Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHCA:PHYCA_507519:PHYCA_507521:scaffold_28:279076:28120624112903801536e-09
PHKE:PHYKE_8991:PHYKE_8992:scaffold_386:5416:9948258936353681464e-08
HYAP:HYAP_12822:HYAP_12823:scaffold_220:13340:185602074227467802.7
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PITG_18458

Length=747
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHCA:PHYCA_507519:PHYCA_507521:scaffold_28:279076:281206              63.5       6e-09
PHKE:PHYKE_8991:PHYKE_8992:scaffold_386:5416:9948                     60.8       4e-08
HYAP:HYAP_12822:HYAP_12823:scaffold_220:13340:18560                   35.4       2.7  

>PHCA:PHYCA_507519:PHYCA_507521:scaffold_28:279076:281206
Length=2130

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 84/380 (22%), Positives = 142/380 (37%), Gaps = 88/380 (23%)
 Frame = -1

Query  289   FPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARY---------NLGNDTLLAVVGEG  339
             F      S+L  H  G     R W     + W+              L N  +  VVG+ 
Sbjct  1290  FNFQHQISKLTEHFAG-----REWLFEHFQRWVQGSSMSTSSESTRELYNQRMFWVVGQI  1126

Query  340   GTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQL-AR  398
             G+GKS+    +       + A H  + + +   S R  +LS+ +QL   LP + + L + 
Sbjct  1125  GSGKSSVAACMVHSC-PEIAAFHFARQEDEQTHSARRCILSLAYQLTTQLPEYAHYLQSH  949

Query  399   LNLKYVLEEADPFLLAGKVLVDPLNAVEEP--MHATFILVDGIDQCA-------------  443
               L+ ++  A    L   +L+ PLNA+  P    +  +L+DG++                
Sbjct  948   EPLEEMVPVASFVELVTHLLIGPLNAIARPTKYKSLVLLIDGVEWLIPRPASSSLPPLSG  769

Query  444   ---VGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRL-----PVSSVLDFSAKN  495
                 GSN    L+ +   +I +LP WV  ++ S+    +  +L     P  ++  F  +N
Sbjct  768   NSWKGSNDEECLVSMLPSLISRLPEWVRVVLLSREDPPVLSKLHAFVPPDITIEQFQQQN  589

Query  496   GAFVADASSLVDDIAR---------NFSDDDAAEAK----------------KVLKKKSG  530
                         DI R         +FSDDD  +A                 +++ ++S 
Sbjct  588   D----------QDIRRYVHHSLSKLHFSDDDFEKASVGIEPSSHRCGMDQAVELIARRSE  439

Query  531   GNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWG  590
             G F Y     QA+S         EG + L  L ELP  +     + F   F         
Sbjct  438   GLFLYAVNVVQAIS---------EGRLHLNELAELPVGMGAYLQQFFASHFSDHDMYK-H  289

Query  591   KAKPLLQLVVGAAAGPYSPV  610
             + +P+L++   A    Y P+
Sbjct  288   RVRPVLEVCCAA----YEPL  241

>PHKE:PHYKE_8991:PHYKE_8992:scaffold_386:5416:9948
Length=4532

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 146/368 (40%), Gaps = 62/368 (17%)
 Frame = +3

Query  327   LGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLV  386
             LG+  +  VVG+ G GK++    + Q     + A H  Q + +   + R  +LS+ +QL 
Sbjct  2589  LGSQRVFWVVGQIGAGKTSVAARLVQSC-PEIAAFHFAQQEDEQTHNARRCVLSLAYQLT  2765

Query  387   DSLPSFKNQLARLNLKYVLEEADPFL----LAGKVLVDPLNAVEEPMHATFILVDGIDQC  442
               LP + + L        LEE  P      L   +LV PLNA+  P  +  +L+DG++  
Sbjct  2766  TQLPEYAHYLQS---HEPLEEMVPVASFPELVTNLLVGPLNAIARPSKSLVLLIDGLEWL  2936

Query  443   AVG-------------------SNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRL  483
                                   S     L+ +   ++P+LP WV F++ S+    +  RL
Sbjct  2937  IPASSSSSPPSLSSLSMSSWKESKEEECLVSMLPSLVPRLPEWVRFVLLSREDPTVLSRL  3116

Query  484   -----PVSSVLDFSAKNGAFVADASSLVD---DIAR-----------NFSDDDAAEAKKV  524
                  P  ++ +F  +N   +   +SL     D+ +           N  +  A +  ++
Sbjct  3117  QPFEPPNITMENFRQENDQDICRFTSLAFSKLDLEQTTASKSTASPANSDEVSAHDIVEL  3296

Query  525   LKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFG-Q  583
             + ++S G F Y     QA++         EG + L  L  LP  +     + F   F  Q
Sbjct  3297  VTRRSEGLFLYAVNVVQAIN---------EGRLHLHDLAALPVGMGACLQQFFASHFADQ  3449

Query  584   GRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGS  643
                ++  + +P+L+++  A    Y P+              + R +  +   L  ++ GS
Sbjct  3450  DLYKL--RVRPVLEVLCAA----YEPLPLATLARVLEWDVYEQRDVSTTLGSLFYIEAGS  3611

Query  644   YRIESSAL  651
                ES  L
Sbjct  3612  SDPESQVL  3635

>HYAP:HYAP_12822:HYAP_12823:scaffold_220:13340:18560
Length=5220

 Score = 35.4 bits (80),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (45%), Gaps = 3/67 (4%)
 Frame = -1

Query  589   WGKAKPLLQLVVGAAAG---PYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYR  645
             W     +L  V+ +  G   P+  +T E +   F   T  L  + R    LVSV HG +R
Sbjct  2274  WAARAAVL*FVIISVTGYVLPFMFLTLECSALEFQWPTVGLNNITRVHYTLVSVDHGGFR  2095

Query  646   IESSALC  652
             +  S LC
Sbjct  2094  MHHSILC  2074

Lambda      K        H        a         alpha
   0.315    0.129    0.368    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 107444284324

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40