Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHPA:PPTG_17123:PPTG_24025:scaffold_63:245290:247235661194443122100.0
PYUU:PYU1_G001738:PYU1_G001737:scaffold_2037:1303157:1305519862233449721690.0
PYUU:PYU1_G009196:PYU1_G009195:scaffold_2035:425757:429212162729644606015e-65
PHRA:PHYRA_81103:PHYRA_50855:scaffold_56:156781:158899165620091215093e-54
PYAP:PYAP_22647:PYAP_22646:scaffold_610:12031:1647241317894914005e-39
PHKE:PHYKE_1953:PHYKE_1956:scaffold_8:138827:16269316369179255633767e-36
PHKE:PHYKE_1956:PHYKE_1959:scaffold_8:162870:169560115624814733694e-35
PHKE:PHYKE_1871:PHYKE_1873:scaffold_1:387181:393938491762604773519e-33
PYUU:PYU1_G007265:PYU1_G007264:scaffold_2032:650674:654281156529234833293e-30
PHKE:PHYKE_10582:PHYKE_10584:scaffold_13:13154:20660432656634903242e-29
PHKE:PHYKE_1945:PHYKE_1946:scaffold_8:87427:99265235236564792582e-21
SAPA:SPRG_16932:SPRG_22382:scaffold_473:188:3908292334921932544e-21
PHKE:PHYKE_2744:PHYKE_2745:scaffold_35:106697:111270997042141705e-11
PHKE:PHYKE_1832:PHYKE_1834:scaffold_1:86035:10948911857130174081545e-09
PHSO:PHYSO_347251:PHYSO_562795:scaffold_7:963196:963683274465721143e-05
PYAR:PYAR_13570:PYAR_13569:scaffold_29:17128:1834210691197441123e-04
HYAP:HYAP_04843:HYAP_04845:scaffold_32:183577:18405616174621029e-04
PHIF:PITG_19065:PITG_19070:NW_003303668.1:94256:12569915460159121571050.003
PYVX:PYVX_18180:PYVX_18170:scaffold_275:3276:4022632745381000.004
PHKE:PHYKE_3243:PHYKE_3244:scaffold_15:77131:7871466112151971000.009
PHIF:PITG_01778:PITG_01781:NW_003303757.1:4157809:419073210279103870.40
HYAP:HYAP_07094:HYAP_07095:scaffold_59:140288:158852183851845624721.0
PYUU:PYU1_G006359:PYU1_G006358:scaffold_2007:651698:655717622909103811.9
PHSO:PHYSO_259444:PHYSO_489418:scaffold_3:5402135:54039621728181730749.6
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PHYCA_556160

Length=649
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHPA:PPTG_17123:PPTG_24025:scaffold_63:245290:247235                  855        0.0  
PYUU:PYU1_G001738:PYU1_G001737:scaffold_2037:1303157:1305519          840        0.0  
PYUU:PYU1_G009196:PYU1_G009195:scaffold_2035:425757:429212            236        5e-65
PHRA:PHYRA_81103:PHYRA_50855:scaffold_56:156781:158899                200        3e-54
PYAP:PYAP_22647:PYAP_22646:scaffold_610:12031:16472                   158        5e-39
PHKE:PHYKE_1953:PHYKE_1956:scaffold_8:138827:162693                   149        7e-36
PHKE:PHYKE_1956:PHYKE_1959:scaffold_8:162870:169560                   146        4e-35
PHKE:PHYKE_1871:PHYKE_1873:scaffold_1:387181:393938                   139        9e-33
PYUU:PYU1_G007265:PYU1_G007264:scaffold_2032:650674:654281            131        3e-30
PHKE:PHYKE_10582:PHYKE_10584:scaffold_13:13154:20660                  129        2e-29
PHKE:PHYKE_1945:PHYKE_1946:scaffold_8:87427:99265                     103        2e-21
SAPA:SPRG_16932:SPRG_22382:scaffold_473:188:3908                      102        4e-21
PHKE:PHYKE_2744:PHYKE_2745:scaffold_35:106697:111270                  70.1       5e-11
PHKE:PHYKE_1832:PHYKE_1834:scaffold_1:86035:109489                    63.9       5e-09
PHSO:PHYSO_347251:PHYSO_562795:scaffold_7:963196:963683               48.5       3e-05
PYAR:PYAR_13570:PYAR_13569:scaffold_29:17128:18342                    47.8       3e-04
HYAP:HYAP_04843:HYAP_04845:scaffold_32:183577:184056                  43.9       9e-04
PHIF:PITG_19065:PITG_19070:NW_003303668.1:94256:125699                45.1       0.003
PYVX:PYVX_18180:PYVX_18170:scaffold_275:3276:4022                     43.1       0.004
PHKE:PHYKE_3243:PHYKE_3244:scaffold_15:77131:78714                    43.1       0.009
PHIF:PITG_01778:PITG_01781:NW_003303757.1:4157809:4190732             38.1       0.40 
HYAP:HYAP_07094:HYAP_07095:scaffold_59:140288:158852                  32.3       1.0  
PYUU:PYU1_G006359:PYU1_G006358:scaffold_2007:651698:655717            35.8       1.9  
PHSO:PHYSO_259444:PHYSO_489418:scaffold_3:5402135:5403962             33.1       9.6  

>PHPA:PPTG_17123:PPTG_24025:scaffold_63:245290:247235
Length=1945

 Score = 855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/431 (94%), Positives = 423/431 (98%), Gaps = 3/431 (1%)
 Frame = -2

Query  208   CVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSIN  267
             CVNVGCIPKKLMHQSSLIGEV+HHD ANFGWN+   +G+APTF+WKQLV+NVDGYIK IN
Sbjct  1944  CVNVGCIPKKLMHQSSLIGEVMHHDSANFGWNV---EGSAPTFDWKQLVTNVDGYIKGIN  1774

Query  268   FKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGG  327
             FKYKVELRSKYVKYENF+GSF++PHTLELWHPRKGTKQITTRDVVIAVGGRP+ELTCPGG
Sbjct  1773  FKYKVELRSKYVKYENFMGSFIDPHTLELWHPRKGTKQITTRDVVIAVGGRPRELTCPGG  1594

Query  328   EHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMA  387
             EHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMA
Sbjct  1593  EHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMA  1414

Query  388   DKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPD  447
              KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPD
Sbjct  1413  TKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPD  1234

Query  448   VAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY  507
             VAKL LDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY
Sbjct  1233  VAKLGLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY  1054

Query  508   NNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTR  567
             NNSTVQMDY+KVCTAVFTPIEYGCCG+SEE+S ER+GEDNIEVYHTNFVPLEWSLST+TR
Sbjct  1053  NNSTVQMDYDKVCTAVFTPIEYGCCGLSEENSIERYGEDNIEVYHTNFVPLEWSLSTETR  874

Query  568   TAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  627
             TAAESCY+KV+CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT
Sbjct  873   TAAESCYVKVVCDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  694

Query  628   AESFTTLEVTK  638
             AESFTTLEVTK
Sbjct  693   AESFTTLEVTK  661

>PYUU:PYU1_G001738:PYU1_G001737:scaffold_2037:1303157:1305519
Length=2362

 Score = 840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/497 (80%), Positives = 438/497 (88%), Gaps = 6/497 (1%)
 Frame = -2

Query  142   MSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTS  201
             M E  V++ +  DA+   YDYDLVVIGGGSGGLACSKEAA +G+KVCVLDYVKPS  GTS
Sbjct  2334  MREAPVKQDNKQDADAVTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSLVGTS  2155

Query  202   WGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDG  261
             WGLGGTCVNVGCIPKKLMHQSSLIGE IH D   FGW +        TF+W Q++ +V+ 
Sbjct  2154  WGLGGTCVNVGCIPKKLMHQSSLIGETIHKDSKAFGWTVGE-----QTFDWAQMLKSVNS  1990

Query  262   YIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKE  321
             YIKSINFKYKVELR K VKYEN LGSF++ HTLELWHP+KGTK +TTRDVVIAVGGRPK 
Sbjct  1989  YIKSINFKYKVELRDKKVKYENLLGSFIDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKP  1810

Query  322   LTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRG  381
             L C GG+ AISSDDIFW +K+ PGKTLVVGASYVALECAGF+KGMGYDVK+MVRSILLRG
Sbjct  1809  LACEGGDLAISSDDIFW-RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRG  1633

Query  382   FDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNA  441
             FDQDMADKIGE+MEV+S IEFIR  VPQSI KLENGQLLVKWT+ DGE+CEEAFDTVLNA
Sbjct  1632  FDQDMADKIGEFMEVESKIEFIRGCVPQSIMKLENGQLLVKWTTADGEACEEAFDTVLNA  1453

Query  442   TGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRL  501
             TGRDPDVAKL LDKAGVKLN K+GRIWV+NEQTSTPN+YAIGDVIDAPELTPVAIQAGRL
Sbjct  1452  TGRDPDVAKLGLDKAGVKLNPKTGRIWVENEQTSTPNVYAIGDVIDAPELTPVAIQAGRL  1273

Query  502   LSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWS  561
             L+RRLYNN T  MDY+KVCTAVFTPIEYGCCG+SEE S E+FGEDN+E+YH NF PLEWS
Sbjct  1272  LARRLYNNETTLMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDNLEIYHQNFTPLEWS  1093

Query  562   LSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  621
             LS+ TR AA SCY+KVICDK+RDK+VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV+ V
Sbjct  1092  LSSATRPAASSCYVKVICDKSRDKYVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVNVV  913

Query  622   GIHPTTAESFTTLEVTK  638
             GIHPTTAE FTTLEVTK
Sbjct  912   GIHPTTAEIFTTLEVTK  862

>PYUU:PYU1_G009196:PYU1_G009195:scaffold_2035:425757:429212
Length=3455

 Score = 236 bits (601),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 155/460 (34%), Positives = 234/460 (51%), Gaps = 17/460 (4%)
 Frame = +1

Query  178   KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFG  237
             + AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  ++   E +H + A++ 
Sbjct  1627  RRAATYGAKVLV---VERGRKYDGAGLGGTCVNYGCVPKKVMFNAASHVEHLHRN-ADYS  1794

Query  238   WNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELW  297
                ++       F+WK + +  D YI  +N  Y+  L +  +     +   V    +E+ 
Sbjct  1795  ITTTTKPFEFGDFDWKNMKTKRDAYIARLNGIYERNLGNAQIDLVEGVAKLVAKDKVEV-  1971

Query  298   HPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVAL  357
                      T + +++AVGG P     PG EH I SDD F +++ +P K  VVGA Y+A+
Sbjct  1972  ----DGVVYTGKHILVAVGGVPSLPPIPGIEHVIDSDDFFKLEE-QPKKVAVVGAGYIAI  2136

Query  358   ECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLEN  416
             E AG    +  D  +  R   +LR FD  + D I E  E ++GI F+R +  + I K  +
Sbjct  2137  EIAGIFNALKSDTSLFCRFDHVLRTFDPIVRDLINEEGE-KAGINFVRNSRIERIDKQAD  2313

Query  417   GQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTST  476
             G L +       E     F+ +L A GR+P    L L++ GVKLNEK   +    E TS 
Sbjct  2314  GTLQITAKVNGEEQVIGGFNQILYAIGREPRTKDLGLEEVGVKLNEKGFIVVDAQENTSV  2493

Query  477   PNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TVQMDYEKVCTAVFTPIEYGCCGM  534
               IYAIGD      ELTPVAI AGR LS RL+       + Y ++ T VF+    G  G 
Sbjct  2494  SGIYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEPNACLHYHQIPTVVFSHPPLGTIGY  2673

Query  535   SEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLG  594
             +E ++ E+FG +N++ Y + FV L ++++        +  L  + +   D+ VVG H  G
Sbjct  2674  TEPEAIEKFGAENVKTYSSKFVNLLYAMADPDHKGKTAMKLVTVGE---DEVVVGIHVAG  2844

Query  595   PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
               A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  2845  EGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  2964

>PHRA:PHYRA_81103:PHYRA_50855:scaffold_56:156781:158899
Length=2118

 Score = 200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 100/121 (83%), Gaps = 3/121 (2%)
 Frame = +3

Query  7     LAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKH  66
             L ETL  S   S ATFHIAGW+TCPSFVKAGEV  AMQMLYP+RV FE+HPFEDR+AFK 
Sbjct  1656  LPETLTAS---STATFHIAGWRTCPSFVKAGEVVAAMQMLYPERVAFEMHPFEDRDAFKQ  1826

Query  67    WLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQGAT  126
             WLSES+ +FA SFG DSKA  HVTSPFVWSSNPT FVGGCDDLLT+FRSGV VG PQG  
Sbjct  1827  WLSESKTDFAASFGADSKANTHVTSPFVWSSNPTTFVGGCDDLLTFFRSGVAVGKPQGVE  2006

Query  127   P  127
             P
Sbjct  2007  P  2009

>PYAP:PYAP_22647:PYAP_22646:scaffold_610:12031:16472
Length=4441

 Score = 158 bits (400),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 141/491 (29%), Positives = 227/491 (46%), Gaps = 41/491 (8%)
 Frame = +2

Query  150   TSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCV  209
             +STA +E     YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+
Sbjct  413   SSTASSE-----YDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCL  553

Query  210   NVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFK  269
             NVGCIP K +  ++ +     HD + +G  +S         N+  ++ + +  +K++   
Sbjct  554   NVGCIPSKALLHATHMYHAAQHDFSKYGIEVSD-----VKMNFDGMMKSKEKAVKTLTGG  718

Query  270   YKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGR-----PKELTC  324
              +   +   V Y    G  V+ + + +     G + +  ++++IA G       P  +  
Sbjct  719   IEGLFKKNKVTYVKGFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDN  898

Query  325   PGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFD  383
               G+   S+  +    KK P   +V+G   + LE     K +G  V V+     +  G D
Sbjct  899   AAGKIVDSTGALEL--KKVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLD  1072

Query  384   QDMADKIGEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNAT  442
             Q++  +  + ++ Q G++F   T V  S    +   L V+  +    S  EA DTVL AT
Sbjct  1073  QELGKEFTKLLKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVAT  1246

Query  443   GRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRL  501
             GR P    L L++ G++  +K GRI V N  +T  PNI+AIGDVI  P L   A + G  
Sbjct  1247  GRRPFTKGLGLEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIA  1423

Query  502   LSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWS  561
                 +       ++Y+ +   ++T  E    G +EE  KE       E    N       
Sbjct  1424  CVENIAGLHG-HVNYDAIPGVIYTYPEVASVGKTEEQLKE-------EGVAYNVGKFPMM  1579

Query  562   LSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  620
              ++  R  AES  ++KVI DKT D+ ++G H +  NAGE+     L M+ G   + +  T
Sbjct  1580  ANSRARAVAESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRT  1756

Query  621   VGIHPTTAESF  631
                HPT +E+F
Sbjct  1757  CHAHPTLSEAF  1789

>PHKE:PHYKE_1953:PHYKE_1956:scaffold_8:138827:162693
Length=23866

 Score = 149 bits (376),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 145/563 (26%), Positives = 252/563 (45%), Gaps = 74/563 (13%)
 Frame = -2

Query  105    GCDDLLTYFRSGVGVGNPQGATPNGSPT-EKTAEADVPMSETSVEET--STADAEETNY-  160
              GC++ +T     +G  N + +   G  T E   + ++  ++ ++ E    + DAE  +  
Sbjct  17925  GCEEHVTTALEQIGAANIEASFRRGEATFEFPDDVEIETAKKAINEAEYQSGDAEVLDSH  17746

Query  161    ---------DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNV  211
                       DYD ++IG G    + + +A  +G KV +++      +GT   +GGTCVN+
Sbjct  17745  TVPVLSDEGDYDFLIIGSGGAAFSAAIQAVEYGAKVAIIE------RGT---VGGTCVNI  17593

Query  212    GCIPKKLMHQSSLIGEVIHHDGAN--FGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFK  269
              GC+P K + ++   GE+ H    N   G N S     A   +  QLV   +  +      
Sbjct  17592  GCVPSKTLLRA---GEINHFAKNNPFLGLNTS-----AVAVDLDQLVEQKNELV------  17455

Query  270    YKVELRSKYVKYENFLG-----------SFVNPHTLELWHPRKGTKQITTRDVVIAVGGR  318
                 E+R +  KYE+ +G            FV+  T+ +     G +++T +  ++A G  
Sbjct  17454  --AEMREQ--KYEHLIGEYGFELIRGEAKFVDEKTIVV-----GGRKLTAKRFLLATGAA  17302

Query  319    PKELTCPGGEHA--ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  376
              P     PG      ++S  +  +K+  P    V+G+ Y+A+E       +G +V ++ RS
Sbjct  17301  PSIPDIPGLTDVDYLTSTSLLDLKQL-PKTLAVIGSGYIAMELGQLFHNLGTEVTLIQRS  17125

Query  377    -ILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAF  435
                + + +D ++++ + + +  + GI  I       +     G L     S +GE      
Sbjct  17124  PRIFKEYDPEISEAVTKAL-TEQGIHLITGATYDRVET--TGNLKHVHLSVNGEKKVIEA  16954

Query  436    DTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPV  494
              + +L ATGR P+   LNL  A V +  K G I V +  +TS P IYA GDV   P+   V
Sbjct  16953  EQLLIATGRKPNTEALNLRAANVIIGSK-GEIVVDDVLKTSNPRIYAAGDVTMGPQFVYV  16777

Query  495    AIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTN  554
              A   GR+ +         +++ E V    FT       G++EE +K +  E       T+
Sbjct  16776  AAYEGRIAADNAVGGLEKKVNLETVPGVTFTSPALATVGLTEEQAKAKGYE-----VKTS  16612

Query  555    FVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  614
               +PL+ S+         +   K++ D    K V+G H +  NAG+V  A  LA+K G T 
Sbjct  16611  ILPLD-SVPRALVNRETTGVFKLVADSKSLK-VLGVHIVAENAGDVIYAATLAVKFGLTV  16438

Query  615    DQMVDTVGIHPTTAESFTTLEVT  637
              + + D++  + T AE      +T
Sbjct  16437  EDLRDSLAPYLTMAEGLKLAALT  16369

>PHKE:PHYKE_1956:PHYKE_1959:scaffold_8:162870:169560
Length=6690

 Score = 146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 133/473 (28%), Positives = 233/473 (49%), Gaps = 38/473 (8%)
 Frame = -1

Query  164   LVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSS  223
             L+VIGGGSGG   +  AA  G+KV +++  +         LGG C+N GC+P K +  ++
Sbjct  2481  LLVIGGGSGGYVAAIRAAQLGKKVLLVEKSE---------LGGVCLNCGCVPSKALISAA  2329

Query  224   LIGEVIHHDGANFGWNLSSGDGNAPTF-NWKQ--LVSNVDGYIKSINFKYKVELRSKYVK  280
                E +   G + G      D +      WKQ  +V+ +   I+S+  K+++ +     K
Sbjct  2328  HRYEQMLESGIS-GLKAKGVDIDFSQIQQWKQTKVVNRLKTGIQSLLKKHEISV----FK  2164

Query  281   YENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTC-PGGEHAISSDDIFWM  339
              E     F+N     L++ ++  +     D ++AVG RP EL   P G   +SS +   +
Sbjct  2163  GEAL---FINDREARLYNEQESLRY-QFDDCIVAVGSRPIELKAFPYGNRILSSTEALTL  1996

Query  340   KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS-ILLRGFDQDMADKIGEYMEVQS  398
              +  P + +V+G  Y+ +E        G  V ++  S  +L GF+ ++   + + ++   
Sbjct  1995  TEI-PERMVVIGGGYIGIELGQMYAKFGTKVTILEGSPSILPGFESEITRIVKKNLD-SL  1822

Query  399   GIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDV-AKLNLDKAG  457
             G+      + QS  +  + ++ V +T +  E    A D VL   GR P+   +L LD+ G
Sbjct  1821  GVTVYTNAMAQSAQQSAD-EITVTFTVDQTEQQVTA-DYVLVTVGRRPNTDGELGLDRIG  1648

Query  458   VKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDY  516
             VK+ E+ G + V  + +TS P+IYAIGD+I  P L   A   G++++  +    +   DY
Sbjct  1647  VKIGER-GLVEVDQQGRTSIPHIYAIGDIIAGPALAHKASYEGKVVAEAIAGQPSA-FDY  1474

Query  517   EKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLK  576
             + +   VF+  E    G+SE D+KE+ G D I V    F     +LS     +A   ++K
Sbjct  1473  KVIPAVVFSDPEIASVGLSEPDAKEK-GYD-IMVGKFPFAANARALS----LSASEGFVK  1312

Query  577   VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  629
             ++ DK +   ++G   +G NA ++   + LA+++G T + +  T+  HPT  E
Sbjct  1311  LVGDK-KTGLILGGQIVGTNASDLIPEIALAIEMGTTMEDLALTIHAHPTLGE  1156

>PHKE:PHYKE_1871:PHYKE_1873:scaffold_1:387181:393938
Length=6757

 Score = 139 bits (351),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 131/477 (27%), Positives = 228/477 (48%), Gaps = 33/477 (7%)
 Frame = -3

Query  157   ETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  216
             + + + D +VIG G GG   +  AA  GQ V ++D  +         LGG C+N GCIP 
Sbjct  6260  DASLNIDTLVIGAGPGGYVAAIRAAQLGQSVLIVDKSE---------LGGVCLNRGCIPS  6108

Query  217   KLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRS  276
             K +  ++   E   H G  FG    S +     F+  Q   N  G +K +       L+ 
Sbjct  6107  KALISAAHQYESALH-GEAFGI---SAENVKVDFSKTQEFKN--GVVKKMTGGVAGLLKG  5946

Query  277   KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELT-CPGGEHAISSDD  335
               V+  N    F+N +   +++  + + +   ++ +IA G RP EL   P G   +SS +
Sbjct  5945  NKVEVFNGECMFINENEARVFNDHE-SPRYKFKNAIIATGSRPIELKPFPFGGRILSSTE  5769

Query  336   IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMV-RSILLRGFDQDMADKIGEYM  394
                + +  P   +V+G  Y+  E        G  V ++     +L GFD+DM   + + M
Sbjct  5768  ALNLPEV-PKSMIVIGGGYIGAELGQMYSKFGAKVTIIEGLDTVLPGFDKDMTSLVAKNM  5592

Query  395   EVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDV-AKLNL  453
             + ++GIE +     +S  + +   + VK+ S +GES E   D +L   GR P+   +L L
Sbjct  5591  K-KTGIEIVTGAKAESAEQTDK-DVTVKY-SVNGESKEVTADYLLVTVGRRPNTDGELGL  5421

Query  454   DKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTV  512
             D  GV ++E+ G + V ++ +TS P+I+AIGD++    L   A   G++ +  +    +V
Sbjct  5420  DLIGVDVDER-GFVKVDHQGRTSIPHIFAIGDIVSGLALAHKASYEGKVAAEAIAGQPSV  5244

Query  513   QMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES  572
              +DY+ +   VFT  E    G +E+++KE+      +V    F P   +    +   AE 
Sbjct  5243  -VDYKCMPAVVFTDPECSSVGYTEKEAKEK----GYKVKAGKF-PYAGNGRAVSLNHAEG  5082

Query  573   CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  629
              ++K++ D+     V+G   +G  A  +   +GLA+++G T + +  T+  HPT  E
Sbjct  5081  -FVKIVADE-ESGLVLGCQIVGLEASNLIAELGLAIEMGATLEDLALTIHAHPTLGE  4917

>PYUU:PYU1_G007265:PYU1_G007264:scaffold_2032:650674:654281
Length=3607

 Score = 131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 137/483 (28%), Positives = 220/483 (46%), Gaps = 42/483 (9%)
 Frame = +2

Query  161   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
             DYD+VVIGGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K + 
Sbjct  1565  DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE-----SRGT---LGGTCLNVGCIPSKALL  1720

Query  221   QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
              S+ +     HD + +G  +S       + ++ +L+ + D  +K++    +   +   V 
Sbjct  1721  HSTHLYHSAQHDFSKYGIEVS-----GVSMDFGKLMKSKDKAVKTLTGGIEQLFKKNKVT  1885

Query  281   YENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSDD  335
             Y    G  V  + + +     G + ++ ++++IA G       P  +    G+   S+  
Sbjct  1886  YIKGHGKIVAKNEIAVTLNDSGNQTVSAKNILIATGSEVTPLPPVPVDNAAGKIVDSTGA  2065

Query  336   IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLR---GFDQDMADKIGE  392
             +    KK P   +V+GA  + LE     K +G   KV V   L R   G D ++  +  +
Sbjct  2066  LEL--KKVPEHLVVIGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEFTK  2233

Query  393   YMEVQS-GIEFIRKTVPQSITKLENGQL-LVKWTSEDGESCEEAFDTVLNATGRDPDVAK  450
              ++ Q  G EF  K    + +K++  ++ L    +  G +     D VL ATGR P    
Sbjct  2234  LLKKQGLGFEFSTKV---TASKVDGDKVTLTTEPAAGGAASTIECDAVLVATGRRPFTGG  2404

Query  451   LNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  509
             L L+  G++  +K GRI V    +T  PNI+AIGDVI  P L   A + G      +   
Sbjct  2405  LGLENMGIQ-TDKFGRIQVDEHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVETIAGK  2581

Query  510   STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTA  569
                 ++Y  +   ++T  E    G +EE  KE       E    N        ++  R  
Sbjct  2582  HG-HVNYNAIPGVIYTFPEVASVGKTEEQLKE-------EGVAYNVGKFPMLANSRARAV  2737

Query  570   AES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  628
              E+   +KVI DK  DK ++G H +  NAGE+     L M+ G   + +  T   HPT +
Sbjct  2738  GEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLS  2914

Query  629   ESF  631
             E+F
Sbjct  2915  EAF  2923

>PHKE:PHYKE_10582:PHYKE_10584:scaffold_13:13154:20660
Length=7506

 Score = 129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 130/490 (27%), Positives = 216/490 (44%), Gaps = 57/490 (12%)
 Frame = +3

Query  158   TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
             T   YDL+ IG GS   +     A  G K+ V+D  +          GGTC   GC PKK
Sbjct  4326  TQQPYDLIAIGTGSAASSVISRCAEAGWKIAVIDERE---------FGGTCALRGCDPKK  4478

Query  218   LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
             ++  ++   E+I  +    G  +   +GNA +  W +L++    + +S+      E + K
Sbjct  4479  VLAGAA---ELIDWNERMKGKGV---EGNA-SIRWSELMAFKRTFTESV--PRASEDKFK  4631

Query  278   YVKYENFLG--SFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  335
                 + F G  SFV+       H R G + +  + ++IA G RP  L   G EH I SDD
Sbjct  4632  QAGMDTFHGKASFVDED-----HIRVGDEILQGKHILIATGARPAPLPIDGAEHLIYSDD  4796

Query  336   IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSIL-LRGFDQDMAD------  388
              F   ++ P K ++VG  Y+A E A      G +V ++ R    L+ FD ++ D      
Sbjct  4797  -FLDLEQLPDKLVLVGGGYIAFEFAHIAARAGTEVHIIHRGEEPLKQFDSELVDLLLKKS  4973

Query  389   -KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPD  447
              ++G ++ + + ++ IR          + G   V   + +G   +     V++  GR P+
Sbjct  4974  EEVGIHVHLNAEVKAIR----------QQGNTYVVSGTRNGADHQWQCGLVVHGAGRIPN  5123

Query  448   VAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDV--IDAPELTPVAIQAGRLLSRR  505
             +  L L+K  V   +K   +    +  S   ++A GDV   +   LTP+A Q  R +S  
Sbjct  5124  IEGLELEKGNVSYTKKGIIVNEYLQSESNSRVFAAGDVSATEGLPLTPLAGQESRAVSLN  5303

Query  506   LYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPL-EWSLST  564
             L   +  + +Y+ + + VFT    G  G+  E +K+       E Y      + +W   T
Sbjct  5304  LLEGNHHKPNYKVMPSIVFTVPSLGSVGLDVEQAKK-------EGYEVKVNDMSKW--YT  5456

Query  565   DTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  624
               RT  +    KVI DK   + ++G H LG    E+     +A++   T DQ+      +
Sbjct  5457  YKRTNEKFAMAKVITDKASGR-ILGAHVLGGKTEELINLFAMAIQFDLTTDQLNTMNFAY  5633

Query  625   PTTAESFTTL  634
             PT A    +L
Sbjct  5634  PTAASDLGSL  5663

>PHKE:PHYKE_1945:PHYKE_1946:scaffold_8:87427:99265
Length=11838

 Score = 103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 115/479 (24%), Positives = 209/479 (44%), Gaps = 58/479 (12%)
 Frame = -2

Query  165   VVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSL  224
             +VIG G GG   +  +   G K  +++  +         LGG C +VGCIP K     +L
Sbjct  3656  LVIGSGPGGYVAALRSVQLGMKTAIVERKQ---------LGGVCTHVGCIPSK-----AL  3519

Query  225   IGEVIHHDGANFGWNLSSGDGNAPTF----NWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
             I E   +D        +  D  A TF    N+KQ V N       +++     L++  V 
Sbjct  3518  IAESHRYD---LFKPFNPVDAAA-TFKNAQNFKQGVVNKQA--GGVHYL----LKNAGVT  3369

Query  281   YENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTC-PGGEHAISSDDIFWM  339
                   S V+ HT  L         I+ +++++A G RP EL   P G   +SS +   +
Sbjct  3368  ILEGEASLVDEHT-ALIQQAGQDHSISFKNLILATGSRPIELPAFPVGGRILSSTEALSL  3192

Query  340   KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQS  398
              +  P   +V+G  Y+ +E        G  V ++   + +L GF+ + A  + + ++   
Sbjct  3191  AEV-PSSLVVIGGGYIGVELGQMYAKFGTKVTILEGGAQVLPGFETEFAAPVVKQLKA-D  3018

Query  399   GIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDV-AKLNLDKAG  457
             GI+ +   + + +   +N   +    S+  E  +   + VL   GR P+   +L L++ G
Sbjct  3017  GIQIVTGAIAEKVE--QNADSITLHYSKSQEQHQVTAEYVLVTIGRKPNTDGQLGLERMG  2844

Query  458   VKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDY  516
             + +  K G +    + +T  P+IYAIGD+   P L   A    ++ +  +    T ++DY
Sbjct  2843  LPVTSK-GLVETDEQCRTMIPHIYAIGDITAGPALAHKASYEAKVAAEAI-AGLTSKVDY  2670

Query  517   EKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPL---EWSLSTDTRTAA---  570
             + +   VF+  E    G+SE ++K +             +P+   + S   + R  A   
Sbjct  2669  KVIPLVVFSDPELSSVGVSETEAKAQA------------IPVVIGKSSFGINGRALALRE  2526

Query  571   ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  629
                ++K++ D      V+G   +G  A  +   + LA+++G T + +  T+  HPT  E
Sbjct  2525  TEGFVKIVADPASG-IVIGAQIVGVEASTLISELALAIEMGATVEDLAMTIHPHPTLGE  2352

>SAPA:SPRG_16932:SPRG_22382:scaffold_473:188:3908
Length=3720

 Score = 102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 102/193 (53%), Gaps = 5/193 (3%)
 Frame = +1

Query  444   RDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLL  502
             R P    L L+   + L+          E TS PN++A+GDV     ELTPVAI AGR L
Sbjct  2923  RTPRTNDLGLETTDIALSADKFIQVDAQENTSVPNVHAVGDVTTTGWELTPVAIAAGRRL  3102

Query  503   SRRLYNNS-TVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWS  561
             + RL+ N     ++Y ++ T VF+    G  G++E  +  ++G  N++VY ++F  + ++
Sbjct  3103  ADRLFGNEPNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGAHNVKVYTSSFFNMFYA  3282

Query  562   LSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  621
             +S   +   +   +K+IC    ++ V+G H  G  A E+ Q  G+A+K+G       + V
Sbjct  3283  MSE--QDDKQKTAMKLIC-IGEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIV  3453

Query  622   GIHPTTAESFTTL  634
              IHPT +E   T+
Sbjct  3454  AIHPTASEELVTM  3492

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 63/127 (50%), Gaps = 3/127 (2%)
 Frame = -2

Query  508   NNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTR  567
             N     ++Y ++ T VF+    G  G++E  +  ++G  N+  + ++F  + +++  +  
Sbjct  1553  NEPNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGAHNVTTHTSSFSNMFYAMCPEKE  1374

Query  568   TAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  627
                 +  +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT 
Sbjct  1373  KVQTA--MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTA  1203

Query  628   AESFTTL  634
             +E   T+
Sbjct  1202  SEELVTM  1182

>PHKE:PHYKE_2744:PHYKE_2745:scaffold_35:106697:111270
Length=4573

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 100/214 (47%), Gaps = 14/214 (7%)
 Frame = +3

Query  418  QLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTST  476
            Q+ VK   E  E+     D +L + GR  +V  + L+   +KL+   G I V N  QT  
Sbjct  99   QIDVKLGDEKQETLRA--DKMLVSVGRQANVENIGLENTDIKLDR--GFIAVNNHLQTGE  266

Query  477  PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSE  536
             +IYAIGDVI   +L   A   G L    L   +   ++  ++   V+T  E    G +E
Sbjct  267  GHIYAIGDVIGGLQLAHAASHEGILAVNHLAGETVHAVESHRIPRCVYTRPEAASIGFTE  446

Query  537  EDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICD-KTRDKFVVGFHYLGP  595
             ++KER  E  ++     F  +  SL   +R      ++KVI D KT D  ++G H +G 
Sbjct  447  REAKERGYE--VKTGKFPFQAIGKSLVHGSRDG----FVKVIADAKTND--ILGVHMIGT  602

Query  596  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  629
            +  E+     LA  L  T  ++  T+  HP+ +E
Sbjct  603  HVTELIAEASLAQMLDATPWEVGQTIHPHPSLSE  704

>PHKE:PHYKE_1832:PHYKE_1834:scaffold_1:86035:109489
Length=23454

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 96/408 (24%), Positives = 166/408 (41%), Gaps = 56/408 (14%)
 Frame = -1

Query  264    KSINFKYKVELRSKYVKYENFLGSFVNP--HTLELWHPRKGTKQITTRDVVIAVGGRPKE  321
              K +  ++++++R+K           +NP   T+++    +G  + +  +++++ G RP  
Sbjct  13017  KGMADRFRIDVRTKSEVIA------INPDNRTVQVQSHERGQYEESYDELILSPGARPII  12856

Query  322    LTCPGGEHAI-----SSDDIFWMKKK----EPGKTLVVGASYVALECAGFLKGMGYDVKV  372
                 PG ++ +     S  DI  +K++         +V+G  ++ +E A  LK  G DV +
Sbjct  12855  PDLPGKDNPLIFTVRSIPDIDRIKEQVNSDNNASVIVIGGGFIGVEMAENLKEAGLDVTL  12676

Query  373    MV-RSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESC  431
              +     LL  FD ++A  + + ME Q G++ +     Q     E G   +     DG   
Sbjct  12675  VEGNGQLLTPFDPELAASLAQEME-QHGVKLLFSQRVQGFQSREQG---IGVELADGRVL  12508

Query  432    EEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVID---  487
                A D V+ A G  PD + L    +GV L  + G I V    ++S P+IYA+GD I+   
Sbjct  12507  --AADLVILAIGVAPDTSFLQ--HSGVSLGAR-GHIMVNEALESSVPHIYAVGDAIEVKD  12343

Query  488    -------APELTPVAIQAGRLLSRRLYN-NSTVQMDYEKVCTAVFTPIEYGCCGMSEEDS  539
                     A  L   A + GR+++ R+   +ST +         VF     G    S E +
Sbjct  12342  YIHGTKTAIPLAGPANKQGRIVADRIAGLHSTYKGTQGTSIIKVFG--MTGASTGSNEKT  12169

Query  540    KERFGEDNIEVY-----HTNFVP------LEWSLSTDTRTAAESCYLKVICDKTRDKFVV  588
               +R G D   V      H ++ P      L+   + D +            DK  D   V
Sbjct  12168  LKRLGIDYRTVIVHPGSHASYYPGSSAITLKLLFAPDGKILGAQAVGYDGVDKRIDDIAV  11989

Query  589    GFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEV  636
                H+     G ++    L +     Y    D V +    AE+  T  V
Sbjct  11988  AIHF----GGHISDLAELELSYAPPYSSAKDPVNMAGYAAENIVTGRV  11857

>PHSO:PHYSO_347251:PHYSO_562795:scaffold_7:963196:963683
Length=487

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 38/72 (53%), Gaps = 8/72 (11%)
 Frame = +1

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVVIG G     C+ E+A  G+KV ++D      + TS  LGG CV+ G IP K   +
Sbjct  274  YDLVVIGSGPSATQCALESAKRGKKVAIVD------KKTS--LGGVCVHTGTIPSKTFRE  429

Query  222  SSLIGEVIHHDG  233
            + L      H G
Sbjct  430  AVLHLSGYRHHG  465

>PYAR:PYAR_13570:PYAR_13569:scaffold_29:17128:18342
Length=1214

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +1

Query  82    DSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQGA  125
             DS A  H +SPFVW SN   FVGGCD  L +FRSG      +GA
Sbjct  1069  DSPALTHTSSPFVW-SNAHGFVGGCDATLAHFRSGXXXXAARGA  1197

 Score = 41.2 bits (95),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  21   TFHIAGWKTCPSFVKAGEVATAMQMLY  47
            T+++AGW  CP + KA +VA AMQMLY
Sbjct  852  TYYVAGWTACPWYRKARDVALAMQMLY  932

>HYAP:HYAP_04843:HYAP_04845:scaffold_32:183577:184056
Length=479

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 10/62 (16%)
 Frame = -3

Query  159  NYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            N +YD +VIGGGSGG+A ++ AAS+   +V V+++ +         LGGTCVNVGC+PKK
Sbjct  174  NKEYDYLVIGGGSGGIASARRAASYPNTRVAVVEHAR---------LGGTCVNVGCVPKK  22

Query  218  LM  219
            LM
Sbjct  21   LM  16

>PHIF:PITG_19065:PITG_19070:NW_003303668.1:94256:125699
Length=31443

 Score = 45.1 bits (105),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 66/157 (42%), Gaps = 11/157 (7%)
 Frame = +1

Query  480    YAIGDVIDAPELTPVAIQAGRLLSRRLYN-----NSTVQMDYEKVCTAVFTPIEYGCCGM  534
              YA GD I AP L   +++ GRL S  ++N      +T Q++       ++T  E    G 
Sbjct  15460  YAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQ  15639

Query  535    SEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLG  594
              +E+    +  +D +  Y                 A     LK++ D    K V G H +G
Sbjct  15640  TEQ----QLTKDCVN-YEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIG  15801

Query  595    PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
                A E+     +AM +G +     D V  +PT AE++
Sbjct  15802  EGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  15912

>PYVX:PYVX_18180:PYVX_18170:scaffold_275:3276:4022
Length=746

 Score = 43.1 bits (100),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  51   VTFELHPFEDREAFKHWLSESQDEFATSFGVDSKATKH  88
            V  E+H F DR+AF+ WL+ S++ FA++FG +S A  H
Sbjct  632  VEHEIHRFPDRDAFRAWLAASREAFASAFGDESAAVTH  745

>PHKE:PHYKE_3243:PHYKE_3244:scaffold_15:77131:78714
Length=1583

 Score = 43.1 bits (100),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 81/197 (41%), Gaps = 22/197 (11%)
 Frame = -3

Query  301   KGTKQITTRDVVIAVGGRPKELTCPGGEHAI-------SSDDIFWMKKKEPGKTLVVGAS  353
             +G  ++ +  ++++ G   K L  PG E  +       ++ D F+ + KE    +V+G  
Sbjct  1215  EGMGELVSETLILSTGASAKYLGIPGEETNVGRGVSTCATCDGFFFRNKE---IIVIGGG  1045

Query  354   YVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITK  413
               ALE A FL   G  V ++ R   LRG  + M D+          +E      P  +  
Sbjct  1044  DSALEEASFLSRFGSKVTLVHRREELRG-SKIMQDR----ARSNEKVEMALNRTPLEVLA  880

Query  414   LENGQLLVK-WTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVK--  470
              +NG   +K   +E GE        V  A G  P+   L     G    ++ G I     
Sbjct  879   GDNGVTGLKVLNNETGEEEIIPASGVFVAIGHTPNTGFL----GGQITTDEHGYILTTPG  712

Query  471   NEQTSTPNIYAIGDVID  487
               +T+ P ++A GDV D
Sbjct  711   TSETNIPGVFACGDVQD  661

>PHIF:PITG_01778:PITG_01781:NW_003303757.1:4157809:4190732
Length=32923

 Score = 38.1 bits (87),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (48%), Gaps = 19/103 (18%)
 Frame = -2

Query  95   WSSNPTAFVGGCDDLLTYFRSGVGVGNP-----QGATPNGS-PTEKTAEADVPMSETSVE  148
            + S P +FV     +L   RS V    P     + AT   +  TE +AE + P+++T  E
Sbjct  279  FQSVPDSFV-----MLHLRRSAVVASRPSHTLLRAATARSTFSTEDSAE-NRPLTDTLRE  118

Query  149  ETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  191
                      +  +DL+VIG G  G  C+ ++A  G+ V ++D
Sbjct  117  L-------RASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID  10

>HYAP:HYAP_07094:HYAP_07095:scaffold_59:140288:158852
Length=18564

 Score = 32.3 bits (72),  Expect(2) = 1.0, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  7      LAETLVTSPDSSVATFHIAGWKTC  30
              L ++L  + DSS   +HIAGW+TC
Sbjct  18385  LNKSLAMASDSSAPVYHIAGWRTC  18456

 Score = 22.3 bits (46),  Expect(2) = 1.0, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  31     PSFVKAGEVATA  42
              PSFVKA EVA+A
Sbjct  18528  PSFVKAKEVASA  18563

>PYUU:PYU1_G006359:PYU1_G006358:scaffold_2007:651698:655717
Length=4019

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 46/103 (45%), Gaps = 14/103 (14%)
 Frame = +1

Query  189  VLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAP  248
            +L Y+ P+       +     +  C P +L+ Q  L   V+H+   N   N++ GDG A 
Sbjct  622  LLGYLSPTHDD----MNPVTTHASCFPAQLLSQCPLGDHVLHYGAKNA--NITDGDGLAY  783

Query  249  TF-NWKQLVSNVDGYIKSI------NFKYKVELRSKYVKYENF  284
             F  WK  V NV  +   +       +K  V LR+K+  Y +F
Sbjct  784  AFGRWKTPVRNVKFHTDVVADTKWQTWKANV-LRTKWWHYSSF  909

>PHSO:PHYSO_259444:PHYSO_489418:scaffold_3:5402135:5403962
Length=1827

 Score = 33.1 bits (74),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  162   YDLVVIGGGSGGLACSKEAASFGQKVCVLD  191
             +DL+VIG G  G  C+ ++A  G+ V ++D
Sbjct  1728  FDLIVIGSGPAGQKCAIDSAKHGKSVAIID  1817

Lambda      K        H        a         alpha
   0.316    0.133    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 91067921012

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40