Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PYAR:PYAR_13570:PYAR_13569:scaffold_29:17128:1834217741078820.048
PHIF:PITG_02427:PITG_02428:NW_003303756.1:2041179:204171631544945649.9
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= SDRG_01782

Length=123
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAR:PYAR_13570:PYAR_13569:scaffold_29:17128:18342                    36.2       0.048
PHIF:PITG_02427:PITG_02428:NW_003303756.1:2041179:2041716             29.3       9.9  

>PYAR:PYAR_13570:PYAR_13569:scaffold_29:17128:18342
Length=1214

 Score = 36.2 bits (82),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 36/78 (46%), Gaps = 24/78 (31%)
 Frame = -1

Query  27   TLEKVRHEFRAHEGAATPE-----------------------ELDQLLRKAQSKISYLKI  63
            TL+++R EFR+    + P+                        +  L+ +AQSKI YLKI
Sbjct  410  TLQQIRSEFRSSGDLSDPKACVLILFPPALLGVPLTIGGALRSVAALVLRAQSKIGYLKI  231

Query  64   VTPKKSSSSTQ-GSHFVY  80
            VTP+ +S   Q G   +Y
Sbjct  230  VTPRATSGMVQ*GVSCLY  177

>PHIF:PITG_02427:PITG_02428:NW_003303756.1:2041179:2041716
Length=537

 Score = 29.3 bits (64),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = +3

Query  71   SSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVR  115
            S  +G   +YK  Q++DGR + +D   +K   Y  +  +H QL R
Sbjct  315  SFHRGLSLLYKYHQQLDGRGIHSDKLMMKHFRYLKLQHQHSQLWR  449

Lambda      K        H        a         alpha
   0.315    0.126    0.341    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5113729264

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40