Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
ALCA:CCI45122:CCI45123:scaffold_90:8389:8676191280301522e-11
PLHA:PHALS_06429:PHALS_06430:NW_020189861.1:1584479:158992023692611991122e-04
PHCA:PHYCA_505427:PHYCA_505430:scaffold_13:335559:345223660369471331112e-04
HYAP:HYAP_00251:HYAP_00252:scaffold_1:1195367:11956131111535890.006
PHKE:PHYKE_2539:PHYKE_4609:scaffold_206:3712:95271807194148870.16
APIN:H310_04844:H310_04845:scaffold_8:304741:3079402552272861850.26
PHCA:PHYCA_506484:PHYCA_111309:scaffold_20:128465:1304671513161135820.58
PHKE:PHYKE_4908:PHYKE_4909:scaffold_269:9588:130031741185438820.59
PHCA:PHYCA_548122:PHYCA_507454:scaffold_27:526448:5314171277145661782.0
PHSO:PHYSO_354313:PHYSO_354314:scaffold_3:3933721:393545282391832772.0
PHCA:PHYCA_127887:PHYCA_510981:scaffold_72:70171:7345173382832745.8
PHIF:PITG_09039:PITG_09040:NW_003303743.1:2501121:25239827020746737.3
PYIR:PYIR_13555:PYIR_13563:scaffold_12:81537:901086636673433737.4
PHCA:PHYCA_9865:PHYCA_535841:scaffold_42:346165:3554773840393835738.0
PHKE:PHYKE_5585:PHYKE_5586:scaffold_223:50056:558501667176535738.2
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PYIR_13451

Length=359
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

ALCA:CCI45122:CCI45123:scaffold_90:8389:8676                          63.2       2e-11
PLHA:PHALS_06429:PHALS_06430:NW_020189861.1:1584479:1589920           47.8       2e-04
PHCA:PHYCA_505427:PHYCA_505430:scaffold_13:335559:345223              47.4       2e-04
HYAP:HYAP_00251:HYAP_00252:scaffold_1:1195367:1195613                 38.9       0.006
PHKE:PHYKE_2539:PHYKE_4609:scaffold_206:3712:9527                     38.1       0.16 
APIN:H310_04844:H310_04845:scaffold_8:304741:307940                   37.4       0.26 
PHCA:PHYCA_506484:PHYCA_111309:scaffold_20:128465:130467              36.2       0.58 
PHKE:PHYKE_4908:PHYKE_4909:scaffold_269:9588:13003                    36.2       0.59 
PHCA:PHYCA_548122:PHYCA_507454:scaffold_27:526448:531417              34.7       2.0  
PHSO:PHYSO_354313:PHYSO_354314:scaffold_3:3933721:3935452             34.3       2.0  
PHCA:PHYCA_127887:PHYCA_510981:scaffold_72:70171:73451                33.1       5.8  
PHIF:PITG_09039:PITG_09040:NW_003303743.1:2501121:2523982             32.7       7.3  
PYIR:PYIR_13555:PYIR_13563:scaffold_12:81537:90108                    32.7       7.4  
PHCA:PHYCA_9865:PHYCA_535841:scaffold_42:346165:355477                32.7       8.0  
PHKE:PHYKE_5585:PHYKE_5586:scaffold_223:50056:55850                   32.7       8.2  

>ALCA:CCI45122:CCI45123:scaffold_90:8389:8676
Length=287

 Score = 63.2 bits (152),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNG  52
            ++ PTSCEGYVTKRGHFRKSWRVRYLV  G
Sbjct  191  RYTPTSCEGYVTKRGHFRKSWRVRYLVICG  280

>PLHA:PHALS_06429:PHALS_06430:NW_020189861.1:1584479:1589920
Length=5441

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 18/99 (18%)
 Frame = +2

Query  25    KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
             +P +C GY+TK+GH RKSW+ RY +  G    ++YY   D +  +       V       
Sbjct  2369  EPVACAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVL------  2524

Query  85    YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELD  123
                 VE  + W G      +PFGF  V +     Y+  D
Sbjct  2525  ----VEDVQKWEG------EPFGFMFVTNEQVPYYVYAD  2611

 Score = 42.4 bits (98),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 27/43 (63%), Gaps = 5/43 (12%)
 Frame = +2

Query  28    SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
             SCEGY+TKRGH   S R+ Y V NG +L     Q AY +++ A
Sbjct  2078  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYTDQQAYRDNQSA  2206

 Score = 40.8 bits (94),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)
 Frame = +2

Query  29    CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
             CEGY+TKRGH   +W+ RY    G  L+  Y+ S +
Sbjct  1796  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YFSSEE  1897

>PHCA:PHYCA_505427:PHYCA_505430:scaffold_13:335559:345223
Length=9664

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (44%), Gaps = 24/133 (18%)
 Frame = +3

Query  25    KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
             +P SC GY+TK+GH RKSW+ RY +  G    ++YY   D +  +       V       
Sbjct  6603  EPVSCAGYLTKQGHKRKSWKKRYFILRGHT--ISYYSDYDMANNAKGKPLAEVM------  6758

Query  85    YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELD------IFVESLGDLNKWVEV  138
                 VE  + W G      +PFGF  + +     Y+  D       ++ +L  L +W   
Sbjct  6759  ----VEDVQKWDG------EPFGFMFMTNEQVPYYVYADNDRERSKWMNALNKLMQWRRS  6908

Query  139   VQNALDAAKKRSR  151
              ++   AA+  +R
Sbjct  6909  PRSRKSAARTVTR  6947

 Score = 41.6 bits (96),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (6%)
 Frame = +3

Query  29    CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
             CEGY+TKRGH   +W+ RY    G  L+  YY S +
Sbjct  6030  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSEE  6131

 Score = 40.8 bits (94),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  28    SCEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
             SCEGY+TKRGH   S R+ Y V NG +L+
Sbjct  6312  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  6398

>HYAP:HYAP_00251:HYAP_00252:scaffold_1:1195367:1195613
Length=246

 Score = 38.9 bits (89),  Expect = 0.006, Method: Composition-based stats.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = +2

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGYVTKRGH  ++W++R+    G  L    Y  R+
Sbjct  11   EGYVTKRGHLVRNWKMRFFTLEGNLLSCT*YRDRE  115

>PHKE:PHYKE_2539:PHYKE_4609:scaffold_206:3712:9527
Length=5815

 Score = 38.1 bits (87),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = -2

Query  13    TSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
             TSG++    D F   S  G++ KRGH RK+W+ RY V   + L+  YY
Sbjct  1941  TSGTSSAFDDAFL-DSMSGWLRKRGHVRKNWKARYFVLEKSVLR--YY  1807

>APIN:H310_04844:H310_04845:scaffold_8:304741:307940
Length=3199

 Score = 37.4 bits (85),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 6/61 (10%)
 Frame = -1

Query  8     DAKLATSGSNGGAGDKFKPTS----CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
             +A  +   S  GA  +  P +     EGYV K+G +   W  RYLV +GA+L   YY S+
Sbjct  2728  EASRSQPSSLKGATSRPPPPTHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNSK  2555

Query  64    D  64
             +
Sbjct  2554  E  2552

>PHCA:PHYCA_506484:PHYCA_111309:scaffold_20:128465:130467
Length=2002

 Score = 36.2 bits (82),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 2/35 (6%)
 Frame = -2

Query  30    EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
             EGYV K+G +   W  RYL+ +GA L   YY S++
Sbjct  1611  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKE  1513

>PHKE:PHYKE_4908:PHYKE_4909:scaffold_269:9588:13003
Length=3415

 Score = 36.2 bits (82),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (58%), Gaps = 0/38 (0%)
 Frame = +1

Query  19    GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
             GAG ++    CEG++ K G   K+W+ RY+  +   L+
Sbjct  1741  GAGQRYSTAVCEGWLDKLGQHSKTWKKRYVALSNGMLE  1854

>PHCA:PHYCA_548122:PHYCA_507454:scaffold_27:526448:531417
Length=4969

 Score = 34.7 bits (78),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 8/61 (13%)
 Frame = +2

Query  10    KLATSGSNGGAGDKFKPTSCE-------GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
             +L   GS+    D F  T  +       G++TK+GH  KSW+ R+ V   ++   AYY++
Sbjct  1277  RLVRHGSDPLLNDNFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKN  1453

Query  63    R  63
             +
Sbjct  1454  K  1456

>PHSO:PHYSO_354313:PHYSO_354314:scaffold_3:3933721:3935452
Length=1731

 Score = 34.3 bits (77),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = -1

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G F KSWR R+ +       + YY S
Sbjct  918  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  823

>PHCA:PHYCA_127887:PHYCA_510981:scaffold_72:70171:73451
Length=3280

 Score = 33.1 bits (74),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +1

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G F KSW+ R+ +       + YY S
Sbjct  733  GYLVKQGSFWKSWKRRFFILRRDRPVLCYYTS  828

>PHIF:PITG_09039:PITG_09040:NW_003303743.1:2501121:2523982
Length=22861

 Score = 32.7 bits (73),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = -2

Query  12   ATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQV  57
            +T G + GA +        G + KRG F K+W  R+LV +   LQV
Sbjct  207  STGGVSAGANNVGHEVILSGALNKRGQFFKAWLPRHLVLSRGALQV  70

>PYIR:PYIR_13555:PYIR_13563:scaffold_12:81537:90108
Length=8571

 Score = 32.7 bits (73),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 18/33 (55%), Gaps = 0/33 (0%)
 Frame = -2

Query  27    TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAY  59
             T+CEG++ K+G   K W+ RY       L+  Y
Sbjct  6734  TTCEGWLLKQGRTSKQWKKRYFTLTNDLLEYRY  6636

>PHCA:PHYCA_9865:PHYCA_535841:scaffold_42:346165:355477
Length=9312

 Score = 32.7 bits (73),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 20/35 (57%), Gaps = 2/35 (6%)
 Frame = -2

Query  30    EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
             EGY+ KRGH   S R RY V  G  L  +YY + D
Sbjct  3938  EGYLMKRGHKIPSMRKRYCVLIGNEL--SYYVTHD  3840

>PHKE:PHYKE_5585:PHYKE_5586:scaffold_223:50056:55850
Length=5794

 Score = 32.7 bits (73),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 20/35 (57%), Gaps = 2/35 (6%)
 Frame = +2

Query  30    EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
             EGY+ KRGH   S R RY V  G  L  +YY + D
Sbjct  1667  EGYLMKRGHRIPSMRKRYCVLIGNEL--SYYVTHD  1765

Lambda      K        H        a         alpha
   0.315    0.132    0.376    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 41768563032

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40