEENDFLRQEFDRLKVRYEALV
KSPAVTIKKSSTRSK---------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>PHYCA_122897
---------------MEVENTQVHVRSDGKK-----------LIGTT-LRHQGMPPQQAP
LV----------------------------------------------------------
---------------------------VPRFDDEDDSSSS--GDDEPAFKSLSSL-----
-YAYES-ISNNNEEDHDL--------FKLNRQQQTFQGGIQWDRVQELQELTNANATLTS
EARDLRQQVKM---------------LQIQLEAQTPVPGLDVDAVQDILLEKDNIEHASI
YCDVRDMKIVHQAKTIRALKRSLQREKQLAADADKQCKTMDATNRKLEEQVDILKLKLQR
FQARDVAEK--------------------------------------NSNVDELKLKTAT
LQQELKKTQRALAREVGDD--IPLDEIV-----GEKDNSTSGASRRRGRAQQIIILKAKV
KKLQAQL----KAGHA---TAEVHDTA--TTLDVDQRAQQELSSQHFHRQKLIDQLTNQR
DELEERVHRSTRKYDALKARAQILDREKQEIRNKFQVLVEKSRTDDALVDALQRQLETWK
TKLHE---------ARRARTADSAKF--TSQEERAELEKLRKVVAEHKS-----------
--RGSDWAASPIGPAGGGMPLP----SEASLYRAIIV---RVVD----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>PHYSO_472559
---------------MEVESTRVHVRPDGKK-----------LIDVT-LRRQGVPSQQAP
LV----------------------------------------------------------
---------------------------VPRFDDEDDSSSSDSDDEEPAIKSTASLN---K
RHYSIP-SNNNNEDDHGG----ATVSSGKLDQGQTFQGEVQWDHVQELQELTNANATLTS
EARDLRQQVKA---------------LQIQLEAQAPVPGLDADAVQDILLEKDILEH---
--DVRDVKIVHQAKTLRTLKRSLQHEKQIAADAVKQCKTFEAANKKLEDEVDTLKLKLQR
FQARAAAD---------------------------------------KKLCEELKSKSTS
LQQELKKTQRALVREVGDD--VPLEDII-----GNTDNTASGAS-RRGRAQHIIMLKAKV
KKLQAQLA-SVKPGTTSVASQDSADTT--TVLDVDQRAQQDLSGQQIHRQKLLDQLTSQR
DELQERIHRLTRKYDALKARAQILDREKQETRNKFQVLVEKSRTDDALVDALQRQLEAWK
AKLHE---------ARRARTADGMKAS-ANADERAELERLRKIVAEHKS-----------
--RGGDRATVQSNTM---MPQP----SEASQYRAMAVRG--FITLVRSIDDKA-------
---------------------HPNVFLVVGMIGGEGALSGGCSRLESP------------
-----TRREGQTVAKCAGRIRNTAAYFDPTNSA---------------------------
--------VSCATPDRGRKRITHPCEPSAQHTQCTLVFVTANYYVERVVFAARGDLEARF
PSQEGRAREATAQLK---------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>PITG_01116
---------------MEVASTQVHVRPDGKK-----------LIDVT-LRRQGMVPEQAA
LV----------------------------------------------------------
---------------------------VPQFDDDDDSSSS---DDGPAIEFLFASN---K
QNTSGT-SNNNEENNHDE---CADGRSHSQQQQKPFSGEIQWDRVQELQELTNANATLTA
EARDLRQQVKA---------------LQIQLEAQAPVPGLDVDAVQDILLEKDSLDH---
--DIRDVKIVHQAKTLRTLKRSLQREKQLAADGSRQCKELERANKQFEEEVDTLKMKLQR
FQARAAAE---------------------------------------KKLCDELKSKNIA
LQQELKKTQRALVREVGED--VPLEDIV-----GNTDTATSGAS-RRGRAQQIIMLKTKV
KQLQTRLA-TLRPGTS---STDTHDNG--HVLDVDQRAQQDLSGLQMHRQKLLDQLTSQR
DELQERLHRLTRKYDALKARAQILDREKNETRDKFQVFVDKSRTDDALVDALQRQLETWK
TKLHE---------ARRARTADAPKAAGTSQEERVELERLRRIVAEHKS-----------
--RAGDRSNT-------AMPQP----SEISQWRRSV------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>PPTG_10245
---------------MEVESTQ--VRPDGKK-----------LIDVT-LRRQGMPPQQAP
LV----------------------------------------------------------
---------------------------VPQFDDDDDSSSS---DDEPAIESLFQSSLSKK
QYTSGS-SNNNDEDNHDE---------NTGEQQKLFQGEIQWDRVQEIQELTNADTTLTS
EIRDLRQQVKA---------------LQIQLEAQAPVPGLDVDAVQDILLEKDNLDH---
--DVRDVKIVHQAKTLRSLKRQLQREKQLAMDATKQSQALQAANKQLEEEVDTLKLKLQR
FQARVAAEKANNNGAVNQPQLPES-----------PSSDTNSDGGSLKKLVDELKSKNTA
LQQELKKTQRALVREVGED--VPLEEIV-----GNTDNAASGAS-RRGRAQQIIMLKTKV
KKLQTRLA-TMRPGTT---SPDPHDLG--NVLDVDQRAQQDLSGQQMHRQKLLDQLTTQR
DELQERLHRLTRNYDALKARAQILDREKHETRDKFQVLVDKSRTDDALVDALQRQLETWK
TKLHD---------ARRARTADSSKC--TSQDERVELERLRKIVAEHKS-----------
--RGGDRST-------GAMPQP----SEISQYRAIAVEKERLTEVVRSLKAQVEDKDKQL
RSLQESHSSSDLLQAT-----PPSPSLPPIGDESVSRLPRRPSRIPLPSGGP--------
-----PPPSAVIMEQQQQQLKHEMETLCKTFRETVREKDE--------------------
----RIAELEQHRQSTAQSSTTGTDVNA--MSQQLRELQEENDFLRQEFDKLKTRYEALT
KPPASVSRKKSRSKEK--------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>SPRG_06208
---------------MSLVVETKRVSAK---------------MELGPAPP---PRHKAP
LA----------------------------------------------------------
---------------------------LPEFDDSDSDDDSHALEDIPPV-----------
-------IETSSNNQSDF----------------------KWDGISDIQMLKHQNAELVA
AIKSQKQQINE---------------LQLLLEAMEPVPGLDVDSFKDILQGSEIVDH---
--DIRNVKIVHQAKKLRQATLAYNKEKSRVAAASAKMAELERAVEAAQTLQGKAERALQR
LQQLPRPEAAKKVPSPEKEIAA-------------------------SKKLEELKLKCEA
QAVELKRTQRALQREVGDD--IALSEIL-----DASDSG------KRGRAQQIVMLKAKI
KKLERANP-SPLDAPR----------------DVDRKAEDDLAATKLERQKQIDKLLDDS
NALRESHEKLQKKYDSTKARLHVFEKDASKSKVKISVLLEKSKNDDLLIDRLQSELEAKK
PGPSS-----------RARTAD------SKPLDANELEALKLLCKDQK------------
--RQVEIHPTCYELMQ--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>SDRG_01907
---------------MSLVVETKRASAK---------------MELGPAPP---PRHKAP
LA----------------------------------------------------------
---------------------------LPEFDDSDSDDDSHALEDVPPA-----------
-------IETSSNNQSDF----------------------KWDGISDIQSLKHQNAELVA
AIKSHKQQINE---------------LQLLLEALEPIPGLDVDAFKDILQGSEIVDH---
--DIRNVKIVHQAKKLRQATLAYNKEKTRAAAASTKMAEMERAVEAAQTLQLKAERALQR
LQQQPRPDVAKKVPSPEKEVAA-------------------------SKKLEELKLKCEA
QAVELKRTQRALQREVGDD--VALSDIL-----DASDSG------KRGRAQQIVMLKAKI
KKLERAQP-SPVDVPR----------------DVDRKAEDDLAASKLERRKQSEKLLEDG
NALREGHEKLHKKYEATKARLHVFEKESSKSKVKISVLLEKSKNDDLLIDRLQSELETKK
PGPSS-----------RARTAD------SKAPDGDELDALKLLCKDQKRQLAHQASLLES
FQRDLHAAQSTDLKHTKASVSK----EQFGNYQALAIEKERLVELVKSLQQQLQAAKLDA
PP-------------------KPSGIPHLRNDASRSRLPSPR------------------
-----TLNDVAELDRLRLAVEAKDEEIATWKRAYEAAVSD--------------------
----KVSCSEELRLLILASQTSTSQHSH-----LIADLEEENAALKDECLKLQNMVRAAR
KREETRVS----------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>H257_00385
---------------MDLHIERKHVTAD---------------VNLRVPSRTKLHVHEAP
LA----------------------------------------------------------
---------------------------MPQWDDEDDNSSD---DDQPPT-----------
-------RDNHGDASQDD---------DNQPPPPLDPAAFNWDGVGDIQALQLKNSELVA
TIKDYKHHVTE---------------LQLLLEAVEPIPGLDVNTLRDVLQGAEVVDH---
--DIRDVKIVHQAKKLRQAKIALTKEKSKGAGASGRIAELERQLHDAEERHLKSERLVHK
LQLGEKPEPK---HTESANTVP-------------------------LKKFEDLRVKYEA
MAIDLKKTQRALQREVGDD--VPLAEIL-----DGEGGG------KRGRAQQIVMLKAKV
KKLEKELQ-TRTAPDT----------------GVDAKAEVELLALKADKQRQLDHVVADL
DALKDANDKLSRKYDAQKARMHTLEKDAGKHKTKLAILLDKSHNDDSLIDALQHEMDDLR
RQISTNASALAKDQLHRARTADSG----NIIDATNTVEALRTKCLEQKRQLAHQASTIES
FRRDLQQAQKLESTKIGVNGM-----TDTANHQALAIEKERLVELVKSLQHQLTDAKK--
---------------------ADAAVAPPPKPEIRSRLPRLNGS----------------
--------DSADVDKLRRAIEAKDEEIGTWKDA---------------------------
--------LEQATKASAAQTNSR----------LVADLEEENERLRDQVDELKKQVVLGH
RPRKHGGSNGSS------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------
>H310_01400
---------------MDLHVETKHVTTD---------------VSLHVPPRHKSHVHEAP
LV----------------------------------------------------------
---------------------------MPQWDN-DDSSDD---DDGPSP-----------
-------CDMDNEASQDD---------DNQPSPPLDPVAFNWDGVGDIQALQLKNSELVA
TIKDYKHQVTEYGLCLISFCGLCVCRLQLMLEAMEPIPGLDVNSLRDVLQGAEVVDH---
--DIRDVKIVHQAKKLRQAKIALNKEKVKGAGASGRIAELEKQLHDAEENYHKSQRLVHK
LQLGEKPEPK---PEATTNTVP-------------------------LKKFEDLRVKYEA
ATIELKKTQRALQREVGDD--VPLADVL-----DGEGG-------KRGRAQQIVMLKAKV
KKLEKELQ-SRSEPDT----------------GVDAKAEVELLALKVDKQKLLDQAVADL
DAFKDANDKLSRKYDAQKARLHTLEKDATKNKAKISVLLDKSKNDDSLIDALQNEMDGLR
RQVTS--SGVSKEQWHRARTADS-----SILTDAAAMDALRTTCAEQKRQLAHQAATIES
FRRDLQQAEKLQSHRVGGNHGD----AATGN-HSLAIEKERLVELVKSLQQQLDAK----
---------------------KADPPPPPPKQEPRSRLPRL-------------------
-----TPDLSADVDKLRRTIEVKDEEIATWKEA---------------------------
--------YERATTAAARTTPSTMSNSR-----LVADLEEDNERLRSQVDELKRQVALGE
HHRKHAA-----------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------