Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634127131440711042e-138
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:130980776211331313389e-32
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:1050931174631614e-12
PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937845940321242e-09
SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383243419761462e-08
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:722373143491296e-08
PHKE:PHYKE_4893:PHYKE_4894:scaffold_31:140787:14217180293345822.4
PHSO:PHYSO_494226:PHYSO_557030:scaffold_3:350988:35122910324051707.6
PHIF:PITG_01883:PITG_01884:NW_003303757.1:4831262:48460327644778146788.3
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PITG_18457

Length=1170
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634               429        2e-138
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807          134        9e-32 
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093               66.6       4e-12 
PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937                    52.4       2e-09 
SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383                  60.8       2e-08 
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237                    54.3       6e-08 
PHKE:PHYKE_4893:PHYKE_4894:scaffold_31:140787:142171                  36.2       2.4   
PHSO:PHYSO_494226:PHYSO_557030:scaffold_3:350988:351229               31.6       7.6   
PHIF:PITG_01883:PITG_01884:NW_003303757.1:4831262:4846032             34.7       8.3   

>PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634
Length=1315

 Score = 429 bits (1104),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 271/407 (67%), Positives = 306/407 (75%), Gaps = 37/407 (9%)
 Frame = +1

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
             M+KVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEAN+SPMRH+A+VTTAEVQAFN
Sbjct  127   MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANSSPMRHSAVVTTAEVQAFN  306

Query  61    AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
             AILQ+TETELRAKAELVLNGMVNSS     +    GT+LPAVTVA  PSI  RSGY +A 
Sbjct  307   AILQRTETELRAKAELVLNGMVNSSFEPSQS----GTVLPAVTVANPPSIKRRSGYRRAY  474

Query  121   KPRQMDASSIPVEFFRE---------------------QFRNNSVEIRQSL---PEPWER  156
             KPR+ DASSIP+EFFRE                     QFRN+SVEIRQSL   P+ W+R
Sbjct  475   KPRRTDASSIPMEFFREVNGGVNVVLC*NAILM*SCL*QFRNSSVEIRQSLMPSPQHWQR  654

Query  157   HFGIHHGRLMRKKTTQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADL  216
             H G+ HGRLMRKKTTQHCRLLPSVNK DP+ PTPELREEDAKHGV NLVTRGFLPAYADL
Sbjct  655   HLGLQHGRLMRKKTTQHCRLLPSVNKADPTAPTPELREEDAKHGVFNLVTRGFLPAYADL  834

Query  217   TPVFSGTSDGSGGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRapptpppv  276
             TP F+    G+  GVMKQRATRIY+RSEQ  R TP TQSTGYNLA+LKFDLRAPPTPPP 
Sbjct  835   TPAFAS---GANDGVMKQRATRIYDRSEQSARPTPITQSTGYNLAALKFDLRAPPTPPPP  1005

Query  277   vpeatfpDsttrrrstrrs--sALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAF  334
              PE +   S    R       SA QG +  T + P S++  KN RSA   SL+SAA+AAF
Sbjct  1006  APETSSTSSADSTRRQSTRRGSARQGASRVTMAFPASAND-KNRRSARQKSLVSAAIAAF  1182

Query  335   TNQGEDTENNRDRFsdddisdeeqesdendkdeYAEMEKLGANVDKI  381
             TNQ +D E+NRDRF   D  D+  + ++ D+D+  E E+LGANVDKI
Sbjct  1183  TNQ-DDVEDNRDRF--SDQPDDVSDEEQKDEDKDEETEELGANVDKI  1314

>PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807
Length=1464

 Score = 134 bits (338),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 89/131 (68%), Gaps = 7/131 (5%)
 Frame = +3

Query  137   EQFRNNSVEIRQSLPEPWERHFGIHHGRLMRKKTTQHCRLLPSVNKTDPSVPTPELREED  196
             ++F+N++VE++ +   P +R   I  GRL++ K T H RLLPSVNK DPS P PEL E D
Sbjct  762   QRFQNSAVELKPTPFSPVQR---ITKGRLVKSKMTHHARLLPSVNKCDPSAPPPELFEHD  932

Query  197   AKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGVMKQRATRIYNRSEQVVRSTPFTQST  256
             AK G+ +L+ RGF+P  ADLTP F      S G ++K   TRIYNR EQ +R  P+T  +
Sbjct  933   AKSGMFSLINRGFVPVGADLTPAFV----NSHGSIIKNSKTRIYNRQEQPIRPMPYTNPS  1100

Query  257   GYNLASLKFDL  267
             G+++ASLKFDL
Sbjct  1101  GFSMASLKFDL  1133

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 7/109 (6%)
 Frame = +2

Query  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
            MD++QQQHHVEDVGR+LLQTQEQLR+MREQM +  AA                A+V AF 
Sbjct  263  MDQIQQQHHVEDVGRILLQTQEQLRLMREQMASTTAATTPTRFHQ-----TAPADVAAFQ  427

Query  61   AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPS  109
             ILQ+ E E+RAKAELVLNG+VN+SS A        + LPAV  +++P+
Sbjct  428  EILQRAELEIRAKAELVLNGLVNTSSQAAAASTL--STLPAVVSSSSPT  568

>PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093
Length=226

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 5/63 (8%)
 Frame = +1

Query  1106  GALAFLRTALEVIGREAGSTIsvasspsrsvasrsGNFAQILSAIRVSTGGGKSDRLGKM  1165
             GALAFLRTALEVIGRE G+TI      S +    SGNFA +LSA+R +TGG   DRLGKM
Sbjct  1     GALAFLRTALEVIGREVGATI---EMSSSTSRPVSGNFAHVLSAVRAATGG--KDRLGKM  165

Query  1166  RQR  1168
             R++
Sbjct  166   RRK  174

>PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937
Length=1113

 Score = 52.4 bits (124),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
            M+++QQQHHVEDVGR+LL TQ+QLR +REQ++
Sbjct  940  MEQLQQQHHVEDVGRILLHTQDQLRHLREQLS  845

 Score = 33.9 bits (76),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 0/55 (0%)
 Frame = -2

Query  48   NAIVTTAEVQAFNAILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAV  102
            NA+++         ILQ+ E ELR KAELVL  +V S  +A +    S   LP+V
Sbjct  752  NALLSNNAGAEIEEILQRAENELRMKAELVLGNLVTSGPAAASATQSSDRSLPSV  588

>SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383
Length=799

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 17/76 (22%)
 Frame = +3

Query  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
            MD++ QQ+HVEDVGR+LLQ Q++LR MREQ+             +  N I    +V A  
Sbjct  243  MDRLAQQYHVEDVGRILLQAQDELRNMREQV-------------LTSNNI----DVDALQ  371

Query  61   AILQQTETELRAKAEL  76
            AIL++ E +LR+KAE+
Sbjct  372  AILERAELDLRSKAEV  419

>PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237
Length=236

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +3

Query  1119  GREAGSTIsvasspsrsvasrsGNFAQILSAIRVSTGGGKSDRLGKMRQ  1167
             GREAG+TI +A+S S S  S  GNFAQ+LSAIR STGGGK DRLGK R+
Sbjct  3     GREAGATIEMAASRSHSAHS--GNFAQVLSAIRASTGGGKGDRLGKARR  143

>PHKE:PHYKE_4893:PHYKE_4894:scaffold_31:140787:142171
Length=1384

 Score = 36.2 bits (82),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +1

Query  496  AATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLK  540
            A+ TI++CVR WL R R    + +  +A+K+Q AWR  +   S+K
Sbjct  802  ASRTIQSCVRKWL-RHRERELQLTVLHAAKLQAAWRGRTVRKSVK  933

>PHSO:PHYSO_494226:PHYSO_557030:scaffold_3:350988:351229
Length=241

 Score = 31.6 bits (70),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (59%), Gaps = 7/51 (14%)
 Frame = +1

Query  577  HVPSLSLDEHSRLGAENFAIQQNLQLTRVCA--AALDSNVELLLYVSPFEL  625
            H  +L+    SR  A++FAIQQNL  T +C+  +A+D      +  +PF+L
Sbjct  103  HQSTLNYPPTSRQSAQSFAIQQNLLPTSICSRTSAVDD-----VATAPFQL  240

>PHIF:PITG_01883:PITG_01884:NW_003303757.1:4831262:4846032
Length=14770

 Score = 34.7 bits (78),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -3

Query  439   FVPLAYVDGQRLLALAG-TGQPRFSKRELLSCIVNEDQVMSVLRRP  483
              +P    DG  L A+A  +G PRFS R    C+V +D   S  +RP
Sbjct  7781  HLPPRIPDGDSLAAIASHSGMPRFSPRYSTHCVVRQDDRASASQRP  7644

Lambda      K        H        a         alpha
   0.321    0.134    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 179491327036

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40