Loading Multiple Sequence Alignment....


Raw alignment output
MUSCLE (3.8) multiple sequence alignment


SPRG_12883        ----MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAV
SDRG_14912        ----MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAV
H257_07358        ---MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAI
H310_07567        ---MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAI
CCA17521          ----MERTQIFGLYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASAN
CCI44232          ----MERAQIFGLYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASAN
PYAP_22846        ---MADKQKVLRLYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQ
PYAR_23207        MTKPATSREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQ
PYU1_G005963      ---MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSAR
PYIR_15186        ---MAEAKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSAR
PYIW_14743        ---MAEAKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSAR
PYVX_20854        ---MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAAR
HYAP_08499        ---MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQ
PHALS_11564       ---MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAH
PHYKE_5841        ---MAEVKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASAR
PITG_13739        ---MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVR
PPTG_09252        ---MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVR
PHYRA_81675       ---MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVR
PHYCA_535380      ---MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVR
PHYSO_315017      ---MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVR
                           :  :**.:*.** .:**:*.  :: :*. **.     :    :   :  . 

SPRG_12883        KGIEQLGQYVHLDPTAHSWTVEMEKDPFGQNQP---RPADVRVVTPPKQSEP--------
SDRG_14912        KGIEQLGQYVHLDPTAHSWTVEMEKDPFGQNQP---RPADVRVVTPPKPSEV--------
H257_07358        KGIQQLNQYVALDPNAQSWSVDMDKDPFGQNHPDRPASINP-------------------
H310_07567        KGIQQLNQYVSLDPNAQHWSVDMEKDPFGQNHPDRPQSLKR-------------------
CCA17521          AGIKELLMYANLNPVDPNWTVEIGRPSEK--PADMDRDVKIKAKRVGVKN----------
CCI44232          AGIKELMMYANLNPVEANWTVEIGRPSEKA-ADIDQKRVEMKEKRVGVEK----------
PYAP_22846        AGIKELSMYATLNPSSTAWTVGVGREVSPE-ATQAAGDTNTKVVGNKQ------------
PYAR_23207        AGIKELSQYASLRSDAMSWTVDVGREVEPRQPASEKEQPTFKVVGDDTRNKQ--------
PYU1_G005963      QGIVELSQYTNLNPSSMTWKVDVGREVGQG-PPAGGPVVNAKVVGEK-------------
PYIR_15186        QGIVELSQYTNLNPSSMTWKVDVGREVGLGAGPAVSQGVSAKVVGSGGKDHQ--------
PYIW_14743        QGIVELSQYTNLNPSSMTWKVDVGREVGVG-GPAIGQGVSTKVVGGKEH-----------
PYVX_20854        AGIQELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGI--KTVGGKRE-----------
HYAP_08499        AGIKELSMYASLHPSLPNWNIEVGHDVAPM-PFDVQSGDDVKDIGGGEMKKE--------
PHALS_11564       AGIKELSMYASLHPSQPNWSVEVGRDAIQ---SQLREGSQVKVVRDGNKAVKK-------
PHYKE_5841        AGIKELSQYASLHPSSVNWSIEVGRDAIQS-PPPVHGGVNAKVVGVRCVYEVVRMWQLQP
PITG_13739        AGITELSMYASLHPSLPNWSVEVGRDAIH--PPPMHGGVKTKVVSADKKE----------
PPTG_09252        AGITELSMYASLHPSLPNWSVEVGRDAIQ--PPPVHGGVNAKIISGGKKE----------
PHYRA_81675       AGIKELSMYASLHPSLPNWSVEVGRDAIQP-PPPVHGGVSAKVVGDDKLE----------
PHYCA_535380      AGIKELSMYANLHPSLPNWSVEVGRDAIQP-PPPVHGGVSAKVVGDGKKESS--------
PHYSO_315017      AGIKELSMYASLHPSLPNWSVEVGRDAIQP-PPPVHGGVNAKVVGDGNKDSSN-------
                   ** :*  *. * .    *.: : .                                   

SPRG_12883        -----
SDRG_14912        -----
H257_07358        -----
H310_07567        -----
CCA17521          -----
CCI44232          -----
PYAP_22846        -----
PYAR_23207        -----
PYU1_G005963      -----
PYIR_15186        -----
PYIW_14743        -----
PYVX_20854        -----
HYAP_08499        -----
PHALS_11564       -----
PHYKE_5841        PSVPG
PITG_13739        -----
PPTG_09252        -----
PHYRA_81675       -----
PHYCA_535380      -----
PHYSO_315017      -----
                       

FASTA format
>SPRG_12883
----MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAV
KGIEQLGQYVHLDPTAHSWTVEMEKDPFGQNQP---RPADVRVVTPPKQSEP--------
-----
>SDRG_14912
----MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAV
KGIEQLGQYVHLDPTAHSWTVEMEKDPFGQNQP---RPADVRVVTPPKPSEV--------
-----
>H257_07358
---MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAI
KGIQQLNQYVALDPNAQSWSVDMDKDPFGQNHPDRPASINP-------------------
-----
>H310_07567
---MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAI
KGIQQLNQYVSLDPNAQHWSVDMEKDPFGQNHPDRPQSLKR-------------------
-----
>CCA17521
----MERTQIFGLYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASAN
AGIKELLMYANLNPVDPNWTVEIGRPSEK--PADMDRDVKIKAKRVGVKN----------
-----
>CCI44232
----MERAQIFGLYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASAN
AGIKELMMYANLNPVEANWTVEIGRPSEKA-ADIDQKRVEMKEKRVGVEK----------
-----
>PYAP_22846
---MADKQKVLRLYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQ
AGIKELSMYATLNPSSTAWTVGVGREVSPE-ATQAAGDTNTKVVGNKQ------------
-----
>PYAR_23207
MTKPATSREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQ
AGIKELSQYASLRSDAMSWTVDVGREVEPRQPASEKEQPTFKVVGDDTRNKQ--------
-----
>PYU1_G005963
---MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSAR
QGIVELSQYTNLNPSSMTWKVDVGREVGQG-PPAGGPVVNAKVVGEK-------------
-----
>PYIR_15186
---MAEAKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSAR
QGIVELSQYTNLNPSSMTWKVDVGREVGLGAGPAVSQGVSAKVVGSGGKDHQ--------
-----
>PYIW_14743
---MAEAKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSAR
QGIVELSQYTNLNPSSMTWKVDVGREVGVG-GPAIGQGVSTKVVGGKEH-----------
-----
>PYVX_20854
---MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAAR
AGIQELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGI--KTVGGKRE-----------
-----
>HYAP_08499
---MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQ
AGIKELSMYASLHPSLPNWNIEVGHDVAPM-PFDVQSGDDVKDIGGGEMKKE--------
-----
>PHALS_11564
---MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAH
AGIKELSMYASLHPSQPNWSVEVGRDAIQ---SQLREGSQVKVVRDGNKAVKK-------
-----
>PHYKE_5841
---MAEVKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASAR
AGIKELSQYASLHPSSVNWSIEVGRDAIQS-PPPVHGGVNAKVVGVRCVYEVVRMWQLQP
PSVPG
>PITG_13739
---MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVR
AGITELSMYASLHPSLPNWSVEVGRDAIH--PPPMHGGVKTKVVSADKKE----------
-----
>PPTG_09252
---MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVR
AGITELSMYASLHPSLPNWSVEVGRDAIQ--PPPVHGGVNAKIISGGKKE----------
-----
>PHYRA_81675
---MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVR
AGIKELSMYASLHPSLPNWSVEVGRDAIQP-PPPVHGGVSAKVVGDDKLE----------
-----
>PHYCA_535380
---MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVR
AGIKELSMYANLHPSLPNWSVEVGRDAIQP-PPPVHGGVSAKVVGDGKKESS--------
-----
>PHYSO_315017
---MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVR
AGIKELSMYASLHPSLPNWSVEVGRDAIQP-PPPVHGGVNAKVVGDGNKDSSN-------
-----