Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
HYAP:HYAP_07105:HYAP_07106:scaffold_59:195834:19856397218083005568e-62
ALCA:CCI44112:CCI44113:scaffold_62:27359:2818652291932472e-22
PHCA:PHYCA_557302:PHYCA_41956:scaffold_106:87695:88164247420581168e-06
PHKE:PHYKE_8545:PHYKE_8546:scaffold_6:3994:762654468146960.017
HYAP:HYAP_04644:HYAP_04645:scaffold_30:323257:32638622252488109920.053
PHCA:PHYCA_564492:PHYCA_533565:scaffold_15:162572:1642411302147257910.054
PHCA:PHYCA_535125:PHYCA_508065:scaffold_32:213616:21862352566246910.063
PHKE:PHYKE_9299:PHYKE_9300:scaffold_36:84544:872601443164069840.48
PYAP:PYAP_15582:PYAP_15583:scaffold_65:26651:309513122333775791.8
PYUU:PYU1_G006059:PYU1_G006058:scaffold_2028:642403:64279310635184715.1
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= CCA22845

Length=431
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP:HYAP_07105:HYAP_07106:scaffold_59:195834:198563                  218        8e-62
ALCA:CCI44112:CCI44113:scaffold_62:27359:28186                        99.8       2e-22
PHCA:PHYCA_557302:PHYCA_41956:scaffold_106:87695:88164                49.3       8e-06
PHKE:PHYKE_8545:PHYKE_8546:scaffold_6:3994:7626                       41.6       0.017
HYAP:HYAP_04644:HYAP_04645:scaffold_30:323257:326386                  40.0       0.053
PHCA:PHYCA_564492:PHYCA_533565:scaffold_15:162572:164241              39.7       0.054
PHCA:PHYCA_535125:PHYCA_508065:scaffold_32:213616:218623              39.7       0.063
PHKE:PHYKE_9299:PHYKE_9300:scaffold_36:84544:87260                    37.0       0.48 
PYAP:PYAP_15582:PYAP_15583:scaffold_65:26651:30951                    35.0       1.8  
PYUU:PYU1_G006059:PYU1_G006058:scaffold_2028:642403:642793            32.0       5.1  

>HYAP:HYAP_07105:HYAP_07106:scaffold_59:195834:198563
Length=2729

 Score = 218 bits (556),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 169/300 (56%), Gaps = 60/300 (20%)
 Frame = -1

Query  64    SFTDTWIEDILARPLST---DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
             ++T+ W +++L  P      +  L+ ALCFAGIPKELRGR W W+LGN LQ+NE+LF IC
Sbjct  1808  TYTEVWRDEVLTLPSGGTRDNVPLLHALCFAGIPKELRGRAWAWILGNTLQVNEDLFKIC  1629

Query  121   KDRAEAVRSEIALQKEVDAIM----KLSAGLSALATQS----------------TDFSED  160
             K RA+AV  E++L++ VD  M     +S G +++  +S                T   + 
Sbjct  1628  KARAQAVLMEMSLKRNVDHSMIETPTVSPGDASIILESPVRSDSNLSSASSASGTTVEDV  1449

Query  161   EA----DDTKASSSTTRLSTPCLTASENEEIDMIRLP------------PPTETLQNLAG  204
             EA    DD++ S  T   ++    AS   +  +I +             P    L +  G
Sbjct  1448  EASLVIDDSETSQVTDDTASAAGDASTMRDPLLIGISDRKRARRSSTVLPVQNMLHDAVG  1269

Query  205   VAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGL  264
             +AE LVA  ERS+ LV+VD+ RTF +HP+FQ G  G ERT EVL AYICYRPDLGYVQ  
Sbjct  1268  IAEMLVAHGERSIKLVNVDMPRTFGHHPLFQPGAEGTERTTEVLEAYICYRPDLGYVQ--  1095

Query  265   NCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRLQERR  324
                                GMSYLAA +C HMD+F AFKAL ALMS++LLFDMFRL+  R
Sbjct  1094  -------------------GMSYLAAILCFHMDSFTAFKALVALMSSSLLFDMFRLEATR  972

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 8/85 (9%)
 Frame = -1

Query  347  MAKALLKVYERNLLELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGD  406
            ++  LL +++ +LL ++  +MMRLLH FP   S+  LF A+ +V+LSC+EI ++L+    
Sbjct  515  LSAGLLSLFQDSLLAMEVQDMMRLLHNFPRTTSSQELFAAISSVSLSCQEITDLLAGG--  342

Query  407  EDTLTRRVWSPDSFREAEITFPDTY  431
                  ++WSPD  R+  + +PDTY
Sbjct  341  ------KLWSPDEVRQVPVKYPDTY  285

>ALCA:CCI44112:CCI44113:scaffold_62:27359:28186
Length=827

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 63/93 (68%), Gaps = 13/93 (14%)
 Frame = -3

Query  339  FCNEFHTKMAKALLKVYERNLLELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEIN  398
            +C  FH  ++   + V  R+ + L              DIS DV+FTAL +VALSCEEIN
Sbjct  291  YCTSFHRYISDPRMHVN*RSSVAL*-------------DISTDVIFTALHDVALSCEEIN  151

Query  399  EILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
             ILSSDG++DTLTRRVWSPDSFR+ EITFPDTY
Sbjct  150  GILSSDGNDDTLTRRVWSPDSFRQVEITFPDTY  52

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -1

Query  302  FKALSALMSTNLLFDMFRLQERR  324
            FKALSALMSTNLLFDMFRLQERR
Sbjct  827  FKALSALMSTNLLFDMFRLQERR  759

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -2

Query  324  RRASVRYITDRRLKYFCNEFHTKMAK-ALLKVYERNLLELDEAEMMRLLHKFPS  376
            +RA V  IT R L     + +  M K ALLKV+++  LELDEA +MRLLHKFPS
Sbjct  433  KRA*VNCITARHLCTCDYKLYAIMKK*ALLKVHKKMFLELDEAAVMRLLHKFPS  272

>PHCA:PHYCA_557302:PHYCA_41956:scaffold_106:87695:88164
Length=469

 Score = 49.3 bits (116),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  79   STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKE  136
            + D+ L  +L   GIP  +R RVW   +GNKL+I  E+F I + RA A + + A +K+
Sbjct  247  NKDTPLAHSLWRQGIPPSIRARVWPMAIGNKLKITPEMFKIYRRRAAAYKKDRANEKD  420

>PHKE:PHYKE_8545:PHYKE_8546:scaffold_6:3994:7626
Length=3632

 Score = 41.6 bits (96),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +DVD+HRT A     Q     +   R +L AY  Y P+LGY QGLN
Sbjct  544  IDVDLHRTVADDDKEQWTEEKSRMMRRILVAYSFYNPNLGYCQGLN  681

>HYAP:HYAP_04644:HYAP_04645:scaffold_30:323257:326386
Length=3129

 Score = 40.0 bits (92),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 46/109 (42%), Gaps = 24/109 (22%)
 Frame = +2

Query  204   GVAEKLVAT---CERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGY  260
             G+ E+L+A+      +   +DVD+HRT +           +   R VL AY  Y P LGY
Sbjct  2225  GLYERLLASNAEITEATRQIDVDLHRTVSDEDKEWWSDEKSGMMRRVLVAYSFYNPGLGY  2404

Query  261   VQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALM  309
              QGLN                     Y+ A I  ++D   AF  L A++
Sbjct  2405  CQGLN---------------------YIVARILQYLDEEEAFYLLIAII  2488

>PHCA:PHYCA_564492:PHYCA_533565:scaffold_15:162572:164241
Length=1669

 Score = 39.7 bits (91),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +3

Query  209   LVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
             L+A+  R V L   D+ RT +   +F  GG   ++   +L  +    PD+GYVQG+N
Sbjct  1302  LIAS*RRGVSLSQQDVFRTRSELVLFSGGGIVQQQMLYILFVFAKLHPDIGYVQGMN  1472

>PHCA:PHYCA_535125:PHYCA_508065:scaffold_32:213616:218623
Length=5007

 Score = 39.7 bits (91),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 25/46 (54%), Gaps = 0/46 (0%)
 Frame = +3

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +DVD+HRT A           A+  R VL AY  Y P LGY QGLN
Sbjct  525  IDVDLHRTVADEDKELWTEEKAQMMRRVLVAYSFYNPSLGYCQGLN  662

>PHKE:PHYKE_9299:PHYKE_9300:scaffold_36:84544:87260
Length=2716

 Score = 37.0 bits (84),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (45%), Gaps = 3/69 (4%)
 Frame = +3

Query  197   ETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRP  256
             E   NL   AE +     R +   ++DI RTF +         G  + R +L AY    P
Sbjct  1443  EYYANLVKEAETMETDTFRQI---ELDIDRTFGHSGTTVCTDSGRAQLRRILRAYSLRNP  1613

Query  257   DLGYVQGLN  265
              +GY QGLN
Sbjct  1614  SVGYCQGLN  1640

>PYAP:PYAP_15582:PYAP_15583:scaffold_65:26651:30951
Length=4300

 Score = 35.0 bits (79),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (47%), Gaps = 8/75 (11%)
 Frame = +2

Query  196   TETLQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
             T+ L N  GV    + T    CE ++     DI RTF  H +F +    G      VL A
Sbjct  3122  TQMLLNNPGVYRDFLQTKRVPCEETI---ARDIGRTFPKHYLFNDRSSMGQCALMNVLKA  3292

Query  251   YICYRPDLGYVQGLN  265
             Y  + P++GY QG+ 
Sbjct  3293  YSLHDPEVGYCQGMG  3337

>PYUU:PYU1_G006059:PYU1_G006058:scaffold_2028:642403:642793
Length=390

 Score = 32.0 bits (71),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 35/84 (42%), Gaps = 12/84 (14%)
 Frame = -1

Query  223  DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL---  279
            D+ RTF   P F     G  +   VL A   +  D+GY Q +  K      F D T    
Sbjct  351  DVDRTFPTIPFFSGDSDGKRQLGNVLKAVALHATDIGYCQ-VRLKQSELRAF-DKTFSV*  178

Query  280  -------LFLTGMSYLAAAICLHM  296
                     L GM+Y+AAA+ L +
Sbjct  177  LL*QRIRYVLQGMNYVAAALLLML  106

Lambda      K        H        a         alpha
   0.320    0.133    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 53884389328

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40