Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:1050931171601224e-07
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:722375114933830.10
PHRA:PHYRA_74543:PHYRA_74544:scaffold_8:533668:53411312521130745.4
PHSO:PHYSO_247875:PHYSO_318422:scaffold_9:1713644:17204333860398542786.1
HYAP:HYAP_09436:HYAP_09437:scaffold_101:61070:84016227892291743786.2
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PYU1_G001734

Length=800
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093               51.6       4e-07
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237                    36.6       0.10 
PHRA:PHYRA_74543:PHYRA_74544:scaffold_8:533668:534113                 33.1       5.4  
PHSO:PHYSO_247875:PHYSO_318422:scaffold_9:1713644:1720433             34.7       6.1  
HYAP:HYAP_09436:HYAP_09437:scaffold_101:61070:84016                   34.7       6.2  

>PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093
Length=226

 Score = 51.6 bits (122),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +1

Query  736  AALGFLRTALEVIGREVGTQALTDDLRGGGDCESGNFAEVLTVVRTLTGGKSAKLEKIRR  795
             AL FLRTALEVIGREVG  A  +         SGNFA VL+ VR  TGGK  +L K+RR
Sbjct  1    GALAFLRTALEVIGREVG--ATIEMSSSTSRPVSGNFAHVLSAVRAATGGKD-RLGKMRR  171

>PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237
Length=236

 Score = 36.6 bits (83),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 22/33 (67%), Gaps = 1/33 (3%)
 Frame = +3

Query  766  DCESGNFAEVLTVVRTLT-GGKSAKLEKIRRLR  797
               SGNFA+VL+ +R  T GGK  +L K RRLR
Sbjct  51   SAHSGNFAQVLSAIRASTGGGKGDRLGKARRLR  149

>PHRA:PHYRA_74543:PHYRA_74544:scaffold_8:533668:534113
Length=445

 Score = 33.1 bits (74),  Expect = 5.4, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 22/30 (73%), Gaps = 1/30 (3%)
 Frame = -1

Query  529  GYAFPQTTAPYEAIRGASMAIGKVLVDDSV  558
            G  F Q TAP + +RGA+M +GK++VD+ +
Sbjct  211  GLRFSQATAPQQPLRGAAM-MGKIIVDNGL  125

>PHSO:PHYSO_247875:PHYSO_318422:scaffold_9:1713644:1720433
Length=6789

 Score = 34.7 bits (78),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 0/42 (0%)
 Frame = -3

Query  122   RKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAY  163
             R  RAA+ IQ VFR +  ++   R R  + + + IQ +WR Y
Sbjct  3985  RNHRAAVLIQRVFRGYLGRQAAKRRRWEMHAALQIQTIWRGY  3860

>HYAP:HYAP_09436:HYAP_09437:scaffold_101:61070:84016
Length=22946

 Score = 34.7 bits (78),  Expect = 6.2, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 24/43 (56%), Gaps = 0/43 (0%)
 Frame = -3

Query  674    YAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTIFML  716
              ++ ++YI   NVST+     +HTC L G  F ++  F  +F L
Sbjct  22917  FSRSKYILENNVSTLGLFVLYHTCSLDGTTFVMDSVFFFVFYL  22789

Lambda      K        H        a         alpha
   0.323    0.137    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 116643875712

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40