Loading Multiple Sequence Alignment....


Raw alignment output
MUSCLE (3.8) multiple sequence alignment


CCA15845          ------------------------------------------------------------
CCI42280          ------------------------------------------------------------
PYAR_24476        ------------------------------------------------------------
PYIR_14437        ------------------------------------------------------------
PYU1_G005989      ------------------------------------------------------------
PHALS_11795       ------------------------------------------------------------
PHYKE_5842        MSSRNNSNVGSGRRGPRREQVACGTSVEQVLLWYDDESQQTCPIYVKEDATEVDASPSAS
HYAP_08503        MNKKDGYNECTYTTSPDFTLHSNIFHATLIQSRRNQYLRLSLPMYPSIKLLYLFIPQSSQ
PHYRA_51797       ------------------------------------------------------------
PITG_13737        ------------------------------------------------------------
PPTG_09250        ------------------------------------------------------------
PHYCA_508469      ------------------------------------------------------------
PHYSO_501475      ------------------------------------------------------------
                                                                              

CCA15845          ------------------------------------------------------------
CCI42280          ------------------------------------------------------------
PYAR_24476        ------------------------------------------------------------
PYIR_14437        ------------------------------------------------------------
PYU1_G005989      ------------------------------------------------------------
PHALS_11795       ------------------------------------------------------------
PHYKE_5842        SSALRSPEAAAFAERKRTRKLPSVNDADATYSRILESTPEYLKELLYSEMRDLQSMDAEF
HYAP_08503        CHTPKNTRSFPLSP----------------------------------------------
PHYRA_51797       ------------------------------------------------------------
PITG_13737        ------------------------------------------------------------
PPTG_09250        ------------------------------------------------------------
PHYCA_508469      ------------------------------------------------------------
PHYSO_501475      ------------------------------------------------------------
                                                                              

CCA15845          ------------------------------------------------------------
CCI42280          ------------------------------------------------------------
PYAR_24476        ------------------------------------------------------------
PYIR_14437        ------------------------------------------------------------
PYU1_G005989      ------------------------------------------------------------
PHALS_11795       ------------------------------------------------------------
PHYKE_5842        RSSGDVDNLPFVEEAMRNTSGRLAKSGDFAQGTHGGHHAANHANSTSGVSKEKTHHENDL
HYAP_08503        ------------------------------------------------------------
PHYRA_51797       ------------------------------------------------------------
PITG_13737        ------------------------------------------------------------
PPTG_09250        ------------------------------------------------------------
PHYCA_508469      ------------------------------------------------------------
PHYSO_501475      ------------------------------------------------------------
                                                                              

CCA15845          ------------------------------------------------------------
CCI42280          ------------------------------------------------------------
PYAR_24476        ------------------------------------------------------------
PYIR_14437        ------------------------------------------------------------
PYU1_G005989      ------------------------------------------------------------
PHALS_11795       ------------------------------------------------------------
PHYKE_5842        TSQLSPSTLNCFHNELKKRVKHRKHKLKLQNTAAPSSPIYKSSAAAFSLEEEGASWPALE
HYAP_08503        ------------------------------------------------------------
PHYRA_51797       ------------------------------------------------------------
PITG_13737        ------------------------------------------------------------
PPTG_09250        ------------------------------------------------------------
PHYCA_508469      ------------------------------------------------------------
PHYSO_501475      ------------------------------------------------------------
                                                                              

CCA15845          ------------------------------------------------------------
CCI42280          ------------------------------------------------------------
PYAR_24476        ------------------------------------------------------------
PYIR_14437        ------------------------------------------------------------
PYU1_G005989      ------------------------------------------------------------
PHALS_11795       ------------------------------------------------------------
PHYKE_5842        EALAESLADFTLAGTKLDDERHAAPSLHSTDQEGSFARVTENSGYFPALGSEAGESRAHG
HYAP_08503        ------------------------------------------------------------
PHYRA_51797       ------------------------------------------------------------
PITG_13737        ------------------------------------------------------------
PPTG_09250        ------------------------------------------------------------
PHYCA_508469      ------------------------------------------------------------
PHYSO_501475      ------------------------------------------------------------
                                                                              

CCA15845          --------------------------------------------------MVKIAIIYYS
CCI42280          --------------------------------------------------MVKIAIIYYS
PYAR_24476        ------------------------------------------------------------
PYIR_14437        --------------------------------------------------MTNVAIIYYS
PYU1_G005989      --------------------------------------------------MTKIAIVYYS
PHALS_11795       ------------------------------------------------------------
PHYKE_5842        TASGPFGFGSPSAWGSANPSTSPPGWDLKKAEAHSGILSVKLKTLPSNITMTKIAIIYYS
HYAP_08503        ---------------------------------------------PRPPTMTKIAIIYYS
PHYRA_51797       --------------------------------------------------MTNIAIIYYS
PITG_13737        --------------------------------------------------MTKIAIIYYS
PPTG_09250        --------------------------------------------------MTKIAIIYYS
PHYCA_508469      --------------------------------------------------MTNIAIIYYS
PHYSO_501475      --------------------------------------------------MTNVAIIYYS
                                                                              

CCA15845          TYGHVARLAETVKEGCELVTGVTAEIYQVAETLSDDVLAKMHAPPKKEHPIASMDVLKDA
CCI42280          TYGHVARLAETVKEGCELVTGVSADIYQVAETLTDDVLSKMHAPPKKEYPIATMDVLKDA
PYAR_24476        ----------------------------------------MHAAPKKDHPIITPEILAAA
PYIR_14437        TYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIATPDVLKEA
PYU1_G005989      TYGHIAKMAESVKEGVESVEGVTAEIYQVQETLSEDVLAKLYAAPKKDHPIATPDVLKEA
PHALS_11795       -------MAESVKSGVESVDGVTAEIYQVEETLSDETLSKMHAPSKKDHPIATPDVLKEA
PHYKE_5842        TYSHIAKMAESIKEGVESVSGTTAEVYQIQETLPEEILAKMHAPPKKDHPVATPDILKNA
HYAP_08503        TYGHIAKMAESIKAGVESVAGATADVYQVQETLSDEVLSKMHAPSKQDHPVATPDVLKNA
PHYRA_51797       TYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVATPDVLKNA
PITG_13737        TYGHIATMAESIKKGVESVDGVTAEIYQVQETLSEEILTKMHAPPKKDHPVATPDTIKNA
PPTG_09250        TYGHIATMAESVKKGVESVDGVTAEVYQVQETLSEEILTKMHAPPKKDHPVATPDILKNA
PHYCA_508469      TYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVATPDILKNA
PHYSO_501475      TYGHIATMAESVKEGVESVEGVTAEIYQVQETLSEEILGKMHAPPKKDYPVATPDVLKNA
                                                          ::*..*.::*: : : :  *

CCA15845          DGILFGMPTRFGLVPAQMKAYFDMAGQLWQNGCTIGKPAGVFFSTATPGGGQETTAFTCL
CCI42280          DGILFGFPTRFGLVPAQMKAYFDMAGQLWQSGCTIGKPAGLFFSTGTPGGGQETTAFTCI
PYAR_24476        DGVLFGIPTRFGSMPAQVKAFFDSCGGLWAKGGLVGKPAGMFFSTGTLGGGQETTVMSSL
PYIR_14437        DGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQETTAFTSL
PYU1_G005989      DGILFGFPTRFGSFPAQVKALFDSTGGLWSTGALVGKPAGIFFSTGTQGGGQETTAFTTL
PHALS_11795       NGILFGIPTRFGLVPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTMGGGQETTAFTTL
PHYKE_5842        DGVLFGIPTRFGSMPAQVKALFDACGGLWASGGLVGKPAGIFFSTGTMGGGQETTAFTTI
HYAP_08503        DGVLLGIPTRFGSMPAQVKALFDACGGLWTAGALVGKPAGIFFSTGTQGGGQETTAFTTV
PHYRA_51797       DGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQETTAFTTL
PITG_13737        DGVLFGIPTRFGSFPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTLGGGQETTAFTAV
PPTG_09250        DGVLLGFPTRFGSMPAQVKALFDACGGLWAGGALVGKPAGIFFSTGTLGGGQETTAFTSV
PHYCA_508469      DGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTIGGGQETTAFTSV
PHYSO_501475      DGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPVGIFFSTGTQGGGQETTAFTSV
                  :*:*:*:***** .*:*:** **  * **  *  :***.*:****.  *.*****.:: :

CCA15845          PFLTHLGMVFVPLGYRSPLLSNLDEVHGGSAWGAGTLAGADGSRQASKLELEVAKVQGES
CCI42280          PFLTHLGMVFVPLGYRSPLLGNLDEVHGGSAWGAGTLAGPDGSRQPSKLELDVAKVQGES
PYAR_24476        TFLTHHGMSFVPLGYRSPLLFNLEEIHGGSPWGAGTLAGADGSRQPSTLELDVAKVQGET
PYIR_14437        TFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGES
PYU1_G005989      TFLAHQGLTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLELDVAKVQGES
PHALS_11795       TFLTHQGMTFVPLGYRSKHLLNMDEIHGGSPWGAGTFAGPSGARQPTQLELDVAKAQGES
PHYKE_5842        TFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSTLELDVAKKQGES
HYAP_08503        TFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGNLAGTDGSRQPSQLEKDVAKVQGES
PHYRA_51797       TFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGES
PITG_13737        TFLTHQGMSFVPLGYRSPLLFNLDEIHGGSPWGAGTIAGGDGSRQPSKLELDVAKAQGES
PPTG_09250        TFLTHQGMTFVPLGYRSPLLFNLEEIHGGSPWGAGTIAGGDGSRQPSQLELDVAKVQGES
PHYCA_508469      TFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGES
PHYSO_501475      TFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGES
                  .**:* *: :*******  * *::*:****.****. ** .*:**.: ** :*** ***:

CCA15845          FASVTRKLAA--------------------------------------------------
CCI42280          FAAVTRKLAA--------------------------------------------------
PYAR_24476        FAQVAQKLAAKPEEAPAAAEVPAAEPVAPVAEPVNEPEATVEVEKPVAEVPAVPSEEPKK
PYIR_14437        FAQIAKKLAA--------------------------------------------------
PYU1_G005989      FAQVAKKLSA--------------------------------------------------
PHALS_11795       FAVVAKKLSA--------------------------------------------------
PHYKE_5842        FAEVAKKLSA--------------------------------------------------
HYAP_08503        FAQVAKKLSSA-------------------------------------------------
PHYRA_51797       FAGVAKKLS---------------------------------------------------
PITG_13737        FAGVAKKLS---------------------------------------------------
PPTG_09250        FAGVAKKLSA--------------------------------------------------
PHYCA_508469      FATVAKKLSA--------------------------------------------------
PHYSO_501475      FAGVAKKLSA--------------------------------------------------
                  ** ::.**:                                                   

CCA15845          -------------
CCI42280          -------------
PYAR_24476        KASFFRRLFCMAE
PYIR_14437        -------------
PYU1_G005989      -------------
PHALS_11795       -------------
PHYKE_5842        -------------
HYAP_08503        -------------
PHYRA_51797       -------------
PITG_13737        -------------
PPTG_09250        -------------
PHYCA_508469      -------------
PHYSO_501475      -------------
                               

FASTA format
>CCA15845
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MVKIAIIYYS
TYGHVARLAETVKEGCELVTGVTAEIYQVAETLSDDVLAKMHAPPKKEHPIASMDVLKDA
DGILFGMPTRFGLVPAQMKAYFDMAGQLWQNGCTIGKPAGVFFSTATPGGGQETTAFTCL
PFLTHLGMVFVPLGYRSPLLSNLDEVHGGSAWGAGTLAGADGSRQASKLELEVAKVQGES
FASVTRKLAA--------------------------------------------------
-------------
>CCI42280
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MVKIAIIYYS
TYGHVARLAETVKEGCELVTGVSADIYQVAETLTDDVLSKMHAPPKKEYPIATMDVLKDA
DGILFGFPTRFGLVPAQMKAYFDMAGQLWQSGCTIGKPAGLFFSTGTPGGGQETTAFTCI
PFLTHLGMVFVPLGYRSPLLGNLDEVHGGSAWGAGTLAGPDGSRQPSKLELDVAKVQGES
FAAVTRKLAA--------------------------------------------------
-------------
>PYAR_24476
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------MHAAPKKDHPIITPEILAAA
DGVLFGIPTRFGSMPAQVKAFFDSCGGLWAKGGLVGKPAGMFFSTGTLGGGQETTVMSSL
TFLTHHGMSFVPLGYRSPLLFNLEEIHGGSPWGAGTLAGADGSRQPSTLELDVAKVQGET
FAQVAQKLAAKPEEAPAAAEVPAAEPVAPVAEPVNEPEATVEVEKPVAEVPAVPSEEPKK
KASFFRRLFCMAE
>PYIR_14437
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTNVAIIYYS
TYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIATPDVLKEA
DGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQETTAFTSL
TFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGES
FAQIAKKLAA--------------------------------------------------
-------------
>PYU1_G005989
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTKIAIVYYS
TYGHIAKMAESVKEGVESVEGVTAEIYQVQETLSEDVLAKLYAAPKKDHPIATPDVLKEA
DGILFGFPTRFGSFPAQVKALFDSTGGLWSTGALVGKPAGIFFSTGTQGGGQETTAFTTL
TFLAHQGLTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLELDVAKVQGES
FAQVAKKLSA--------------------------------------------------
-------------
>PHALS_11795
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MAESVKSGVESVDGVTAEIYQVEETLSDETLSKMHAPSKKDHPIATPDVLKEA
NGILFGIPTRFGLVPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTMGGGQETTAFTTL
TFLTHQGMTFVPLGYRSKHLLNMDEIHGGSPWGAGTFAGPSGARQPTQLELDVAKAQGES
FAVVAKKLSA--------------------------------------------------
-------------
>PHYKE_5842
MSSRNNSNVGSGRRGPRREQVACGTSVEQVLLWYDDESQQTCPIYVKEDATEVDASPSAS
SSALRSPEAAAFAERKRTRKLPSVNDADATYSRILESTPEYLKELLYSEMRDLQSMDAEF
RSSGDVDNLPFVEEAMRNTSGRLAKSGDFAQGTHGGHHAANHANSTSGVSKEKTHHENDL
TSQLSPSTLNCFHNELKKRVKHRKHKLKLQNTAAPSSPIYKSSAAAFSLEEEGASWPALE
EALAESLADFTLAGTKLDDERHAAPSLHSTDQEGSFARVTENSGYFPALGSEAGESRAHG
TASGPFGFGSPSAWGSANPSTSPPGWDLKKAEAHSGILSVKLKTLPSNITMTKIAIIYYS
TYSHIAKMAESIKEGVESVSGTTAEVYQIQETLPEEILAKMHAPPKKDHPVATPDILKNA
DGVLFGIPTRFGSMPAQVKALFDACGGLWASGGLVGKPAGIFFSTGTMGGGQETTAFTTI
TFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSTLELDVAKKQGES
FAEVAKKLSA--------------------------------------------------
-------------
>HYAP_08503
MNKKDGYNECTYTTSPDFTLHSNIFHATLIQSRRNQYLRLSLPMYPSIKLLYLFIPQSSQ
CHTPKNTRSFPLSP----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------PRPPTMTKIAIIYYS
TYGHIAKMAESIKAGVESVAGATADVYQVQETLSDEVLSKMHAPSKQDHPVATPDVLKNA
DGVLLGIPTRFGSMPAQVKALFDACGGLWTAGALVGKPAGIFFSTGTQGGGQETTAFTTV
TFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGNLAGTDGSRQPSQLEKDVAKVQGES
FAQVAKKLSSA-------------------------------------------------
-------------
>PHYRA_51797
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTNIAIIYYS
TYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHPVATPDVLKNA
DGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGGGQETTAFTTL
TFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGES
FAGVAKKLS---------------------------------------------------
-------------
>PITG_13737
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTKIAIIYYS
TYGHIATMAESIKKGVESVDGVTAEIYQVQETLSEEILTKMHAPPKKDHPVATPDTIKNA
DGVLFGIPTRFGSFPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTLGGGQETTAFTAV
TFLTHQGMSFVPLGYRSPLLFNLDEIHGGSPWGAGTIAGGDGSRQPSKLELDVAKAQGES
FAGVAKKLS---------------------------------------------------
-------------
>PPTG_09250
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTKIAIIYYS
TYGHIATMAESVKKGVESVDGVTAEVYQVQETLSEEILTKMHAPPKKDHPVATPDILKNA
DGVLLGFPTRFGSMPAQVKALFDACGGLWAGGALVGKPAGIFFSTGTLGGGQETTAFTSV
TFLTHQGMTFVPLGYRSPLLFNLEEIHGGSPWGAGTIAGGDGSRQPSQLELDVAKVQGES
FAGVAKKLSA--------------------------------------------------
-------------
>PHYCA_508469
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTNIAIIYYS
TYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYPVATPDILKNA
DGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTIGGGQETTAFTSV
TFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKVQGES
FATVAKKLSA--------------------------------------------------
-------------
>PHYSO_501475
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTNVAIIYYS
TYGHIATMAESVKEGVESVEGVTAEIYQVQETLSEEILGKMHAPPKKDYPVATPDVLKNA
DGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPVGIFFSTGTQGGGQETTAFTSV
TFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGADGSRQPSKLELDVAKVQGES
FAGVAKKLSA--------------------------------------------------
-------------