Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:1026341219813008072e-95
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:130980776211331342632e-41
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:1050934171581658e-13
PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937842940331241e-08
SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383243488991462e-08
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:722373146481182e-06
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PHALS_06477

Length=1166
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634               315        2e-95
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807          105        2e-41
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093               68.2       8e-13
PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937                    52.4       1e-08
SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383                  60.8       2e-08
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237                    50.1       2e-06

>PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634
Length=1315

 Score = 315 bits (807),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 210/300 (70%), Gaps = 37/300 (12%)
 Frame = +1

Query  14   VGMEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQA  73
            V MEKVQQ +HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RHS+V+T AEVQA
Sbjct  121  VKMEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANSSPMRHSAVVTTAEVQA  300

Query  74   FHALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRRGDSR  133
            F+A+LQ+TE+ELRAKAELVLNG++    +      Q  T LPAV+VA P  IK R G  R
Sbjct  301  FNAILQRTETELRAKAELVLNGMV----NSSFEPSQSGTVLPAVTVANPPSIKRRSGYRR  468

Query  134  ADEFGHINRIDNNSTSMEFFRQ---------------------QFRNNRVEIRQSLMTSP  172
            A +     R D +S  MEFFR+                     QFRN+ VEIRQSLM SP
Sbjct  469  AYK---PRRTDASSIPMEFFREVNGGVNVVLC*NAILM*SCL*QFRNSSVEIRQSLMPSP  639

Query  173  ENWRRKSG---ARRVRKKTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLP  229
            ++W+R  G    R +RKKTTQH RLLP VNKADP+ PTP+LREEDA  G+ NLVTRGFLP
Sbjct  640  QHWQRHLGLQHGRLMRKKTTQHCRLLPSVNKADPTAPTPELREEDAKHGVFNLVTRGFLP  819

Query  230  AYADLTPAFAGPNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFR  289
            AYADLTPAFA      +G+    +K RAT IYDRS++SAR TP+  S G+NLA LKFD R
Sbjct  820  AYADLTPAFA------SGANDGVMKQRATRIYDRSEQSARPTPITQSTGYNLAALKFDLR  981

>PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807
Length=1464

 Score = 105 bits (263),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 78/134 (58%), Gaps = 10/134 (7%)
 Frame = +3

Query  155   QQFRNNRVEIRQSLMTSPENWRRKSGARRVRKKTTQHYRLLPCVNKADPSEPTPDLREED  214
             Q+F+N+ VE++ +  +     +R +  R V+ K T H RLLP VNK DPS P P+L E D
Sbjct  762   QRFQNSAVELKPTPFSP---VQRITKGRLVKSKMTHHARLLPSVNKCDPSAPPPELFEHD  932

Query  215   ATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCALKHRATYIYDRSKRSARCTPLV  274
             A  G+ +L+ RGF+P  ADLTPAF         S G  +K+  T IY+R ++  R  P  
Sbjct  933   AKSGMFSLINRGFVPVGADLTPAFV-------NSHGSIIKNSKTRIYNRQEQPIRPMPYT  1091

Query  275   YSIGFNLAGLKFDF  288
                GF++A LKFD 
Sbjct  1092  NPSGFSMASLKFDL  1133

 Score = 88.2 bits (217),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 88/145 (61%), Gaps = 9/145 (6%)
 Frame = +2

Query  10   SAKAVGMEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNA  69
            S  A+ M+++QQ +HVEDVGR+LL+TQEQLR MREQM +  A+    +  +        A
Sbjct  245  SIGALEMDQIQQQHHVEDVGRILLQTQEQLRLMREQMASTTAATTPTRFHQ-----TAPA  409

Query  70   EVQAFHALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRR  129
            +V AF  +LQ+ E E+RAKAELVLNG++  + S   +     + LPAV V++ SP   R+
Sbjct  410  DVAAFQEILQRAELEIRAKAELVLNGLV--NTSSQAAAASTLSTLPAV-VSSSSPTT-RK  577

Query  130  GDSRADEFGHINRIDNNSTSMEFFR  154
             +  A    H +R +N    +++FR
Sbjct  578  QNLGAFLVRHQSRSENYEMDLDYFR  652

>PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093
Length=226

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  1105  ALSYLRTALEVIGREAGATKGIVSSSSRSVLGNFADVLSTVRASTGGGSSNRLGQVHR  1162
             AL++LRTALEVIGRE GAT  + SS+SR V GNFA VLS VRA+TGG   +RLG++ R
Sbjct  4     ALAFLRTALEVIGREVGATIEMSSSTSRPVSGNFAHVLSAVRAATGG--KDRLGKMRR  171

>PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937
Length=1113

 Score = 52.4 bits (124),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  16   MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTA  48
            ME++QQ +HVEDVGR+LL TQ+QLR +REQ++A
Sbjct  940  MEQLQQQHHVEDVGRILLHTQDQLRHLREQLSA  842

 Score = 31.6 bits (70),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = -2

Query  63   SSVITNAEVQAFHALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAV  117
            +++++N        +LQ+ E+ELR KAELVL  ++ S  +  ++    +  LP+V
Sbjct  752  NALLSNNAGAEIEEILQRAENELRMKAELVLGNLVTSGPAAASATQSSDRSLPSV  588

>SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383
Length=799

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 34/99 (34%)
 Frame = +3

Query  16   MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
            M+++ Q YHVEDVGR+LL+ Q++LR MREQ+  +                  N +V A  
Sbjct  243  MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDVDALQ  371

Query  76   ALLQQTESELRAKAE-----------------LVLNGII  97
            A+L++ E +LR+KAE                 +VLNG++
Sbjct  372  AILERAELDLRSKAEVRPPVSAQAAQQPHAA*IVLNGVV  488

>PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237
Length=236

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +3

Query  1117  GREAGATKGIVSSSSRSV-LGNFADVLSTVRASTGGGSSNRLGQVHRM  1163
             GREAGAT  + +S S S   GNFA VLS +RASTGGG  +RLG+  R+
Sbjct  3     GREAGATIEMAASRSHSAHSGNFAQVLSAIRASTGGGKGDRLGKARRL  146

Lambda      K        H        a         alpha
   0.320    0.132    0.389    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 178800311340

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40