Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PYVX:scaffold_275637469732009953e-118
PLHA:NW_020189861.1184651518470451776901e-77
PHIF:NW_003303697.13948493953701746891e-77
PHPA:scaffold_632446972452181746863e-77
PHCA:scaffold_8495232957381696821e-76
PHRA:scaffold_561609221614461756784e-76
PHSO:scaffold_1279360327941061686722e-75
PHKE:scaffold_9860418609421756592e-73
PYIR:scaffold_50241546361615449e-65
PYIR:scaffold_81104621109441615771e-62
PHCA:scaffold_79054689059471615708e-62
PHPA:scaffold_226853726858511615691e-61
PHKE:scaffold_622347439531615681e-61
PYUU:scaffold_2037129949012999721615662e-61
PHRA:scaffold_10612931134101615653e-61
PHIF:NW_003303730.16969206973991615654e-61
PHSO:scaffold_148188178192961615628e-61
PHRA:scaffold_267934298211615611e-60
HYAP:scaffold_591611921617161755592e-60
PYIR:scaffold_2249143419161615521e-59
PHRA:scaffold_7925674261501605522e-59
PYIR:scaffold_48281176081645074e-59
PHSO:scaffold_3518133186121615486e-59
PHSO:scaffold_56819866824651615486e-59
PLHA:NW_020187034.194689951681615399e-58
PHKE:scaffold_7613888671615327e-57
PHPA:scaffold_661626201631051635222e-55
PHPA:scaffold_46348139661635222e-55
PHPA:scaffold_203635873640661615142e-54
PHIF:NW_003303626.1267289267543853412e-53
PLHA:NW_020189073.134612350941625001e-52
PHPA:scaffold_391510321515291674884e-51
PYAR:scaffold_3459207425621634812e-50
PYIW:scaffold_711517656581624788e-50
PHCA:scaffold_672193512198451664762e-49
PYAP:scaffold_56012578130661634762e-49
PHPA:scaffold_164887594892561664717e-49
PHIF:NW_003303741.1157528415757841674682e-48
PHSO:scaffold_121684171689111664654e-48
PHSO:scaffold_4437393343743491404593e-47
PHKE:scaffold_35414314148081664567e-47
PHRA:scaffold_333705733710671664559e-47
PHIF:NW_003303754.1354484135453411674433e-45
PHSO:scaffold_6437920383121324241e-42
PHRA:scaffold_49483248560801963e-32
PHRA:scaffold_289216881924801961e-31
PYAP:scaffold_18217401943682108e-30
PHSO:scaffold_11202260120228971043071e-27
PHIF:NW_003303747.1274851527488921272902e-25
PYIW:scaffold_70031654971222404e-21
PHIF:NW_003304531.14307531092487e-21
PHRA:scaffold_92179752183581342537e-21
PYIR:scaffold_155250028621322483e-20
PHPA:scaffold_5102059010209731342483e-20
PYAP:scaffold_21625622259841322421e-19
PHIF:NW_003303753.1377398837745031812421e-19
PHCA:scaffold_931443821447441272412e-19
PHRA:scaffold_43331383335031282351e-18
PHSO:scaffold_2255068525510531292332e-18
PHCA:scaffold_241719781723611342322e-18
PHKE:scaffold_22152734530991282313e-18
PHSO:scaffold_165218075222981712252e-17
PHKE:scaffold_949265130161282242e-17
PYAR:scaffold_88368640451312242e-17
PHIF:NW_003303738.1105849610589031412233e-17
PHKE:scaffold_39930729310941312233e-17
PLHA:NW_020187210.15497065502211832207e-17
PHRA:scaffold_41812490128011082181e-16
PHCA:scaffold_501509541513551412181e-16
PHPA:scaffold_45524775529951792181e-16
PHRA:scaffold_1234454048511082162e-16
PHCA:scaffold_223992433996351372162e-16
PHSO:scaffold_104930024933791312162e-16
PYIW:scaffold_360258530851712153e-16
PYAP:scaffold_1129368240051192143e-16
PHIF:NW_003303752.1206492720653311412135e-16
PHRA:scaffold_294739964743761322135e-16
PHCA:scaffold_23825043828151082135e-16
PHKE:scaffold_15542535429841572126e-16
PHPA:scaffold_123927533930641082127e-16
PHCA:scaffold_9881218815831282111e-15
PHKE:scaffold_25012789131691322101e-15
SADI:scaffold_13458416589131772092e-15
PHRA:scaffold_891242061245171082082e-15
PYUU:scaffold_20367131937135401272073e-15
PHIF:NW_003303391.18018880451892073e-15
APAS:scaffold_331213551218521802063e-15
PYIR:scaffold_1319561160721652046e-15
SAPA:scaffold_311351011355951752037e-15
APIN:scaffold_99107799112791772021e-14
PHRA:scaffold_521024061027981372011e-14
PYIR:scaffold_87112411129351812002e-14
PYUU:scaffold_20326904406909401741983e-14
PYIW:scaffold_1535654969531411974e-14
PHIF:NW_003303506.1191423631571974e-14
PHRA:scaffold_372853052855921001965e-14
PYAP:scaffold_1879968103871571966e-14
PHKE:scaffold_7252765531361311941e-13
PYIW:scaffold_3644138618891741921e-13
PYVX:scaffold_8941555471351921e-13
PYUU:scaffold_20294775694780751751922e-13
PYIR:scaffold_281288913891711902e-13
PLHA:NW_020189511.14309634314781811922e-13
PYUU:scaffold_20386012736017761901912e-13
PLHA:NW_020186941.129751301401371903e-13
PHRA:scaffold_13195857963421761903e-13
HYAP:scaffold_17636799370891011894e-13
PYVX:scaffold_25104027641341844e-13
PYUU:scaffold_20288213048216961351885e-13
PHRA:scaffold_31314446147451041885e-13
PYVX:scaffold_38525727261221371886e-13
PHRA:scaffold_2877515778141041876e-13
PYAP:scaffold_55819399198151471877e-13
PYIW:scaffold_2639340338521641868e-13
PYVX:scaffold_639199723171111868e-13
PHPA:scaffold_460459719931859e-13
PYVX:scaffold_563772981001381861e-12
PYAP:scaffold_583618867001841851e-12
PYIR:scaffold_349771812331781821e-12
PYUU:scaffold_14021475881479591391842e-12
ALCA:scaffold_16827529279061391832e-12
PLHA:NW_020187244.1202276420231411311832e-12
PYVX:scaffold_12119546200101611832e-12
PHSO:scaffold_3111283118041791832e-12
ALLA:FR82407647601479781391832e-12
PYAR:scaffold_1366127016291311823e-12
PYAR:scaffold_21219994203261211823e-12
PHCA:scaffold_88238608242221311823e-12
PHRA:scaffold_105154671154871681814e-12
PHCA:scaffold_401641321645001361814e-12
PLHA:NW_020188258.1135621813565951311805e-12
PYIR:scaffold_1744158220221531796e-12
PHIF:NW_003303757.153260115326208721797e-12
PHSO:scaffold_3643337964337411311789e-12
PYIR:scaffold_573538657631391789e-12
PLHA:NW_020187410.1331436701261779e-12
PYVX:scaffold_504235042556691281e-11
PYAP:scaffold_63015037155251711771e-11
PYAR:scaffold_463917411995891751e-11
PYIR:scaffold_582135151771641e-11
PYAP:scaffold_28914376146841081761e-11
PYIW:scaffold_182152218691311761e-11
PHRA:scaffold_233804923808781371761e-11
HYAP:scaffold_85376535380091251752e-11
PYAR:scaffold_44523568591741732e-11
PYUU:scaffold_20122071172074731251752e-11
PHKE:scaffold_49991009297701752e-11
PHKE:scaffold_115117632038961742e-11
PYIR:scaffold_973439248861761742e-11
PHSO:scaffold_155731225736101731743e-11
PYIR:scaffold_81453249031281743e-11
PHKE:scaffold_2239024396682261743e-11
PYAR:scaffold_3482173921011281733e-11
PHCA:scaffold_392000792003721021733e-11
PYUU:scaffold_17896981896986081511734e-11
PYUU:scaffold_20332772327929711394e-11
PYAR:scaffold_37017514178731241715e-11
PHCA:scaffold_14646327981716e-11
PHPA:scaffold_764374743974821707e-11
PHPA:scaffold_144624694462666701708e-11
PLHA:NW_020188562.19290379295461771708e-11
APIN:scaffold_11823074823277751349e-11
PHSO:scaffold_8123809012384581281691e-10
PYIW:scaffold_3542137517431381671e-10
PHPA:scaffold_8187414877221071681e-10
PYVX:scaffold_30515403157591271672e-10
PYAP:scaffold_2310576109471291672e-10
PHCA:scaffold_4924767251321311653e-10
PYIR:scaffold_2511147519301571634e-10
PYAP:scaffold_9427016273751261635e-10
PHRA:scaffold_1232481525015711635e-10
PYIR:scaffold_2176225225751121625e-10
PYAR:scaffold_67472747543941636e-10
PYAR:scaffold_505235531801636e-10
PYIR:scaffold_1332682872411461626e-10
PHCA:scaffold_116511676516701751626e-10
PYAR:scaffold_48872967991771617e-10
PYIR:scaffold_27793112241031618e-10
PHIF:NW_003303743.1148099414814071531619e-10
PHRA:scaffold_5140105404611271619e-10
PYAP:scaffold_7421752375711619e-10
PYAP:scaffold_793275132211601611e-09
HYAP:scaffold_46374427642711611e-09
PYIR:scaffold_45223858242921581591e-09
PYVX:scaffold_1070288334101801591e-09
PHPA:scaffold_194961049810711592e-09
PYAP:scaffold_209224827601861592e-09
SAPA:scaffold_194646014649481291592e-09
PHPA:scaffold_95383275386711211592e-09
SAPA:scaffold_321166041169511321582e-09
PHKE:scaffold_88436523858731282e-09
PYAP:scaffold_744450648711261582e-09
PHKE:scaffold_206311034751301582e-09
PYIR:scaffold_15247816481511181582e-09
PHPA:scaffold_8181632718168481791563e-09
PYAR:scaffold_1918730936731564e-09
SADI:scaffold_911575381579331481555e-09
SADI:scaffold_272908322913231831546e-09
SADI:scaffold_264154019051381537e-09
PHCA:scaffold_34476374481581791538e-09
PHIF:NW_003303594.17915279352721538e-09
PHIF:NW_003303637.1182840183040721538e-09
PYIW:scaffold_8782075871321521e-08
PYAP:scaffold_1054245546821511502e-08
PYIW:scaffold_78311207115091031502e-08
PYIR:scaffold_9989885102261201483e-08
PHKE:scaffold_2794775548033971484e-08
PHKE:scaffold_19112398127481211474e-08
PYAP:scaffold_12353515538741241474e-08
PYAR:scaffold_5931577715929511475e-08
PYAR:scaffold_4801723417431701465e-08
PYIW:scaffold_27016747171001181465e-08
PYIR:scaffold_136142174480921466e-08
PYVX:scaffold_6981312613314671457e-08
PHRA:scaffold_4471954724751791449e-08
PYAP:scaffold_983359939491221449e-08
PYUU:scaffold_2007550844551119961449e-08
PHRA:scaffold_532190124101761441e-07
PYAR:scaffold_5510157105461341441e-07
SAPA:scaffold_123062303065591141441e-07
APAS:scaffold_49302651302824621191e-07
PHRA:scaffold_55597869998711281e-07
PYIW:scaffold_195244114680941431e-07
PYAR:scaffold_1613712674701231431e-07
PHRA:scaffold_14385081385278701422e-07
PYVX:scaffold_663125417571681412e-07
SADI:scaffold_221346921350721401412e-07
PYUU:scaffold_203183550840681781412e-07
PYAR:scaffold_68104639361691373e-07
PYAR:scaffold_2617110814731271403e-07
PYIR:scaffold_54815532160021651403e-07
PYIR:scaffold_206610891328851393e-07
PYVX:scaffold_29751435351311344e-07
PYIW:scaffold_50601896471611374e-07
PYAP:scaffold_133915731851971385e-07
PHIF:NW_003303307.174210741191385e-07
PYIW:scaffold_532833187231381385e-07
PYVX:scaffold_62220562286771369e-07
PYAR:scaffold_266856990331631361e-06
PYVX:scaffold_34123522239741551361e-06
PYAR:scaffold_1972467751171491341e-06
PYVX:scaffold_16402786521331322e-06
PYIW:scaffold_5066121715791211312e-06
PLHA:NW_020188786.12424902428431251323e-06
SADI:scaffold_210201871020351591314e-06
PHPA:scaffold_21660120660401981304e-06
PYAR:scaffold_3952708980961295e-06
PYIR:scaffold_4627352908621305e-06
PYIR:scaffold_212220332302951295e-06
PYAR:scaffold_226581511171051296e-06
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PYVX_18173

Length=500
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  387        3e-118
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  270        1e-77 
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  270        1e-77 
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  268        3e-77 
PHCA:scaffold_84 PHYCAscaffold_84                                     267        1e-76 
PHRA:scaffold_56                                                      265        4e-76 
PHSO:scaffold_1                                                       263        2e-75 
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  258        2e-73 
PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:...  214        9e-65 
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  226        1e-62 
PHCA:scaffold_7 PHYCAscaffold_7                                       224        8e-62 
PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 ...  223        1e-61 
PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:Phy...  223        1e-61 
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  222        2e-61 
PHRA:scaffold_106                                                     222        3e-61 
PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 ge...  222        4e-61 
PHSO:scaffold_14                                                      221        8e-61 
PHRA:scaffold_267                                                     220        1e-60 
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  219        2e-60 
PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:...  217        1e-59 
PHRA:scaffold_79                                                      217        2e-59 
PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:...  199        4e-59 
PHSO:scaffold_35                                                      215        6e-59 
PHSO:scaffold_5                                                       215        6e-59 
PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig:...  212        9e-58 
PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig superc...  209        7e-57 
PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 ...  205        2e-55 
PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 ...  205        2e-55 
PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 ...  202        2e-54 
PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 g...  135        2e-53 
PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig:...  197        1e-52 
PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 ...  192        4e-51 
PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:...  189        2e-50 
PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:pi...  188        8e-50 
PHCA:scaffold_67 PHYCAscaffold_67                                     187        2e-49 
PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:p...  187        2e-49 
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  186        7e-49 
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  184        2e-48 
PHSO:scaffold_12                                                      183        4e-48 
PHSO:scaffold_4                                                       181        3e-47 
PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig superc...  180        7e-47 
PHRA:scaffold_33                                                      179        9e-47 
PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 gen...  175        3e-45 
PHSO:scaffold_64                                                      167        1e-42 
PHRA:scaffold_494                                                     80.1       3e-32 
PHRA:scaffold_2892                                                    80.1       1e-31 
PYAP:scaffold_182 pag1_scaffold_182 dna:supercontig supercontig:p...  85.5       8e-30 
PHSO:scaffold_11                                                      122        1e-27 
PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 ge...  116        2e-25 
PYIW:scaffold_7003 piw_scaffold_7003 dna:supercontig supercontig:...  97.1       4e-21 
PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 ...  100        7e-21 
PHRA:scaffold_9                                                       102        7e-21 
PYIR:scaffold_155 pir_scaffold_155 dna:supercontig supercontig:pi...  100        3e-20 
PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 u...  100        3e-20 
PYAP:scaffold_216 pag1_scaffold_216 dna:supercontig supercontig:p...  97.8       1e-19 
PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 gen...  97.8       1e-19 
PHCA:scaffold_93 PHYCAscaffold_93                                     97.4       2e-19 
PHRA:scaffold_4                                                       95.1       1e-18 
PHSO:scaffold_2                                                       94.4       2e-18 
PHCA:scaffold_24 PHYCAscaffold_24                                     94.0       2e-18 
PHKE:scaffold_221 scf_22126_221.1 dna:supercontig supercontig:Phy...  93.6       3e-18 
PHSO:scaffold_16                                                      91.3       2e-17 
PHKE:scaffold_949 scf_22126_949.1_contig_1 dna:supercontig superc...  90.9       2e-17 
PYAR:scaffold_88 par_scaffold_88 dna:supercontig supercontig:par_...  90.9       2e-17 
PHIF:NW_003303738.1 Phytophthora infestans T30-4 supercont1.21 ge...  90.5       3e-17 
PHKE:scaffold_399 scf_22126_399.1 dna:supercontig supercontig:Phy...  90.5       3e-17 
PLHA:NW_020187210.1 Plasmopara halstedii genome assembly, contig:...  89.4       7e-17 
PHRA:scaffold_418                                                     88.6       1e-16 
PHCA:scaffold_50 PHYCAscaffold_50                                     88.6       1e-16 
PHPA:scaffold_4 NW_008648990.1 Phytophthora parasitica INRA-310 u...  88.6       1e-16 
PHRA:scaffold_1234                                                    87.8       2e-16 
PHCA:scaffold_22 PHYCAscaffold_22                                     87.8       2e-16 
PHSO:scaffold_10                                                      87.8       2e-16 
PYIW:scaffold_360 piw_scaffold_360 dna:supercontig supercontig:pi...  87.4       3e-16 
PYAP:scaffold_1129 pag1_scaffold_1129 dna:supercontig supercontig...  87.0       3e-16 
PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 gen...  86.7       5e-16 
PHRA:scaffold_29                                                      86.7       5e-16 
PHCA:scaffold_2 PHYCAscaffold_2                                       86.7       5e-16 
PHKE:scaffold_155 scf_22126_155.1 dna:supercontig supercontig:Phy...  86.3       6e-16 
PHPA:scaffold_12 NW_008648998.1 Phytophthora parasitica INRA-310 ...  86.3       7e-16 
PHCA:scaffold_98 PHYCAscaffold_98                                     85.9       1e-15 
PHKE:scaffold_250 scf_22126_250.1 dna:supercontig supercontig:Phy...  85.5       1e-15 
SADI:scaffold_134 supercont1.134 dna:supercontig supercontig:Sap_...  85.1       2e-15 
PHRA:scaffold_89                                                      84.7       2e-15 
PYUU:scaffold_2036 scf1117875582036 dna:supercontig supercontig:p...  84.3       3e-15 
PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 g...  84.3       3e-15 
APAS:scaffold_33 supercont1.33 dna:supercontig supercontig:Apha_a...  84.0       3e-15 
PYIR:scaffold_1319 pir_scaffold_1319 dna:supercontig supercontig:...  83.2       6e-15 
SAPA:scaffold_31 supercont2.31 dna:supercontig supercontig:ASM151...  82.8       7e-15 
APIN:scaffold_9 supercont1.9 dna:supercontig supercontig:Apha_inv...  82.4       1e-14 
PHRA:scaffold_52                                                      82.0       1e-14 
PYIR:scaffold_871 pir_scaffold_871 dna:supercontig supercontig:pi...  81.6       2e-14 
PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:p...  80.9       3e-14 
PYIW:scaffold_1535 piw_scaffold_1535 dna:supercontig supercontig:...  80.5       4e-14 
PHIF:NW_003303506.1 Phytophthora infestans T30-4 supercont1.253 g...  80.5       4e-14 
PHRA:scaffold_37                                                      80.1       5e-14 
PYAP:scaffold_187 pag1_scaffold_187 dna:supercontig supercontig:p...  80.1       6e-14 
PHKE:scaffold_72 scf_22126_72.1 dna:supercontig supercontig:PhyKe...  79.3       1e-13 
PYIW:scaffold_3644 piw_scaffold_3644 dna:supercontig supercontig:...  78.6       1e-13 
PYVX:scaffold_894 pve_scaffold_894 dna:supercontig supercontig:pv...  78.6       1e-13 
PYUU:scaffold_2029 scf1117875582029 dna:supercontig supercontig:p...  78.6       2e-13 
PYIR:scaffold_2812 pir_scaffold_2812 dna:supercontig supercontig:...  77.8       2e-13 
PLHA:NW_020189511.1 Plasmopara halstedii genome assembly, contig:...  78.6       2e-13 
PYUU:scaffold_2038 scf1117875582038 dna:supercontig supercontig:p...  78.2       2e-13 
PLHA:NW_020186941.1 Plasmopara halstedii genome assembly, contig:...  77.8       3e-13 
PHRA:scaffold_131                                                     77.8       3e-13 
HYAP:scaffold_176 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  77.4       4e-13 
PYVX:scaffold_2510 pve_scaffold_2510 dna:supercontig supercontig:...  75.5       4e-13 
PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:p...  77.0       5e-13 
PHRA:scaffold_313                                                     77.0       5e-13 
PYVX:scaffold_385 pve_scaffold_385 dna:supercontig supercontig:pv...  77.0       6e-13 
PHRA:scaffold_28                                                      76.6       6e-13 
PYAP:scaffold_558 pag1_scaffold_558 dna:supercontig supercontig:p...  76.6       7e-13 
PYIW:scaffold_2639 piw_scaffold_2639 dna:supercontig supercontig:...  76.3       8e-13 
PYVX:scaffold_639 pve_scaffold_639 dna:supercontig supercontig:pv...  76.3       8e-13 
PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310...  75.9       9e-13 
PYVX:scaffold_563 pve_scaffold_563 dna:supercontig supercontig:pv...  76.3       1e-12 
PYAP:scaffold_583 pag1_scaffold_583 dna:supercontig supercontig:p...  75.9       1e-12 
PYIR:scaffold_3497 pir_scaffold_3497 dna:supercontig supercontig:...  74.7       1e-12 
PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:p...  75.5       2e-12 
ALCA:scaffold_168 AcNc2_CONTIG_168_length_51659 dna:supercontig s...  75.1       2e-12 
PLHA:NW_020187244.1 Plasmopara halstedii genome assembly, contig:...  75.1       2e-12 
PYVX:scaffold_121 pve_scaffold_121 dna:supercontig supercontig:pv...  75.1       2e-12 
PHSO:scaffold_31                                                      75.1       2e-12 
ALLA:FR824076 dna:supercontig supercontig:ENA1:FR824076:1:147313:...  75.1       2e-12 
PYAR:scaffold_1366 par_scaffold_1366 dna:supercontig supercontig:...  74.7       3e-12 
PYAR:scaffold_212 par_scaffold_212 dna:supercontig supercontig:pa...  74.7       3e-12 
PHCA:scaffold_8 PHYCAscaffold_8                                       74.7       3e-12 
PHRA:scaffold_105                                                     74.3       4e-12 
PHCA:scaffold_40 PHYCAscaffold_40                                     74.3       4e-12 
PLHA:NW_020188258.1 Plasmopara halstedii genome assembly, contig:...  73.9       5e-12 
PYIR:scaffold_1744 pir_scaffold_1744 dna:supercontig supercontig:...  73.6       6e-12 
PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 gen...  73.6       7e-12 
PHSO:scaffold_3                                                       73.2       9e-12 
PYIR:scaffold_573 pir_scaffold_573 dna:supercontig supercontig:pi...  73.2       9e-12 
PLHA:NW_020187410.1 Plasmopara halstedii genome assembly, contig:...  72.8       9e-12 
PYVX:scaffold_50 pve_scaffold_50 dna:supercontig supercontig:pve_...  53.9       1e-11 
PYAP:scaffold_630 pag1_scaffold_630 dna:supercontig supercontig:p...  72.8       1e-11 
PYAR:scaffold_4639 par_scaffold_4639 dna:supercontig supercontig:...  72.0       1e-11 
PYIR:scaffold_5821 pir_scaffold_5821 dna:supercontig supercontig:...  67.8       1e-11 
PYAP:scaffold_289 pag1_scaffold_289 dna:supercontig supercontig:p...  72.4       1e-11 
PYIW:scaffold_182 piw_scaffold_182 dna:supercontig supercontig:pi...  72.4       1e-11 
PHRA:scaffold_23                                                      72.4       1e-11 
HYAP:scaffold_8 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8:...  72.0       2e-11 
PYAR:scaffold_4452 par_scaffold_4452 dna:supercontig supercontig:...  71.2       2e-11 
PYUU:scaffold_2012 scf1117875582012 dna:supercontig supercontig:p...  72.0       2e-11 
PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig superc...  72.0       2e-11 
PHKE:scaffold_1151 scf_22126_1151.1_contig_1 dna:supercontig supe...  71.6       2e-11 
PYIR:scaffold_973 pir_scaffold_973 dna:supercontig supercontig:pi...  71.6       2e-11 
PHSO:scaffold_15                                                      71.6       3e-11 
PYIR:scaffold_81 pir_scaffold_81 dna:supercontig supercontig:pir_...  71.6       3e-11 
PHKE:scaffold_22 scf_22126_22.1 dna:supercontig supercontig:PhyKe...  71.6       3e-11 
PYAR:scaffold_3482 par_scaffold_3482 dna:supercontig supercontig:...  71.2       3e-11 
PHCA:scaffold_39 PHYCAscaffold_39                                     71.2       3e-11 
PYUU:scaffold_1789 scf1117875581789 dna:supercontig supercontig:p...  71.2       4e-11 
PYUU:scaffold_2033 scf1117875582033 dna:supercontig supercontig:p...  58.2       4e-11 
PYAR:scaffold_370 par_scaffold_370 dna:supercontig supercontig:pa...  70.5       5e-11 
PHCA:scaffold_146 PHYCAscaffold_146                                   70.5       6e-11 
PHPA:scaffold_76 NW_008649062.1 Phytophthora parasitica INRA-310 ...  70.1       7e-11 
PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 u...  70.1       8e-11 
PLHA:NW_020188562.1 Plasmopara halstedii genome assembly, contig:...  70.1       8e-11 
APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_i...  63.2       1e-08 
PHSO:scaffold_8                                                       69.7       1e-10 
PYIW:scaffold_3542 piw_scaffold_3542 dna:supercontig supercontig:...  68.9       1e-10 
PHPA:scaffold_81 NW_008649067.1 Phytophthora parasitica INRA-310 ...  69.3       1e-10 
PYVX:scaffold_305 pve_scaffold_305 dna:supercontig supercontig:pv...  68.9       2e-10 
PYAP:scaffold_23 pag1_scaffold_23 dna:supercontig supercontig:pag...  68.9       2e-10 
PHCA:scaffold_49 PHYCAscaffold_49                                     68.2       3e-10 
PYIR:scaffold_2511 pir_scaffold_2511 dna:supercontig supercontig:...  67.4       4e-10 
PYAP:scaffold_94 pag1_scaffold_94 dna:supercontig supercontig:pag...  67.4       5e-10 
PHRA:scaffold_123                                                     67.4       5e-10 
PYIR:scaffold_2176 pir_scaffold_2176 dna:supercontig supercontig:...  67.0       5e-10 
PYAR:scaffold_674 par_scaffold_674 dna:supercontig supercontig:pa...  67.4       6e-10 
PYAR:scaffold_505 par_scaffold_505 dna:supercontig supercontig:pa...  67.4       6e-10 
PYIR:scaffold_1332 pir_scaffold_1332 dna:supercontig supercontig:...  67.0       6e-10 
PHCA:scaffold_11 PHYCAscaffold_11                                     67.0       6e-10 
PYAR:scaffold_4887 par_scaffold_4887 dna:supercontig supercontig:...  66.6       7e-10 
PYIR:scaffold_277 pir_scaffold_277 dna:supercontig supercontig:pi...  66.6       8e-10 
PHIF:NW_003303743.1 Phytophthora infestans T30-4 supercont1.16 ge...  66.6       9e-10 
PHRA:scaffold_51                                                      66.6       9e-10 
PYAP:scaffold_74 pag1_scaffold_74 dna:supercontig supercontig:pag...  66.6       9e-10 
PYAP:scaffold_793 pag1_scaffold_793 dna:supercontig supercontig:p...  66.6       1e-09 
HYAP:scaffold_463 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  66.6       1e-09 
PYIR:scaffold_452 pir_scaffold_452 dna:supercontig supercontig:pi...  65.9       1e-09 
PYVX:scaffold_1070 pve_scaffold_1070 dna:supercontig supercontig:...  65.9       1e-09 
PHPA:scaffold_19 NW_008649005.1 Phytophthora parasitica INRA-310 ...  65.9       2e-09 
PYAP:scaffold_209 pag1_scaffold_209 dna:supercontig supercontig:p...  65.9       2e-09 
SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM151...  65.9       2e-09 
PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 u...  65.9       2e-09 
SAPA:scaffold_32 supercont2.32 dna:supercontig supercontig:ASM151...  65.5       2e-09 
PHKE:scaffold_884 scf_22126_884.1_contig_1 dna:supercontig superc...  55.1       5e-08 
PYAP:scaffold_744 pag1_scaffold_744 dna:supercontig supercontig:p...  65.5       2e-09 
PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:Phy...  65.5       2e-09 
PYIR:scaffold_152 pir_scaffold_152 dna:supercontig supercontig:pi...  65.5       2e-09 
PHPA:scaffold_8 NW_008648994.1 Phytophthora parasitica INRA-310 u...  64.7       3e-09 
PYAR:scaffold_1918 par_scaffold_1918 dna:supercontig supercontig:...  64.7       4e-09 
SADI:scaffold_91 supercont1.91 dna:supercontig supercontig:Sap_di...  64.3       5e-09 
SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_di...  63.9       6e-09 
SADI:scaffold_264 supercont1.264 dna:supercontig supercontig:Sap_...  63.5       7e-09 
PHCA:scaffold_3 PHYCAscaffold_3                                       63.5       8e-09 
PHIF:NW_003303594.1 Phytophthora infestans T30-4 supercont1.165 g...  63.5       8e-09 
PHIF:NW_003303637.1 Phytophthora infestans T30-4 supercont1.122 g...  63.5       8e-09 
PYIW:scaffold_878 piw_scaffold_878 dna:supercontig supercontig:pi...  63.2       1e-08 
PYAP:scaffold_10 pag1_scaffold_10 dna:supercontig supercontig:pag...  62.4       2e-08 
PYIW:scaffold_783 piw_scaffold_783 dna:supercontig supercontig:pi...  62.4       2e-08 
PYIR:scaffold_998 pir_scaffold_998 dna:supercontig supercontig:pi...  61.6       3e-08 
PHKE:scaffold_279 scf_22126_279.1 dna:supercontig supercontig:Phy...  61.6       4e-08 
PHKE:scaffold_191 scf_22126_191.1 dna:supercontig supercontig:Phy...  61.2       4e-08 
PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:p...  61.2       4e-08 
PYAR:scaffold_593 par_scaffold_593 dna:supercontig supercontig:pa...  61.2       5e-08 
PYAR:scaffold_480 par_scaffold_480 dna:supercontig supercontig:pa...  60.8       5e-08 
PYIW:scaffold_270 piw_scaffold_270 dna:supercontig supercontig:pi...  60.8       5e-08 
PYIR:scaffold_1361 pir_scaffold_1361 dna:supercontig supercontig:...  60.8       6e-08 
PYVX:scaffold_698 pve_scaffold_698 dna:supercontig supercontig:pv...  60.5       7e-08 
PHRA:scaffold_44                                                      60.1       9e-08 
PYAP:scaffold_983 pag1_scaffold_983 dna:supercontig supercontig:p...  60.1       9e-08 
PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:p...  60.1       9e-08 
PHRA:scaffold_532                                                     60.1       1e-07 
PYAR:scaffold_55 par_scaffold_55 dna:supercontig supercontig:par_...  60.1       1e-07 
SAPA:scaffold_12 supercont2.12 dna:supercontig supercontig:ASM151...  60.1       1e-07 
APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_a...  56.6       1e-06 
PHRA:scaffold_555                                                     53.9       1e-07 
PYIW:scaffold_1952 piw_scaffold_1952 dna:supercontig supercontig:...  59.7       1e-07 
PYAR:scaffold_1613 par_scaffold_1613 dna:supercontig supercontig:...  59.7       1e-07 
PHRA:scaffold_14                                                      59.3       2e-07 
PYVX:scaffold_663 pve_scaffold_663 dna:supercontig supercontig:pv...  58.9       2e-07 
SADI:scaffold_22 supercont1.22 dna:supercontig supercontig:Sap_di...  58.9       2e-07 
PYUU:scaffold_2031 scf1117875582031 dna:supercontig supercontig:p...  58.9       2e-07 
PYAR:scaffold_6810 par_scaffold_6810 dna:supercontig supercontig:...  57.4       3e-07 
PYAR:scaffold_2617 par_scaffold_2617 dna:supercontig supercontig:...  58.5       3e-07 
PYIR:scaffold_548 pir_scaffold_548 dna:supercontig supercontig:pi...  58.5       3e-07 
PYIR:scaffold_2066 pir_scaffold_2066 dna:supercontig supercontig:...  58.2       3e-07 
PYVX:scaffold_2975 pve_scaffold_2975 dna:supercontig supercontig:...  56.2       4e-07 
PYIW:scaffold_5060 piw_scaffold_5060 dna:supercontig supercontig:...  57.4       4e-07 
PYAP:scaffold_1339 pag1_scaffold_1339 dna:supercontig supercontig...  57.8       5e-07 
PHIF:NW_003303307.1 Phytophthora infestans T30-4 supercont1.454 g...  57.8       5e-07 
PYIW:scaffold_532 piw_scaffold_532 dna:supercontig supercontig:pi...  57.8       5e-07 
PYVX:scaffold_622 pve_scaffold_622 dna:supercontig supercontig:pv...  57.0       9e-07 
PYAR:scaffold_266 par_scaffold_266 dna:supercontig supercontig:pa...  57.0       1e-06 
PYVX:scaffold_341 pve_scaffold_341 dna:supercontig supercontig:pv...  57.0       1e-06 
PYAR:scaffold_1972 par_scaffold_1972 dna:supercontig supercontig:...  56.2       1e-06 
PYVX:scaffold_1640 pve_scaffold_1640 dna:supercontig supercontig:...  55.5       2e-06 
PYIW:scaffold_5066 piw_scaffold_5066 dna:supercontig supercontig:...  55.1       2e-06 
PLHA:NW_020188786.1 Plasmopara halstedii genome assembly, contig:...  55.5       3e-06 
SADI:scaffold_2 supercont1.2 dna:supercontig supercontig:Sap_dicl...  55.1       4e-06 
PHPA:scaffold_21 NW_008649007.1 Phytophthora parasitica INRA-310 ...  54.7       4e-06 
PYAR:scaffold_3952 par_scaffold_3952 dna:supercontig supercontig:...  54.3       5e-06 
PYIR:scaffold_46 pir_scaffold_46 dna:supercontig supercontig:pir_...  54.7       5e-06 
PYIR:scaffold_2122 pir_scaffold_2122 dna:supercontig supercontig:...  54.3       5e-06 
PYAR:scaffold_2265 par_scaffold_2265 dna:supercontig supercontig:...  54.3       6e-06 
PYAP:scaffold_192 pag1_scaffold_192 dna:supercontig supercontig:p...  54.3       6e-06 
PYIR:scaffold_4757 pir_scaffold_4757 dna:supercontig supercontig:...  52.4       7e-06 
SADI:scaffold_24 supercont1.24 dna:supercontig supercontig:Sap_di...  53.9       9e-06 
PHKE:scaffold_715 scf_22126_715.1 dna:supercontig supercontig:Phy...  48.9       8e-06 
PLHA:NW_020189786.1 Plasmopara halstedii genome assembly, contig:...  53.5       1e-05 
PHIF:NW_003303727.1 Phytophthora infestans T30-4 supercont1.32 ge...  53.5       1e-05 
PYIR:scaffold_630 pir_scaffold_630 dna:supercontig supercontig:pi...  53.1       1e-05 
PYVX:scaffold_155 pve_scaffold_155 dna:supercontig supercontig:pv...  52.8       2e-05 
PYAR:scaffold_8021 par_scaffold_8021 dna:supercontig supercontig:...  51.2       2e-05 
PYIW:scaffold_50 piw_scaffold_50 dna:supercontig supercontig:piw_...  52.8       2e-05 
PYAP:scaffold_356 pag1_scaffold_356 dna:supercontig supercontig:p...  52.8       2e-05 
SADI:scaffold_390 supercont1.390 dna:supercontig supercontig:Sap_...  51.6       2e-05 
PYVX:scaffold_1989 pve_scaffold_1989 dna:supercontig supercontig:...  52.4       2e-05 
PYAP:scaffold_234 pag1_scaffold_234 dna:supercontig supercontig:p...  52.8       2e-05 
PYAP:scaffold_321 pag1_scaffold_321 dna:supercontig supercontig:p...  52.4       2e-05 
PYIW:scaffold_712 piw_scaffold_712 dna:supercontig supercontig:pi...  52.4       3e-05 
PYAR:scaffold_3173 par_scaffold_3173 dna:supercontig supercontig:...  52.0       3e-05 
PHKE:scaffold_376 scf_22126_376.1_contig_1 dna:supercontig superc...  52.0       3e-05 
PYIR:scaffold_976 pir_scaffold_976 dna:supercontig supercontig:pi...  51.2       5e-05 
PYIR:scaffold_1966 pir_scaffold_1966 dna:supercontig supercontig:...  50.8       6e-05 
PYAR:scaffold_4631 par_scaffold_4631 dna:supercontig supercontig:...  50.1       9e-05 
PHKE:scaffold_190 scf_22126_190.1 dna:supercontig supercontig:Phy...  50.1       1e-04 
PYAR:scaffold_2725 par_scaffold_2725 dna:supercontig supercontig:...  49.3       2e-04 
PHCA:scaffold_5 PHYCAscaffold_5                                       49.3       2e-04 
PHCA:scaffold_47 PHYCAscaffold_47                                     49.3       2e-04 
PYIR:scaffold_2435 pir_scaffold_2435 dna:supercontig supercontig:...  47.8       5e-04 
PYAR:scaffold_3827 par_scaffold_3827 dna:supercontig supercontig:...  47.4       6e-04 
ALCA:scaffold_116 AcNc2_CONTIG_116_length_69695 dna:supercontig s...  47.4       8e-04 
PYAR:scaffold_9435 par_scaffold_9435 dna:supercontig supercontig:...  45.4       8e-04 
PHIF:NW_003303565.1 Phytophthora infestans T30-4 supercont1.194 g...  47.4       8e-04 
ALCA:scaffold_198 AcNc2_CONTIG_198_length_47010 dna:supercontig s...  46.2       0.002 
PYAR:scaffold_393 par_scaffold_393 dna:supercontig supercontig:pa...  46.2       0.002 
PYIW:scaffold_7 piw_scaffold_7 dna:supercontig supercontig:piw_sc...  46.2       0.002 
PYIW:scaffold_3717 piw_scaffold_3717 dna:supercontig supercontig:...  45.4       0.002 
PHKE:scaffold_787 scf_22126_787.1_contig_1 dna:supercontig superc...  45.8       0.002 
PYVX:scaffold_496 pve_scaffold_496 dna:supercontig supercontig:pv...  45.4       0.003 
PYAP:scaffold_328 pag1_scaffold_328 dna:supercontig supercontig:p...  45.1       0.004 
PYIR:scaffold_883 pir_scaffold_883 dna:supercontig supercontig:pi...  45.1       0.005 
PYIW:scaffold_569 piw_scaffold_569 dna:supercontig supercontig:pi...  44.7       0.006 
PYIR:scaffold_1443 pir_scaffold_1443 dna:supercontig supercontig:...  43.9       0.009 
PYIR:scaffold_4165 pir_scaffold_4165 dna:supercontig supercontig:...  43.1       0.010 
PHSO:scaffold_13                                                      42.4       0.028 
SAPA:scaffold_44 supercont2.44 dna:supercontig supercontig:ASM151...  33.5       0.029 
PYAR:scaffold_6624 par_scaffold_6624 dna:supercontig supercontig:...  41.2       0.038 
PYIW:scaffold_1159 piw_scaffold_1159 dna:supercontig supercontig:...  42.0       0.040 
PYVX:scaffold_1002 pve_scaffold_1002 dna:supercontig supercontig:...  41.6       0.043 
PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:p...  41.6       0.057 
PYAP:scaffold_453 pag1_scaffold_453 dna:supercontig supercontig:p...  40.8       0.075 
PYAR:scaffold_5201 par_scaffold_5201 dna:supercontig supercontig:...  40.4       0.089 
ALLA:FR824130 dna:supercontig supercontig:ENA1:FR824130:1:88159:1...  40.4       0.12  
PYAP:scaffold_566 pag1_scaffold_566 dna:supercontig supercontig:p...  29.3       0.17  
PLHA:NW_020188473.1 Plasmopara halstedii genome assembly, contig:...  39.3       0.29  
ALLA:FR824149 dna:supercontig supercontig:ENA1:FR824149:1:77927:1...  37.0       1.2   
PYIR:scaffold_5474 pir_scaffold_5474 dna:supercontig supercontig:...  35.4       1.5   
PYAR:scaffold_4128 par_scaffold_4128 dna:supercontig supercontig:...  36.6       1.6   
PYIW:scaffold_1943 piw_scaffold_1943 dna:supercontig supercontig:...  36.2       2.1   
PHIF:NW_003303663.1 Phytophthora infestans T30-4 supercont1.96 ge...  36.2       2.1   
PLHA:NW_020188793.1 Plasmopara halstedii genome assembly, contig:...  35.0       2.4   
PYAR:scaffold_4687 par_scaffold_4687 dna:supercontig supercontig:...  35.8       2.8   
HYAP:scaffold_130 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  35.4       4.4   
PHKE:scaffold_1259 scf_22126_1259.1 dna:supercontig supercontig:P...  31.2       6.1   
PYAR:scaffold_4201 par_scaffold_4201 dna:supercontig supercontig:...  34.3       6.8   
PYIR:scaffold_922 pir_scaffold_922 dna:supercontig supercontig:pi...  34.3       7.8   
PHIF:NW_003303719.1 Phytophthora infestans T30-4 supercont1.40 ge...  34.3       9.2   
PYIW:scaffold_77 piw_scaffold_77 dna:supercontig supercontig:piw_...  34.3       9.6   

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 387 bits (995),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +2

Query  1     MRSSPLasaalgvalasagavELCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVA  60
             MRSSPLASAALGVALASAGAVELCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVA
Sbjct  6374  MRSSPLASAALGVALASAGAVELCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVA  6553

Query  61    YLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN  120
             YLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN
Sbjct  6554  YLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN  6733

Query  121   GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKY  180
             GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKY
Sbjct  6734  GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKY  6913

Query  181   QGERYSWQVFKNCINLSASA  200
             QGERYSWQVFKNCINLSASA
Sbjct  6914  QGERYSWQVFKNCINLSASA  6973

 Score = 366 bits (939),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 304/321 (95%), Positives = 308/321 (96%), Gaps = 0/321 (0%)
 Frame = +2

Query  180   YQGERYSWQVFKNCINLSASALVTMIGLQHprsalpalalaaaafvatnapqaMAHQLVI  239
             Y+G      +   C + S  +LVTMIGLQHPRSALPALALAAAAFVATNAPQAMAHQLVI
Sbjct  7424  YRGRSLR*MISSGCRSFSFVSLVTMIGLQHPRSALPALALAAAAFVATNAPQAMAHQLVI  7603

Query  240   LPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASA  299
             LPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASA
Sbjct  7604  LPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASA  7783

Query  300   DFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY  359
             DFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY
Sbjct  7784  DFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY  7963

Query  360   SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIsdgsaaassedsasgeVEETaapsvg  419
             SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPISDGSAAASSEDSASGEVEETAAPSVG
Sbjct  7964  SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPISDGSAAASSEDSASGEVEETAAPSVG  8143

Query  420   ssssdaasvggeadetspsssgsdasvggeadeeaagsadaetsapgssateapspstae  479
             SSSSDAASVGGEADETSPSSSGSDASVGGEADEEAAGSADAETSAPGSSATEAPSPSTAE
Sbjct  8144  SSSSDAASVGGEADETSPSSSGSDASVGGEADEEAAGSADAETSAPGSSATEAPSPSTAE  8323

Query  480   peesdetssGTTPSKCRAKSA  500
             PEESDETSSGTTPSKCRAKSA
Sbjct  8324  PEESDETSSGTTPSKCRAKSA  8386

 Score = 224 bits (570),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -1

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ VILPAPT+  + KD  + PLAFLE Q FST +DF  +   NG+DSLRAFMD  S Y
Sbjct  14925  AHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-Y  14749

Query  294    SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
              +V   AD  CG+T+ D   Q +PDG+MRSTGYTH GPCEVWLDDT VLQ+DNCH+ ISGK
Sbjct  14748  TVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGK  14569

Query  354    TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              TYDLDYS+C  +CTLYW+W+GVRYL   YSWQVYK CVP+
Sbjct  14568  TYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPL  14449

 Score = 199 bits (507),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +3

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ VILP PT+T   +D  + PLAFLE Q F T +DF  +  +NG+ +LRAFMD  S Y
Sbjct  13554  AHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-Y  13730

Query  294    SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
              +V   AD  CGFT+ D  PQPIP    RSTGYTHDGPCE+WLD TRV  +DNCHE ISGK
Sbjct  13731  TVTDGADQTCGFTEIDGTPQPIPANF-RSTGYTHDGPCEIWLDSTRVYANDNCHEAISGK  13907

Query  354    TYDLDYS-ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 +DYS    G+CTLYWYW+GVRYL   YSWQVYK CVP+
Sbjct  13908  DTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPL  14030

 Score = 119 bits (299),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  327   HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
             HDGPCE+WLDDTR+ Q DNCHE +SGK   +DYS+C+GSCTLYW+W+GVRYLK  YSWQV
Sbjct  9063  HDGPCEIWLDDTRIFQGDNCHESVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQV  8884

Query  387   YKACVPI  393
             YK CVP+
Sbjct  8883  YKNCVPL  8863

 Score = 71.2 bits (173),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDS  291
             AHQ VILP PT+T E  D  + PLAFLE Q F+T +DF  +  ANG+D+LRAFMD  S
Sbjct  9304  AHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAS  9131

 Score = 152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 98/160 (61%), Gaps = 1/160 (1%)
 Frame = +2

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             Q+V+ P P + V+G D R  P+A+LE Q   T  +   +L   G+ +LRA MDDD LYSV
Sbjct  7592  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  7771

Query  98    TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                  F CG T P+   QPIP +G   ++GYT DGPCE+W+D+T  L   NCH       
Sbjct  7772  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  7948

Query  158   HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
             + +DYS C  SC + W+WLG++Y  + YSWQV+K C+ +S
Sbjct  7949  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  8068

 Score = 150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 97/159 (61%), Gaps = 1/159 (1%)
 Frame = +2

Query  236   QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
             Q+V+ P P + V+G D R  P+A+LE Q   T  +   +L   G+ +LRA MDDD LYSV
Sbjct  6485  QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  6664

Query  296   NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                  F CG T P+   QPIP +G   ++GYT DGPCE+W+D+T  L   NCH       
Sbjct  6665  TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  6844

Query  355   YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             + +DYS C  SC + W+WLG++Y  + YSWQV+K C+ +
Sbjct  6845  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  6961

 Score = 94.7 bits (234),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  338    TRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              TRV  +DNCH  ISGK   +DYS+C GSCTLYWYW+GVRYLK  YSWQVYK CVP+
Sbjct  12658  TRVYANDNCHAAISGKDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  12825

 Score = 73.9 bits (180),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ VILP P++T   +D  + PLAFLE Q F T +DF  +  ANG+ +LR+FMD    Y
Sbjct  12434  AHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGK-Y  12610

Query  294    SVNASADFRCG  304
              +V + AD +CG
Sbjct  12611  TVTSGADQQCG  12643

 Score = 138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 96/163 (59%), Gaps = 2/163 (1%)
 Frame = -1

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              Q V+ P P +  D  D   +P+A+LE QG  T  +   W ++ GY +LRA MD    Y+V
Sbjct  14919  QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDG-ASYTV  14743

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              T+     CG T  +   Q +P +G   ++GYT  GPCE+W+D+T+ L   NCH       
Sbjct  14742  TDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKT  14566

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              + +DYS C  +C + WFW+G++Y    YSWQV+KNC+ LSASA
Sbjct  14565  YDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASA  14437

 Score = 132 bits (332),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 92/166 (55%), Gaps = 4/166 (2%)
 Frame = +3

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              Q V+ P P +     D   +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  13560  QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQ-ASYTV  13736

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              T+     CG T  +   QPIP N  F ++GYT DGPCEIW+D+T   A  NCH       
Sbjct  13737  TDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKD  13910

Query  158    HTIDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
                IDYS     +C + W+W+G++Y    YSWQV+KNC+ LS SA +
Sbjct  13911  TAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSARM  14048

 Score = 85.5 bits (210),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -1

Query  131   DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
             DGPCEIW+D+T    G NCH         +DYS C  SC + WFW+G++Y    YSWQV+
Sbjct  9060  DGPCEIWLDDTRIFQGDNCHESVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVY  8881

Query  191   KNCINLSASALV  202
             KNC+ LS SA +
Sbjct  8880  KNCVPLSTSARM  8845

 Score = 42.4 bits (98),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = -3

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
             Q V+ P P +  +  D   SP+A+LE QG  T  +  +W +  GY TLRA MD 
Sbjct  9298  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQ  9137

 Score = 64.7 bits (156),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +1

Query  140    NTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
              +T   A  NCH         IDYS C  SC + W+W+G++Y    YSWQV+KNC+ LS S
Sbjct  12655  STRVYANDNCHAAISGKDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  12834

Query  200    A  200
              A
Sbjct  12835  A  12837

 Score = 48.1 bits (113),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +2

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              Q V+ P P +     D   SP+A+LE QG  T  +   W    GY TLR+ M D G Y+V
Sbjct  12440  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFM-DSGKYTV  12616

Query  98     TEEGLFDCG  106
              T      CG
Sbjct  12617  TSGADQQCG  12643

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 270 bits (690),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -2

Query  25       FAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYAT  84
                +  RRL++GLGEGQVVLYP PF+VVDG+D++G  +AYLE+QG++T+IE Q+W+ +  Y +
Sbjct  1847045  YGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNS  1846866

Query  85       LRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLAL  144
                LRA++DDD LY VTEE +F+CGLT P TETQPIPTN SF+TSGYTLDGPCE+W++NT+ +
Sbjct  1846865  LRAMLDDDMLYKVTEEAIFECGLTSPKTETQPIPTNNSFVTSGYTLDGPCEVWLNNTMVI  1846686

Query  145      AGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASAL  201
                 GRNC+TEFP GHH +DYS+CG SC++ W+WLGIKY    YSWQV+KNCINL   +L
Sbjct  1846685  TGRNCYTEFPNGHHQVDYSLCGNSCKLVWYWLGIKYVEGIYSWQVYKNCINLGNKSL  1846515

 Score = 155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 101/159 (64%), Gaps = 1/159 (1%)
 Frame = -2

Query  236      QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
                Q+V+ PAP Y V+G D +   LA+LE Q  +T+ +   ++  + ++SLRA +DDD LY V
Sbjct  1847006  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKV  1846827

Query  296      NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                   A F CG T P    QPIP +    ++GYT DGPCEVWL++T V+   NC+       
Sbjct  1846826  TEEAIFECGLTSPKTETQPIPTNNSFVTSGYTLDGPCEVWLNNTMVITGRNCYTEFPNGH  1846647

Query  355      YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                + +DYS C  SC L WYWLG++Y++ +YSWQVYK C+ +
Sbjct  1846646  HQVDYSLCGNSCKLVWYWLGIKYVEGIYSWQVYKNCINL  1846530

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 270 bits (689),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -1

Query  26      AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
                QRRLD+GLGEGQ+VL+PPPFFVVDG+D++G  +AYL++QG++T+IEAQ+W+ ++GY++L
Sbjct  395370  GQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSL  395191

Query  86      RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
               RA++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCEIW+D+T   +
Sbjct  395190  RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVAS  395011

Query  146     GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
               GRNCHTEFP G H +DYS CG SC +SW+WLGIKY    YSWQV+KNC+ LS +
Sbjct  395010  GRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  394849

 Score = 232 bits (591),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 127/160 (79%), Gaps = 4/160 (3%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP+PTYT + KD ++ PL FLEGQ + T +DF G+   NG+ +LR FM+    Y
Sbjct  359155  AHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  358988

Query  294     SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
               +V   AD+ CGFT+ +AAPQP PDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE I GK
Sbjct  358987  TVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  358808

Query  354     TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               TY+LDYS+C G+CTL WYWLGVR+LK  YSWQ+YKAC+P+
Sbjct  358807  TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  358688

 Score = 162 bits (409),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (65%), Gaps = 1/157 (1%)
 Frame = -1

Query  236     QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
               Q+V+ P P + V+G D +   LA+L+ Q  +T+ +   ++   G+ SLRA +DD+SLY V
Sbjct  395334  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  395155

Query  296     NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                  A F CG T P    QPIP +   +++GYT DGPCE+WLDDT+V    NCH       
Sbjct  395154  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  394975

Query  355     YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               + +DYS+C GSC L WYWLG++Y++ +YSWQVYK CV
Sbjct  394974  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  394864

 Score = 138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 94/163 (58%), Gaps = 5/163 (3%)
 Frame = -3

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL P P +  D  D + +P+ +LE QG  T  +   W    GY TLR  M+    Y+V
Sbjct  359149  QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  358982

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                +   + CG T  N   QP P +G+  ++GYT DGPCE+W+D+T  L   NCH       
Sbjct  358981  ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  358805

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               + +DYS C  +C + W+WLG+++    YSWQ++K CI LSASA
Sbjct  358804  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  358676

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 268 bits (686),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -1

Query  26      AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
                QRRLD+GLGEGQVVL+PPPFFVVDG+D++G  +AYL++QGV+T+IEAQ+W+ + GY +L
Sbjct  245218  GQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSL  245039

Query  86      RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
               RA++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCE+W+D+T   +
Sbjct  245038  RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSS  244859

Query  146     GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
               GRNCHTEFP G H +DYS CG++C +SW+WLGIKY    YSWQV+KNC+ LS +
Sbjct  244858  GRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  244697

 Score = 240 bits (612),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LPAPTYT + KD ++ PLAFLE Q + T +DF G+   NG+ +LR FMD  + Y
Sbjct  243501  AHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AKY  243325

Query  294     SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
               +V   AD+ CGFT+ +AAPQPIPDG MRSTGYTHDGPCEVWLD  RVLQ DNCHE ISGK
Sbjct  243324  TVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  243145

Query  354     TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               TY+LDYS+C G+CTL WYWLGVRYLK  YSWQ+YKAC+P+
Sbjct  243144  TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPL  243025

 Score = 224 bits (572),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+L APTYT + KD ++ PLAFLE Q F+T +DF  +   NG+DSLRAF D  S Y
Sbjct  241990  AHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS-Y  242166

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +V+  AD  CGFT+ +   QPIPDG  MRSTGYTHDGPCEVWLDDT V+Q+DNCHE ISG
Sbjct  242167  TVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISG  242346

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C  +CTLYW+WLGVRYLK  YSWQ+YKACVP+
Sbjct  242347  KYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  242469

 Score = 160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 105/159 (66%), Gaps = 1/159 (1%)
 Frame = -1

Query  236     QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
               Q+V+ P P + V+G D +   LA+L+ Q  +T+ +   ++  +G+ SLRA +DD+SLY V
Sbjct  245182  QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  245003

Query  296     NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                  A F CG T P    QPIP +   +++GYT DGPCEVWLDDT+V    NCH       
Sbjct  245002  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  244823

Query  355     YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               +++DYS+C  +CTL WYWLG++Y++ +YSWQVYK CV +
Sbjct  244822  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  244706

 Score = 149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 98/163 (60%), Gaps = 1/163 (1%)
 Frame = +1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL   P +  D  D + +P+A+LE QG  T  +   W  + GY +LRA  +D   Y+V
Sbjct  241996  QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAF-NDGASYTV  242172

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               ++     CG T  N + QPIP   +  ++GYT DGPCE+W+D+T+ +   NCH      +
Sbjct  242173  SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKY  242352

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               +TIDYS C  +C + WFWLG++Y    YSWQ++K C+ LS SA
Sbjct  242353  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSA  242481

 Score = 147 bits (371),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = -2

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLR  MD    Y+V
Sbjct  243495  QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AKYTV  243319

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T+   + CG T  N   QPIP +G+  ++GYT DGPCE+W+D    L   NCH       
Sbjct  243318  TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  243142

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               + +DYS C  +C + W+WLG++Y    YSWQ++K CI LSASA
Sbjct  243141  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASA  243013

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 267 bits (682),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -3

Query  26     AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
               QRRLD+GLGEGQVV +PPPFF+VDG+D++G  +AYL++QGV+T+IEAQ+W+ + GY +L
Sbjct  95738  GQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSL  95559

Query  86     RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
              RA++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCE+W+D+T   A
Sbjct  95558  RAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSA  95379

Query  146    GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              GRNCHTEFP+G H +DYS CGESC +SW+WLGIKY    YSWQV+KNC+
Sbjct  95378  GRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  95232

 Score = 238 bits (608),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = -1

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T +DF G+  +NG+ +LRAFMD  + Y
Sbjct  94222  AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKY  94046

Query  294    SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
              +V   AD+ CGFT+  AAPQPIPDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE   GK
Sbjct  94045  TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  93866

Query  354    TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              TY+LDYS+C GSC L WYWLG R+LK  +SWQVYKAC+P+
Sbjct  93865  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  93746

 Score = 223 bits (567),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +2

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ+V+LPAPTYT + K  ++ PLAFLE Q F+T +DF  +   NG+DSLRAF +D + Y
Sbjct  92741  AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAF-NDGASY  92917

Query  294    SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              +V+  ADF CGFT+ +   Q IPD   MRSTGYTHDGPCEVWLDDT V+Q+DNCHE ISG
Sbjct  92918  TVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISG  93097

Query  353    KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              K Y +DYS+C  +CTLYW+WLGVRYLK  YSWQ+YKACVP+
Sbjct  93098  KDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  93220

 Score = 159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 103/157 (66%), Gaps = 1/157 (1%)
 Frame = -3

Query  236    QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
              Q+V  P P + V+G D +   LA+L+ Q  +T+ +   +++ +G+ SLRA +DD+SLY V
Sbjct  95702  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95523

Query  296    NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                 A F CG T P    QPIP +   +++GYT DGPCEVWLDDT+V    NCH       
Sbjct  95522  TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  95343

Query  355    YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              + +DYS+C  SCTL WYWLG++Y++ +YSWQVYK CV
Sbjct  95342  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  95232

 Score = 152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 2/163 (1%)
 Frame = -1

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  94216  QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  94040

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              T+   + CG T      QPIP +G+  ++GYT DGPCE+W+D+T  L   NCH  FP   
Sbjct  94039  TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  93863

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              + +DYS C  SC + W+WLG ++    +SWQV+K CI LS+SA
Sbjct  93862  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  93734

 Score = 150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 98/163 (60%), Gaps = 1/163 (1%)
 Frame = +2

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              QVVL P P +  D    + +P+A+LE QG  T  +   W  + GY +LRA  +D   Y+V
Sbjct  92747  QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAF-NDGASYTV  92923

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              ++   F CG T  N + Q IP   +  ++GYT DGPCE+W+D+T+ +   NCH       
Sbjct  92924  SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKD  93103

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              +TIDYS C  +C + WFWLG++Y    YSWQ++K C+ LSASA
Sbjct  93104  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASA  93232

>PHRA:scaffold_56
Length=334739

 Score = 265 bits (678),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  26      AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
                QRRLD+GLGEGQ+VL+PPPFF+VDG+D++G  +AYL++QGV+T+IEAQ W+ + GYA+L
Sbjct  160922  GQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASL  161101

Query  86      RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
               R+++DD+ LY VTEE +FDCGLT P TETQ IPTN SF +SGYTLDGPCE+W+D+T A A
Sbjct  161102  RSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAA  161281

Query  146     GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               GRNCHTEFP G H IDYS CG +C + W+WLGIKY    YSWQV+KNCI L   A
Sbjct  161282  GRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  161446

 Score = 233 bits (594),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T  DF  +  +NG+ +LRAFMD  + Y
Sbjct  162541  AHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKY  162717

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +V   AD+ CGFT+ DA PQ IPDG  MRSTGYTHDGPCEVWLD TRVL HDNCHE ISG
Sbjct  162718  TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  162897

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C G+CTL+WYW+GVRYLK  YSWQVYKACVP+
Sbjct  162898  KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  163020

 Score = 231 bits (589),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 128/161 (80%), Gaps = 2/161 (1%)
 Frame = -1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LPAPTYT + K  ++ PLAFLE Q FST +DF  + + NG+DSLRAF DD + Y
Sbjct  164081  AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAF-DDGASY  163905

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +V+  ADF CGFTD +   Q IPDG  MRSTGYTHDGPCEVWLDDT V+Q+DNCHEVISG
Sbjct  163904  TVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISG  163725

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C  +CTLYW+W+GVRYL   YSWQVYKACVP+
Sbjct  163724  KDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPL  163602

 Score = 155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 101/159 (64%), Gaps = 1/159 (1%)
 Frame = +2

Query  236     QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
               Q+V+ P P + V+G D +   LA+L+ Q  +T+ +  G++  +G+ SLR+ +DD+SLY V
Sbjct  160958  QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  161137

Query  296     NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                  A F CG T P    Q IP +   +S+GYT DGPCEVWLDDT+     NCH       
Sbjct  161138  TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  161317

Query  355     YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               + +DYSAC  +C L WYWLG++Y++  YSWQVYK C+ +
Sbjct  161318  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  161434

 Score = 151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 98/163 (60%), Gaps = 1/163 (1%)
 Frame = -1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL P P +  D    + +P+A+LE QG  T  +   W  E GY +LRA  DD   Y+V
Sbjct  164075  QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAF-DDGASYTV  163899

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               ++   F CG T  N + Q IP   +  ++GYT DGPCE+W+D+T+ +   NCH       
Sbjct  163898  SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKD  163719

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               +TIDYS C  +C + WFW+G++Y    YSWQV+K C+ LSASA
Sbjct  163718  YTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASA  163590

 Score = 148 bits (374),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 94/163 (58%), Gaps = 1/163 (1%)
 Frame = +1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  162547  QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKYTV  162723

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                +   + CG T  +   Q IP   +  ++GYT DGPCE+W+D T  L   NCH       
Sbjct  162724  ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  162903

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               +TIDYS C  +C + W+W+G++Y    YSWQV+K C+ LSASA
Sbjct  162904  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  163032

>PHSO:scaffold_1
Length=13391543

 Score = 263 bits (672),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -1

Query  30       LDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALM  89
                LD GLGEGQVV +PPPFF+VDG+D++G  +AYL++QGV+T+IEAQ+W+ E GYA+LRA++
Sbjct  2794106  LDPGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMQEHGYASLRAML  2793927

Query  90       DDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
                DD+ LY VTEE LFDCGLT P TETQPIP+N SF TSGYTLDGPCE+W+D+T   AGRNC
Sbjct  2793926  DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNC  2793747

Query  150      HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                HT+FP G H IDYS CG+SC + W+WLGIKY    YSWQV+KNC+ LS
Sbjct  2793746  HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  2793603

 Score = 231 bits (588),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -1

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ+V+LPAPTYT + K  ++ PLAFLE Q + T +DF  +    G+ +LRAFMD  S Y
Sbjct  2791880  AHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-Y  2791704

Query  294      SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
                +V   AD+ CGFTD     QPIPDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE  SGK
Sbjct  2791703  TVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGK  2791524

Query  354      TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                TYDLDYS+C GSCTL WYWLGVR+LK  YSWQVYKACVP+
Sbjct  2791523  TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  2791404

 Score = 226 bits (575),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ+V+LPAPTYT + K  ++ PLAFLE Q F+T +DF  +   NG+DSLRAF +D + Y
Sbjct  2790346  AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAF-NDGASY  2790522

Query  294      SVNASADFRCGFTDPDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                +V   ADF CGFT+ +   QPIPD   MRSTGYTHDGPCEVWLDDT V+Q+DNCHE ISG
Sbjct  2790523  TVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISG  2790702

Query  353      KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                K Y +DYS+C  +CTLYW+WLGVRYLK  YSWQ+YKACVP+
Sbjct  2790703  KDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  2790825

 Score = 161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 1/159 (1%)
 Frame = -1

Query  236      QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
                Q+V  P P + V+G D +   LA+L+ Q  +T+ +   ++  +G+ SLRA +DD+SLY V
Sbjct  2794082  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKV  2793903

Query  296      NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                   A F CG T P    QPIP +   +++GYT DGPCEVWLDDT+V    NCH       
Sbjct  2793902  TEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ  2793723

Query  355      YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                +++DYSAC  SCTL+WYWLG++Y++  YSWQVYK CV +
Sbjct  2793722  HEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  2793606

 Score = 155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 99/166 (60%), Gaps = 1/166 (1%)
 Frame = +1

Query  35       GEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGL  94
                G  QVVL P P +  D    + +P+A+LE QG  T  +   W  + GY +LRA  +D   
Sbjct  2790343  GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAF-NDGAS  2790519

Query  95       YSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
                Y+V +   F CG T  N E QPIP + +  ++GYT DGPCE+W+D+T+ +   NCH    
Sbjct  2790520  YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  2790699

Query  155      EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                   +TIDYS C  +C + WFWLG++Y    YSWQ++K C+ LS SA
Sbjct  2790700  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSA  2790837

 Score = 145 bits (365),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 96/163 (59%), Gaps = 2/163 (1%)
 Frame = -1

Query  38       QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
                QVVL P P +  D    + +P+A+LE QG  T  +   W  ++GY TLRA MD    Y+V
Sbjct  2791874  QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-ASYTV  2791698

Query  98       TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                 +   + CG T      QPIP +G+  ++GYT DGPCE+W+D T  L   NCH  F    
Sbjct  2791697  ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  2791521

Query  158      HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                + +DYS C  SC + W+WLG+++    YSWQV+K C+ LS SA
Sbjct  2791520  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSA  2791392

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 60/135 (44%), Gaps = 15/135 (11%)
 Frame = +2

Query  266      STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFR----CGFTDPDAAPQPIPDGIMR  321
                + T  F       G+ SLR  +D       N   D       G T           G + 
Sbjct  2592242  ANTATFTSSFAKAGYSSLRDMLDQQVTDCANTRTDVSPVDVSGLTTMSWQNDQEQKGFID  2592421

Query  322      STGYTHDGPCEVWLDDTRVLQHDNC-HEVISG--KTYDLDYSACNGSCTLYWYWLGVRYL  378
                S    H GPCEVW+DDT V   D+C  +  SG     + D+S C+G CTL +YWL +   
Sbjct  2592422  S----HHGPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALHEP  2592589

Query  379      KQVYSWQVYKACVPI  393
                    +WQ+YK CVP+
Sbjct  2592590  ----NWQIYKQCVPV  2592622

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 60/135 (44%), Gaps = 15/135 (11%)
 Frame = -1

Query  266      STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFR----CGFTDPDAAPQPIPDGIMR  321
                + T  F       G+ SLR  +D       N   D       G T           G + 
Sbjct  2595470  ANTATFTSSFAKAGYSSLRDMLDQQVTDCANTRTDVSPVDVSGLTTMSWQNDQEQKGFID  2595291

Query  322      STGYTHDGPCEVWLDDTRVLQHDNC-HEVISG--KTYDLDYSACNGSCTLYWYWLGVRYL  378
                S    H GPCEVW+DDT V   D+C  +  SG     + D+S C+G CTL +YWL +   
Sbjct  2595290  S----HHGPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALHEP  2595123

Query  379      KQVYSWQVYKACVPI  393
                    +WQ+YK CVP+
Sbjct  2595122  ----NWQIYKQCVPV  2595090

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 68/147 (46%), Gaps = 36/147 (24%)
 Frame = +2

Query  77       LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SF  123
                 A+ GY++LR ++D         + + DC  T   T+  P+  +G              F
Sbjct  2592269  FAKAGYSSLRDMLD---------QQVTDCANT--RTDVSPVDVSGLTTMSWQNDQEQKGF  2592415

Query  124      ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHH---TIDYSVCGESCRVSWFWLGIKY  180
                I S +   GPCE+WID+T+     +C  ++  G+      D+S C   C + ++WL +  
Sbjct  2592416  IDSHH---GPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLAL--  2592580

Query  181      QGERYSWQVFKNCINL--SASALVTMI  205
                     +WQ++K C+ +   + A  TM+
Sbjct  2592581  --HEPNWQIYKQCVPVVSGSGAQTTMV  2592655

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 68/147 (46%), Gaps = 36/147 (24%)
 Frame = -1

Query  77       LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SF  123
                 A+ GY++LR ++D         + + DC  T   T+  P+  +G              F
Sbjct  2595443  FAKAGYSSLRDMLD---------QQVTDCANT--RTDVSPVDVSGLTTMSWQNDQEQKGF  2595297

Query  124      ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHH---TIDYSVCGESCRVSWFWLGIKY  180
                I S +   GPCE+WID+T+     +C  ++  G+      D+S C   C + ++WL +  
Sbjct  2595296  IDSHH---GPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLAL--  2595132

Query  181      QGERYSWQVFKNCINL--SASALVTMI  205
                     +WQ++K C+ +   + A  TM+
Sbjct  2595131  --HEPNWQIYKQCVPVVSGSGAQTTMV  2595057

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 48/118 (41%), Gaps = 27/118 (23%)
 Frame = +2

Query  271      FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPD----------GIM  320
                F       G+ SLR  +D              C  T  D +P  + D          G++
Sbjct  2593682  FTSSFAKAGYSSLRDMLDQQVT---------DCANTRTDVSPVDVSDLTAMTWQNNPGVI  2593834

Query  321      RSTGYTHDGPCEVWLDDTRVLQHDNC---HEVISGKTYDLDYSACNGSCTLYWYWLGV  375
                     TH GPCEVW+D+  +   DNC   +  +       D+S C+  CTL +YWL +
Sbjct  2593835  -----THRGPCEVWIDEIMMNHRDNCLAGNVAVYSMEISTDFSKCSDKCTLRFYWLAL  2593993

 Score = 45.4 bits (106),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 28/126 (22%)
 Frame = +2

Query  77       LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSG--------Y  128
                 A+ GY++LR ++D         + + DC     NT T   P + S +T+          
Sbjct  2593694  FAKAGYSSLRDMLD---------QQVTDCA----NTRTDVSPVDVSDLTAMTWQNNPGVI  2593834

Query  129      TLDGPCEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERY  185
                T  GPCE+WID  +     NC   +        + D+S C + C + ++WL + Y+    
Sbjct  2593835  THRGPCEVWIDEIMMNHRDNCLAGNVAVYSMEISTDFSKCSDKCTLRFYWLAL-YEP---  2594002

Query  186      SWQVFK  191
                +WQ+ +
Sbjct  2594003  NWQIVR  2594020

 Score = 44.3 bits (103),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 15/92 (16%)
 Frame = -2

Query  286       FMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI--MRSTGYTHDGPCEVWLDDTRVLQH  343
                  +D  SLY      D  C FT+ +  PQPIP     + S G  H G CE  L D ++L  
Sbjct  10439074  MLDGMSLY------DAACSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  10438913

Query  344       DNC-----HEVISGKT-YDLDYSAC-NGSCTL  368
                 D+C     H  ++ KT   +DY +C NG C +
Sbjct  10438912  DDCYSEYSHLNVNVKTESSIDYLSCENGGCKM  10438817

 Score = 44.3 bits (103),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 15/92 (16%)
 Frame = -2

Query  286      FMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI--MRSTGYTHDGPCEVWLDDTRVLQH  343
                 +D  SLY      D  C FT+ +  PQPIP     + S G  H G CE  L D ++L  
Sbjct  7957075  MLDGMSLY------DAACSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  7956914

Query  344      DNC-----HEVISGKT-YDLDYSAC-NGSCTL  368
                D+C     H  ++ KT   +DY +C NG C +
Sbjct  7956913  DDCYSEYSHLNVNVKTESSIDYLSCENGGCKM  7956818

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 258 bits (659),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -2

Query  26     AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
               QRRL + LGEGQ+VL PPPFF+VDG+D++G  +AYL++QGV+T+IE Q W+   GY +L
Sbjct  60942  GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  60763

Query  86     RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
              RA++DD+ LY VTEE LFDCGLT P TETQ IPTN +F TSGYT+DGPCE+W+D+    A
Sbjct  60762  RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPCEVWLDDKKVAA  60583

Query  146    GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              GRNCHTEFP G H+IDYS CG SC + W+WLG+KY  E YSWQV+KNC+ LS +A
Sbjct  60582  GRNCHTEFPHGMHSIDYSSCGNSCTLWWYWLGVKYTDEGYSWQVYKNCVGLSKTA  60418

 Score = 234 bits (598),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -3

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T DDF  +   NG+ +LRAFMD  + Y
Sbjct  59183  AHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKY  59007

Query  294    SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              +V   AD+ CGFT+ DAAPQ IP G  MRSTGYTHDGPCEVWLD TRVL HDNCHE ISG
Sbjct  59006  TVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  58827

Query  353    KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKACVP+
Sbjct  58826  KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  58704

 Score = 228 bits (581),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 2/161 (1%)
 Frame = +1

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ+V+LP+PTYT + K  ++ PLAFLE Q FST +DF  +   NG+ SLRAF +DD+ Y
Sbjct  57496  AHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAF-NDDASY  57672

Query  294    SVNASADFRCGFTDPDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              +V+  ADF CGFTD + A QPIPD   MRSTGYTHDGPCEVWLDDT V+Q++NCH+ ISG
Sbjct  57673  TVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISG  57852

Query  353    KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              K Y +DYS+C  +CTLYW+W+GVRYLK  YSWQVYKACVP+
Sbjct  57853  KDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPL  57975

 Score = 160 bits (406),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 1/157 (1%)
 Frame = -2

Query  236    QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
              Q+V+ P P + V+G D +   LA+L+ Q  +T+ +  G+++++G+DSLRA +DD++LY V
Sbjct  60906  QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  60727

Query  296    NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                 A F CG T P    Q IP +   +++GYT DGPCEVWLDD +V    NCH       
Sbjct  60726  TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPCEVWLDDKKVAAGRNCHTEFPHGM  60547

Query  355    YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              + +DYS+C  SCTL+WYWLGV+Y  + YSWQVYK CV
Sbjct  60546  HSIDYSSCGNSCTLWWYWLGVKYTDEGYSWQVYKNCV  60436

 Score = 159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 102/163 (63%), Gaps = 1/163 (1%)
 Frame = +1

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              QVVL P P +  D    + +P+A+LE QG  T  +   W ++ GYA+LRA  +DD  Y+V
Sbjct  57502  QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAF-NDDASYTV  57678

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              ++   F CG T  N   QPIP + +  ++GYT DGPCE+W+D+T+ +   NCH       
Sbjct  57679  SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKD  57858

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              +TIDYS C  +C + WFW+G++Y    YSWQV+K C+ LSASA
Sbjct  57859  YTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASA  57987

 Score = 153 bits (386),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 96/163 (59%), Gaps = 1/163 (1%)
 Frame = -3

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  59177  QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKYTV  59001

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              T+   + CG T  +   Q IP+  +  ++GYT DGPCE+W+D T  L   NCH       
Sbjct  59000  TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  58821

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              +TIDYS C  +C + W+WLG+++    YSWQV+K C+ LSASA
Sbjct  58820  YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  58692

>PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_5024:1:718:1 
REF
Length=718

 Score = 214 bits (544),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +1

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ VILPAPT+T   K+  W PLAFLE Q + TT DF GY+ + G+ +LRAFMDD   Y
Sbjct  154  AHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAY  333

Query  294  SVNAS-ADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V+A+ A+F CG+T+ +   QPIP G +RSTGYTHDGPCEVWLD+T+V+   NC++   G
Sbjct  334  KVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPG  513

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            KT+ + Y++C GSCTL WYW+G+R+LK  +SWQVYK CVPI
Sbjct  514  KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  636

 Score = 152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +1

Query  31   DSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90
            DS +   Q V+ P P F     +   +P+A+LE QG  T  +   ++  +GY TLRA MD
Sbjct  139  DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  318

Query  91   DDGLYSVTEEGL-FDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
            D   Y V   G  F+CG T  N + QPIP  G+  ++GYT DGPCE+W+DNT  ++G NC
Sbjct  319  DKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNC  495

Query  150  HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            + +FP   H+I Y+ C  SC + W+W+G+++   ++SWQV+K C+
Sbjct  496  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  630

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 226 bits (577),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQLV++P PTY +EGK N+W PLAFLE Q+F TT DF  YL AN + SLRAFM++ +LY
Sbjct  110462  AHQLVLIPKPTYIIEGKQNQWNPLAFLEDQSFPTTADFNAYLTANKYTSLRAFMNNSTLY  110641

Query  294     SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +VNASA+F CGFT  D   QPIP +G MR TGYTHDGPCE W++DT+V   +NCH  +  
Sbjct  110642  TVNASANFGCGFTKLDGERQPIPTNGQMRLTGYTHDGPCETWMNDTKVFAGENCHTELPS  110821

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                +Y +DYSAC GSC L  YW+G+RY+K  YSWQVYKAC P+
Sbjct  110822  ISYSMDYSACKGSCILRRYWMGIRYVKNEYSWQVYKACTPL  110944

 Score = 212 bits (540),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +2

Query  233     MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
               +AHQ +I P P + V+G+D +W+PLAFLE Q  +T+ DF G+L   G+ +LRA MDD+ L
Sbjct  107042  VAHQKLIYPEPFFLVDGQDMQWQPLAFLENQKINTSADFAGFLKQKGYANLRAMMDDEKL  107221

Query  293     YSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
               Y VN  A F CG+TDP    QPIP +G +RSTGYTHDGPCEVWLDD +V+  +NCH    
Sbjct  107222  YEVNLDALFDCGYTDPTYESQPIPTNGQIRSTGYTHDGPCEVWLDDVKVMSGENCHTEFP  107401

Query  352     GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               GKT+ +DYS C GSCTL WYW+G+R+LK  +SWQVYK CV +
Sbjct  107402  GKTFKIDYSTCKGSCTLRWYWMGLRFLKNKWSWQVYKECVAL  107527

 Score = 193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +2

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q ++YP PFF+VDG D +  P+A+LE Q ++T+ +   +L ++GYA LRA+MDD+ LY V
Sbjct  107051  QKLIYPEPFFLVDGQDMQWQPLAFLENQKINTSADFAGFLKQKGYANLRAMMDDEKLYEV  107230

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                 + LFDCG T P  E+QPIPTNG   ++GYT DGPCE+W+D+   ++G NCHTEFP   
Sbjct  107231  NLDALFDCGYTDPTYESQPIPTNGQIRSTGYTHDGPCEVWLDDVKVMSGENCHTEFPGKT  107410

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
                 IDYS C  SC + W+W+G+++   ++SWQV+K C+ LS     T
Sbjct  107411  FKIDYSTCKGSCTLRWYWMGLRFLKNKWSWQVYKECVALSDKPTAT  107548

 Score = 187 bits (475),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = +2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ V +P P +T+  K   W PL+FLE     T+    G++   G+ +LRA MDD  LY
Sbjct  108800  AHQAVEVPKPNWTLPKKATYWAPLSFLEKNGVKTSASVDGFMKEKGYSTLRALMDDSKLY  108979

Query  294     SVNASAD-FRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
                VN++AD F CG+TDP    Q IP D  MR+TGYTH GPCEVW+D+ RV+  DNCHE +S
Sbjct  108980  KVNSNADNFLCGYTDPTKGSQVIPKDSTMRTTGYTHVGPCEVWIDNVRVIAGDNCHEQVS  109159

Query  352     GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 T  +DYS C GSCT+ WYWLG+RYLK+ +SWQVYK C+ +
Sbjct  109160  NTT-KVDYSNCKGSCTMRWYWLGLRYLKKKWSWQVYKNCIAL  109282

 Score = 157 bits (396),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 97/159 (61%), Gaps = 0/159 (0%)
 Frame = +2

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P ++++G   + +P+A+LE Q   T  +   +L    Y +LRA M++  LY+V
Sbjct  110468  QLVLIPKPTYIIEGKQNQWNPLAFLEDQSFPTTADFNAYLTANKYTSLRAFMNNSTLYTV  110647

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                    F CG T  + E QPIPTNG    +GYT DGPCE W+++T   AG NCHTE P   
Sbjct  110648  NASANFGCGFTKLDGERQPIPTNGQMRLTGYTHDGPCETWMNDTKVFAGENCHTELPSIS  110827

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               +++DYS C  SC +  +W+GI+Y    YSWQV+K C  L
Sbjct  110828  YSMDYSACKGSCILRRYWMGIRYVKNEYSWQVYKACTPL  110944

 Score = 147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 102/177 (58%), Gaps = 2/177 (1%)
 Frame = +2

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               S +   Q V  P P + +       +P+++LE+ GV T+     ++ E+GY+TLRALMDD
Sbjct  108788  SSVAAHQAVEVPKPNWTLPKKATYWAPLSFLEKNGVKTSASVDGFMKEKGYSTLRALMDD  108967

Query  92      DGLYSVTEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCH  150
                 LY V      F CG T P   +Q IP + +  T+GYT  GPCE+WIDN   +AG NCH
Sbjct  108968  SKLYKVNSNADNFLCGYTDPTKGSQVIPKDSTMRTTGYTHVGPCEVWIDNVRVIAGDNCH  109147

Query  151     TEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGL  207
                +       +DYS C  SC + W+WLG++Y  +++SWQV+KNCI L+        G+
Sbjct  109148  EQV-SNTTKVDYSNCKGSCTMRWYWLGLRYLKKKWSWQVYKNCIALTGDGPTISKGV  109315

>PHCA:scaffold_7 PHYCAscaffold_7
Length=1368812

 Score = 224 bits (570),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   KD ++ PLAFLE Q F T  DF  + + NG+ SLR FMD  + Y
Sbjct  905947  AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDR-AKY  905771

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +V   ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  905770  TVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  905591

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  905590  KDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  905468

 Score = 221 bits (563),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LPAP +  + +D +  PLAFLE Q F T  DF  + + NG+ SLR FMD  + Y
Sbjct  901426  AHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDR-AKY  901602

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +V   ADF+CG+TDP+  PQPIP G  MRSTGYTHDGPCEVW+DDT V++ DNCHE   G
Sbjct  901603  TVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPG  901782

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS C G CTLYWYWLGVR+LK  YSWQVYK C+P+
Sbjct  901783  KGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPL  901905

 Score = 220 bits (561),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   KD ++ PLAFLE + F+T +DF  +   NG+ SLR FMD  + Y
Sbjct  908748  AHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDR-AKY  908924

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V   ADF+CGFTDP+  PQPIP G  MRSTGYTHDGPCEVWLDDT VL  +NCHE   G
Sbjct  908925  PVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  909104

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C G+CTLYW+WLGVR+LK  YSWQVYKAC+P+
Sbjct  909105  KGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPL  909227

 Score = 218 bits (556),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +  + +D + KPL FLEG  F T  DF  +   NG+ SLR FMD+ + Y
Sbjct  876705  AHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN-AKY  876529

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V+  ADF+CGFTDP+  PQPIP G  MRSTGYTHDGPCEVW+DDT V++ DNCHE   G
Sbjct  876528  PVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPG  876349

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS C G CTLYWYWLGVR+LK  YSWQVYK C+P+
Sbjct  876348  KDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPL  876226

 Score = 149 bits (376),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = +2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   KD ++ PLAFLE Q F T  DF  +   N + SLR FM D++ Y
Sbjct  904319  AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFM-DNAKY  904495

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHE  348
               +V   ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE
Sbjct  904496  TVTDGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHE  904663

 Score = 77.0 bits (188),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  352     GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               GK Y +DYS+C G+CTL WYWLG+R+LK  YSWQVYKAC+P+
Sbjct  904674  GKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  904799

 Score = 160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 100/161 (62%), Gaps = 1/161 (1%)
 Frame = +3

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  +  D + +P+A+LE +G  T  +   W  E GY +LR  MD    Y V
Sbjct  908754  QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDR-AKYPV  908930

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               TE   F CG T PN   QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  908931  TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKG  909110

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
               +TIDYS C  +C + WFWLG+++    YSWQV+K CI L+A
Sbjct  909111  YTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLTA  909233

 Score = 160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 98/161 (61%), Gaps = 1/161 (1%)
 Frame = -3

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL P P +  D  D +  P+ +LE  G  T  +   W  E GY +LR  MD+   Y V
Sbjct  876699  QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN-AKYPV  876523

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               +E   F CG T PN   QPIP   +  ++GYT DGPCE+WID+T+ + G NCH +FP   
Sbjct  876522  SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKD  876343

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
               +TIDYS C   C + W+WLG+++   RYSWQV+K CI L++
Sbjct  876342  YTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTS  876220

 Score = 160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 97/163 (60%), Gaps = 1/163 (1%)
 Frame = +1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL P P +  D  D +  P+A+LE QG  T  +   W  E GY +LR  MD    Y+V
Sbjct  901432  QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDR-AKYTV  901608

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                    F CG T PN   QPIP   +  ++GYT DGPCE+WID+T+ + G NCH +FP   
Sbjct  901609  RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKG  901788

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               +TIDYS C   C + W+WLG+++    YSWQV+K CI L+ S 
Sbjct  901789  YTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  901917

 Score = 157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 99/163 (61%), Gaps = 1/163 (1%)
 Frame = -2

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  +  D + +P+A+LE QG  T  +   W  E GY +LR  MD    Y+V
Sbjct  905941  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDR-AKYTV  905765

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T    F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  905764  TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  905585

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               +T+DYS C  +C + W+WLG+++    YSWQV+K CI L+ S 
Sbjct  905584  YTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSG  905456

 Score = 112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = +2

Query  30      LDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALM  89
               LDS     Q+VL P P +  +  D + +P+A+LE QG  T  +  +W  E  Y +LR  M
Sbjct  904301  LDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFM  904480

Query  90      DDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
               D+   Y+VT+   F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NC
Sbjct  904481  DN-AKYTVTDGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNC  904657

Query  150     HTEFPE  155
               H +FP 
Sbjct  904658  HEKFPR  904675

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 64/142 (45%), Gaps = 18/142 (13%)
 Frame = +3

Query  76      WLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTL-----  130
               W + R  A  R+     G+   T    F    T PNT+++  PT+ + + +         
Sbjct  904389  WRSSRTRALRRSRTLLRGVRKTTTN-PFATSWTMPNTQSRTEPTSLAGLPTRRVRRSPFR  904565

Query  131     -DGPCEIWIDNTL-----ALAGRNC------HTEFPEGHHTIDYSVCGESCRVSWFWLGI  178
                + PC   +  T       L  R C         FP   +T+DYS C  +C + W+WLGI
Sbjct  904566  REMPCVPLVTRTTVRVKCGLTTRWCWMVTTATRNFPGKDYTVDYSSCKGTCTLRWYWLGI  904745

Query  179     KYQGERYSWQVFKNCINLSASA  200
               ++   +YSWQV+K CI LS S 
Sbjct  904746  RFLKNQYSWQVYKACIPLSGSG  904811

 Score = 36.2 bits (82),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 1/35 (3%)
 Frame = -1

Query  238     VILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFV  272
               V+LP P  T  GK  ++ PLAFLE   F T +DF 
Sbjct  902648  VLLPEPQRTANGKGAKYNPLAFLE-HGFKTQEDFA  902547

 Score = 30.8 bits (68),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -3

Query  290     DSLYSVNASADFRCGFTDPDAAPQ  313
               ++ Y+V   ADF CGFTDP   P 
Sbjct  902505  NAKYTVTDGADFSCGFTDPKGTPS  902434

 Score = 35.4 bits (80),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +2

Query  247     VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
                +GK  ++ PLAFLE + F+  +DF  +   NG+ S   FMD
Sbjct  900353  AQGKKFQYNPLAFLENEGFTAQEDFTAWRTENGYKSFD-FMD  900475

 Score = 34.7 bits (78),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -2

Query  249     GKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSL  283
               GK  ++ PLAFLE + F+T +DF  +   NG+  L
Sbjct  895375  GKKFQYNPLAFLENEGFTTQEDFTAWRTENGYKLL  895271

>PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.22, whole genome shotgun 
sequence
Length=998868

 Score = 223 bits (569),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   KD ++ PLAFLE Q F T +DF  + D NG+ SLR FMD  + Y
Sbjct  685372  AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDR-AKY  685548

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V + ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  685549  EVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  685728

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C GSCTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  685729  KDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPL  685851

 Score = 221 bits (562),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   KD ++ PLAFLE Q F T +DF+ + + N + SLR FMD+ + Y
Sbjct  687118  AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKY  686942

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V + ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  +NCHE   G
Sbjct  686941  EVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  686762

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C G+CTL WYWLG+R+LK  YSWQVYKAC+P+
Sbjct  686761  KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  686639

 Score = 219 bits (559),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   K+ ++ PLAFLE + F+T +DF  +   NG+ SLR F+D+ + Y
Sbjct  682879  AHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDN-AKY  682703

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V   ADF+CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  682702  PVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  682523

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C G+CTLYWYWLGVR+LK  YSWQVYKAC+P+
Sbjct  682522  KDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  682400

 Score = 216 bits (549),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   KD ++ PLAFLE Q F   +DF  +   NG+ SLR FMD  + Y
Sbjct  714181  AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR-AKY  714357

Query  294     SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V   ADF CGFT+P   PQPIP  GIMRSTGYTHDGPCEV+LDDT VLQ DNCHE   G
Sbjct  714358  EVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPG  714537

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K   +DYS+C G+CTL WYWLG+R+LK  YSWQVYK C+P+
Sbjct  714538  KDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  714660

 Score = 159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 1/166 (1%)
 Frame = -3

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  +  D + +P+A+LE QG  T  +  +W  E  Y +LR  MD+   Y V
Sbjct  687112  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEV  686936

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T    F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  686935  TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  686756

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
               +T+DYS C  +C + W+WLGI++   +YSWQV+K CI LS S   T
Sbjct  686755  YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGEAT  686618

 Score = 159 bits (401),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 100/163 (61%), Gaps = 1/163 (1%)
 Frame = +1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  +  D + +P+A+LE QG  T  + ++W  E GY +LR  MD    Y V
Sbjct  685378  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDR-AKYEV  685554

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T    F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  685555  TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  685734

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               +T+DYS C  SC + W+WLG+++    YSWQV+K CI L+  A
Sbjct  685735  YTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGA  685863

 Score = 150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 96/166 (58%), Gaps = 1/166 (1%)
 Frame = +1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  +  D + +P+A+LE QG     +   W  E GY +LR  MD    Y V
Sbjct  714187  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR-AKYEV  714363

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T    F CG T P    QPIP  G   ++GYT DGPCE+++D+TL L G NCH +FP   
Sbjct  714364  TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKD  714543

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
                 IDYS C  +C + W+WLGI++    YSWQV+K CI L  S  V+
Sbjct  714544  CPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGSGGVS  714681

 Score = 150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 98/159 (62%), Gaps = 1/159 (1%)
 Frame = -3

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  +  + + +P+A+LE +G  T  +   W  E GY +LR  +D+   Y V
Sbjct  682873  QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDN-AKYPV  682697

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T+   F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  682696  TDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  682517

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               +T+DYS C  +C + W+WLG+++    YSWQV+K CI L
Sbjct  682516  YTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  682400

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 46/89 (52%), Gaps = 14/89 (16%)
 Frame = -1

Query  300     DFRCGFTDPDAAPQPIP-DGIM-----RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CGFT  D  PQPIP DG       R  G+ H GPCEV++DD  V + DNC     G 
Sbjct  454854  DKKCGFTRMDVDPQPIPSDGNAKWRSNRDGGFGHLGPCEVYIDDNMVARGDNCETDFPGG  454675

Query  353     -------KTYDLDYSACNGSCTLYWYWLG  374
                          +DY +CNG CTL  YWL 
Sbjct  454674  DDKSSKPSIIPVDY*SCNGKCTLTLYWLA  454588

 Score = 59.3 bits (142),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 60/127 (47%), Gaps = 22/127 (17%)
 Frame = -1

Query  74      QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-----SFITSGY  128
               +T   E+G     AL+D      V ++    CG T  + + QPIP++G     S    G+
Sbjct  454914  KTMAKEKGMRVRDALLD-----MVKDK---KCGFTRMDVDPQPIPSDGNAKWRSNRDGGF  454759

Query  129     TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGESCRVSWFWLGIKY  180
                  GPCE++ID+ +   G NC T+FP G           +DY  C   C ++ +WL  + 
Sbjct  454758  GHLGPCEVYIDDNMVARGDNCETDFPGGDDKSSKPSIIPVDY*SCNGKCTLTLYWLAFEG  454579

Query  181     Q-GERYS  186
               + G R S
Sbjct  454578  RIGRRTS  454558

 Score = 24.6 bits (52),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 12/22 (55%), Gaps = 0/22 (0%)
 Frame = -3

Query  184     RYSWQVFKNCINLSASALVTMI  205
               R +WQ + NCI L  S+  T  
Sbjct  454582  RANWQAYINCIPLQGSSSKTQT  454517

>PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_622.1:1:14582:1 
REF
Length=14582

 Score = 223 bits (568),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = -1

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ+V+LP PT+T + KD ++ PLAFLEG+ F+  +DF  +   NG+ SLR FMD+ + Y
Sbjct  3953  AHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKY  3777

Query  294   SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             SV + AD  CGFTDP+  PQPIP+G  MRSTGYTHDGPCEVW+DDT  + +DNCHE   G
Sbjct  3776  SVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPG  3597

Query  353   KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             K Y +DYSAC G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  3596  KDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPL  3474

 Score = 156 bits (394),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 98/162 (60%), Gaps = 1/162 (1%)
 Frame = -1

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             Q+VL P P +  D  D + +P+A+LE +G     +   W  E GY +LR  MD+   YSV
Sbjct  3947  QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSV  3771

Query  98    TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
             T      CG T PN   QPIP   +  ++GYT DGPCE+WID+TLA+   NCH  FP   
Sbjct  3770  TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKD  3591

Query  158   HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
             +TIDYS C  +C + W+WLG+++    YSWQV+K CI L+ S
Sbjct  3590  YTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGS  3465

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = -2

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ+V+LP PT+T   KD ++ PLAFLEG+ F+  +DF  + + NG+ SLR FM D++ Y
Sbjct  5482  AHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFM-DNAKY  5306

Query  294   SVNASADFRCG  304
              V + ADF CG
Sbjct  5305  PVTSGADFNCG  5273

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  352  GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            GK Y +DYSAC G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  10   GKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  135

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  153  FPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
            FP   +TIDYS C  +C + W+WLG+++    YSWQV+K CI L+ 
Sbjct  4    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLTG  141

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = -2

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             Q+VL P P +  +  D + +P+A+LE +G     + + W  E GY +LR  M D+  Y V
Sbjct  5476  QIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFM-DNAKYPV  5300

Query  98    TEEGLFDCG  106
             T    F+CG
Sbjct  5299  TSGADFNCG  5273

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 222 bits (566),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +1

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ++I P P + V+GKD +WKPLAFLE Q  +T+ D  G++   G+ +LRA MDD+ LY
Sbjct  1299490  AHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLY  1299669

Query  294      SVNASADFRCGFTDPDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                 VN  A F CG+TDP    QPIP  G +RSTGYTHDGPCEVWLDD +V+  DNCH+   G
Sbjct  1299670  EVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPG  1299849

Query  353      KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                KT+ LDYS+C GSCTL WYWLGVRYLK+ YSWQ+YK CV +
Sbjct  1299850  KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  1299972

 Score = 221 bits (562),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = +2

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ V+LPAPT+TV+ +  ++ PLAFLE Q + TT DF  Y  A G+ +LRAFMDD   Y
Sbjct  1294355  AHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAY  1294534

Query  294      SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
                 V A ADF+CG+T  D   QPIP G +RSTGYTHDGPCEVWLD TRV++ +NCH    G 
Sbjct  1294535  KVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGT  1294714

Query  354      TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                T+ +DYS+C GSCTL WYW+G+R+LK  YSWQVYK CVPI
Sbjct  1294715  TFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  1294834

 Score = 221 bits (562),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +1

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQLVILP PT+TV  KD RW PLAFLE Q + TT DF  Y  + G+ SLRAFMDD   Y
Sbjct  1298026  AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAY  1298205

Query  294      SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
                 VN++ADF CG+T+ + A QPIP    R+TGYTHDGPCEVWLD+T+VL   NCH+   GK
Sbjct  1298206  KVNSNADFECGYTNKNGARQPIPANF-RTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGK  1298382

Query  354      TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                T+ + Y+AC GSCTL WYW+G+R+LK  +SWQVYK CVP+
Sbjct  1298383  THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  1298502

 Score = 220 bits (561),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = +3

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ V+LPAPT+TV+ +  ++ PLAFLE Q F TT DF  Y  A G+ +LRAFMDD   Y
Sbjct  1295892  AHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAY  1296071

Query  294      SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
                +V + ADF CG+T  D   Q IP G +RSTGYTHDGPCEVWLD TRV++ +NCH   +G 
Sbjct  1296072  TVASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGT  1296251

Query  354      TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                T+ +DYS+C GSCTL WYW+G+R+LK  YSWQVYK CVPI
Sbjct  1296252  THTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPI  1296371

 Score = 219 bits (558),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = +2

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ V+LPAPT+TV+ +  ++ PLAFLE Q F TT DF  Y  A G+ SLRAFMDD   Y
Sbjct  1288631  AHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAY  1288810

Query  294      SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
                 V A ADF+CG+T  D   QPIP G +RSTGYTHDGPCEVWLD+T V++ +NCH    G 
Sbjct  1288811  KVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGT  1288990

Query  354      TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                T+ + Y++C GSCTL WYW+G+R+LK  YSWQVYK CVPI
Sbjct  1288991  THKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  1289110

 Score = 194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 119/163 (73%), Gaps = 0/163 (0%)
 Frame = +1

Query  38       QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
                Q++++P PFF+VDG D +  P+A+LE QGV+T+ +   ++ ++GYA LRALMDD+ LY V
Sbjct  1299496  QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  1299675

Query  98       TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                  + LF+CG T P  E+QPIPT G+  ++GYT DGPCE+W+D+   ++G NCH +FP   
Sbjct  1299676  NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  1299855

Query  158      HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                  +DYS C  SC + W+WLG++Y  +RYSWQ++K C++LS +A
Sbjct  1299856  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNA  1299984

 Score = 191 bits (486),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = +3

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ V +P P +TV  K   W PL+FLE     T+    G++   G+++LR  MDD  LY
Sbjct  1300995  AHQAVEVPKPNWTVPKKATYWAPLSFLEKNGVKTSASVNGFMKEKGYNTLRDLMDDQKLY  1301174

Query  294      SVNASAD-FRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
                 VN++AD F CG+TDP    QPIP D  MR+TGYTH GPCEVW+DD +V+  DNCHE +S
Sbjct  1301175  KVNSNADNFLCGYTDPTKGSQPIPKDSTMRTTGYTHVGPCEVWIDDVKVIAGDNCHEQVS  1301354

Query  352      GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  T  +DYS C G CT++WYWLG+R+LK+ +SWQVYK C+ +
Sbjct  1301355  N-TTKVDYSNCKGKCTMHWYWLGLRFLKKKWSWQVYKNCIAL  1301477

 Score = 180 bits (457),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = -3

Query  40       VLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE  99
                VLYP PF++VDG + + +PVA+LE+QG+ T+ +   ++ ++GYA LRA++DD  LY+V  
Sbjct  1303085  VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  1302906

Query  100      EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
                + L +CG T P  E+QPIP   +FI++GY L+GPCE+W+D+   ++  NCHT++P  +  
Sbjct  1302905  DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  1302726

Query  160      IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASAL  201
                +DYS C  SC + W+WLGI+   E YSWQV+K C++L  + +
Sbjct  1302725  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGV  1302600

 Score = 165 bits (418),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = +1

Query  31       DSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90
                DS     Q+V+ P P F V   D R SP+A+LE QG  T  +   +   +GY +LRA MD
Sbjct  1298011  DSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMD  1298190

Query  91       DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCH  150
                D   Y V     F+CG T  N   QPIP N  F T+GYT DGPCE+W+DNT  L+G NCH
Sbjct  1298191  DKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCH  1298364

Query  151      TEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                 +FP   H + Y+ C  SC + W+W+GI++   ++SWQV+K C+ L
Sbjct  1298365  KDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  1298502

 Score = 160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 100/165 (61%), Gaps = 1/165 (1%)
 Frame = +2

Query  38       QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
                Q V+ P P F V     + +P+A+LE QG  T  +   +   +GY +LRA MDD   Y V
Sbjct  1288637  QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  1288816

Query  98       TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                     F CG T  + + QPIP  G+  ++GYT DGPCE+W+DNTL + G NCH+EFP   
Sbjct  1288817  AAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTT  1288993

Query  158      HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
                H I Y+ C  SC + W+W+GI++   +YSWQV+KNC+ +    L+
Sbjct  1288994  HKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGKRLL  1289128

 Score = 160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 98/161 (61%), Gaps = 1/161 (1%)
 Frame = -3

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                A   V+ P P Y V+G + +  P+A LE Q   T+ D   ++   G+ +LRA +DD  LY
Sbjct  1303097  AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  1302918

Query  294      SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                +VN  A   CG+TDP    QPIP      STGY  +GPCEVWLDD +V+   NCH    G
Sbjct  1302917  NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  1302738

Query  353      KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  + LDYS+C GSC L WYWLG++ + + YSWQVYK CV +
Sbjct  1302737  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  1302615

 Score = 157 bits (397),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 100/165 (61%), Gaps = 1/165 (1%)
 Frame = +2

Query  38       QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
                Q V+ P P F V     + +P+A+LE QG  T ++   +   +GY TLRA MDD   Y V
Sbjct  1294361  QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  1294540

Query  98       TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                     F CG T  + + QPIP  G+  ++GYT DGPCE+W+D+T  + G NCH+EFP   
Sbjct  1294541  AAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTT  1294717

Query  158      HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
                  IDYS C  SC + W+W+GI++   +YSWQV+KNC+ +    L+
Sbjct  1294718  FKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGKRLL  1294852

 Score = 157 bits (396),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 99/162 (61%), Gaps = 1/162 (1%)
 Frame = +3

Query  38       QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
                Q V+ P P F V     + +P+A+LE QG  T  +   +   +GY TLRA MDD   Y+V
Sbjct  1295898  QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTV  1296077

Query  98       TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                     F+CG T  +   Q IP  G+  ++GYT DGPCE+W+D+T  + G NCHTEF    
Sbjct  1296078  ASGADFECGWTKLDGTRQSIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTT  1296254

Query  158      HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                HTIDYS C  SC + W+W+GI++    YSWQV+KNC+ + +S
Sbjct  1296255  HTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGSS  1296380

 Score = 144 bits (363),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 99/172 (58%), Gaps = 2/172 (1%)
 Frame = +3

Query  38       QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
                Q V  P P + V       +P+++LE+ GV T+     ++ E+GY TLR LMDD  LY V
Sbjct  1301001  QAVEVPKPNWTVPKKATYWAPLSFLEKNGVKTSASVNGFMKEKGYNTLRDLMDDQKLYKV  1301180

Query  98       TEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG  156
                      F CG T P   +QPIP + +  T+GYT  GPCE+WID+   +AG NCH +    
Sbjct  1301181  NSNADNFLCGYTDPTKGSQPIPKDSTMRTTGYTHVGPCEVWIDDVKVIAGDNCHEQV-SN  1301357

Query  157      HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGLQ  208
                   +DYS C   C + W+WLG+++  +++SWQV+KNCI L+        G++
Sbjct  1301358  TTKVDYSNCKGKCTMHWYWLGLRFLKKKWSWQVYKNCIALTGDGPTISKGVK  1301513

>PHRA:scaffold_106
Length=147471

 Score = 222 bits (565),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = -1

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ+V+LP P +T + KD ++ PLAFLE + F+T +DF  +   NG+ SLR FMD+ + Y
Sbjct  13410  AHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKY  13234

Query  294    SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              SV   ADF CGFTDP   PQPIP D  MRSTGYTHDGPCEVWLDDT VL  +NCHE   G
Sbjct  13233  SVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  13054

Query  353    KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              K Y +DYS+C G+CTL WYW+GVR+LK+ YSWQVYK C+P+
Sbjct  13053  KDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPL  12931

 Score = 162 bits (411),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 102/163 (63%), Gaps = 1/163 (1%)
 Frame = -1

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              Q+VL P P +  D  D + +P+A+LE +G  T  +   W  E GY +LR  MD+   YSV
Sbjct  13404  QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  13228

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              T    F CG T P    QPIP + +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  13227  TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  13048

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              +T+DYS C  +C + W+W+G+++  E YSWQV+K CI L+  +
Sbjct  13047  YTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGS  12919

>PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 
genomic scaffold, whole genome shotgun sequence
Length=2113949

 Score = 222 bits (565),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T + KD ++ PLAFLE Q F T  DF  + D NG+ SLR FMD  + Y
Sbjct  696920  AHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDR-AKY  697096

Query  294     SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V + ADF CGFTDP   PQPIP  G MRSTGYTHDGPCEVWLDD  VL  DNCHE   G
Sbjct  697097  DVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPG  697276

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  697277  KDYTVDYSSCKGTCTLRWYWLGVRFLKNSYSWQVYKACIPL  697399

 Score = 157 bits (396),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 1/160 (1%)
 Frame = +2

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +     D + +P+A+LE QG  T  + + W  E GY +LR  MD    Y V
Sbjct  696926  QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDR-AKYDV  697102

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T    F CG T P    QPIP  G+  ++GYT DGPCE+W+D+ + L G NCH +FP   
Sbjct  697103  TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKD  697282

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
               +T+DYS C  +C + W+WLG+++    YSWQV+K CI L+
Sbjct  697283  YTVDYSSCKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLT  697402

 Score = 137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 73/98 (74%), Gaps = 7/98 (7%)
 Frame = +1

Query  297     ASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTY  355
               +S+ FR G       PQPIP G  MRSTGYTHDGPCEVWLDD  VL  DNCHE   GK Y
Sbjct  673417  SSSLFRRG------TPQPIPAGDAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDY  673578

Query  356     DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                +DYS+C G+CTL WYWLG+R+LK  YSWQVYKAC+P+
Sbjct  673579  TVDYSSCKGTCTLRWYWLGIRFLKNKYSWQVYKACIPL  673692

 Score = 107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +1

Query  109     FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGES  168
               F     QPIP   +  ++GYT DGPCE+W+D+ + L G NCH +FP   +T+DYS C  +
Sbjct  673429  FRRGTPQPIPAGDAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCKGT  673608

Query  169     CRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               C + W+WLGI++   +YSWQV+K CI L+ S 
Sbjct  673609  CTLRWYWLGIRFLKNKYSWQVYKACIPLAGSG  673704

>PHSO:scaffold_14
Length=1806347

 Score = 221 bits (562),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = -1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   K+ ++ PLAFLE Q F T +DF  +   NG+ SLR FMD  + Y
Sbjct  819296  AHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDR-AKY  819120

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V + ADF CGFTDP   PQPIP+G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  819119  DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  818940

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  818939  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  818817

 Score = 159 bits (402),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 92/140 (66%), Gaps = 2/140 (1%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+L  P  T   KD ++ PLAFLE Q F T +DF  + D NG+ SLR FMD  + Y
Sbjct  813958  AHQIVLLSEPQ*TTSDKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDK-AKY  814134

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +V + ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT+VL+ DNCHE   G
Sbjct  814135  TVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPG  814314

Query  353     KTYDLDYSACNGSCTLYWYW  372
               K Y +  +   G   L   W
Sbjct  814315  KDYTVLVAGVQGVHPLVRIW  814374

 Score = 155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 100/166 (60%), Gaps = 1/166 (1%)
 Frame = -1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  +  + + +P+A+LE QG  T  +   W  E GY +LR  MD    Y V
Sbjct  819290  QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDR-AKYDV  819114

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T    F CG T P    QPIP      ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  819113  TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  818934

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
               +T+DYS C  +C + W+WLG+++    YSWQV+K CI L++ ++ +
Sbjct  818933  YTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAS  818796

 Score = 121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 90/169 (53%), Gaps = 25/169 (15%)
 Frame = -2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T   K  ++ PLAFLE Q F T +DF  +   NG+ +LR FM D + Y
Sbjct  815815  AHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFM-DKAKY  815639

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEV-----WLDDTRVLQHDNCH  347
                V + ADF CGFTDP   PQPIP+G  MRSTGYTHDG         W    R +     H
Sbjct  815638  DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGVARRHDGAGWRQLPREVPGQGLH  815459

Query  348     E---VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                   V+ G               L    L +  +K  YSW+VYKAC+P+
Sbjct  815458  GRLLVV*G---------------LVHASLVLDGMKNSYSWKVYKACIPL  815357

 Score = 103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 69/123 (56%), Gaps = 1/123 (1%)
 Frame = +1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL   P       D + +P+A+LE QG  T  +  +W  + GY +LR  MD    Y+V
Sbjct  813964  QIVLLSEPQ*TTSDKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDK-AKYTV  814140

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               T    F CG T P    QPIP   +  ++GYT DGPCE+W+D+T  L G NCH +FP   
Sbjct  814141  TSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPGKD  814320

Query  158     HTI  160
               +T+
Sbjct  814321  YTV  814329

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 75/165 (45%), Gaps = 12/165 (7%)
 Frame = -2

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  +    + +P+A+LE QG  T  +   W  E GY TLR  M D   Y V
Sbjct  815809  QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFM-DKAKYDV  815633

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAG-RNCHTEFP-E  155
               T    F CG T P    QPIP      ++GYT DG     +      AG R    E P +
Sbjct  815632  TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG-----VARRHDGAGWRQLPREVPGQ  815468

Query  156     GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               G H     V G     S    G+K     YSW+V+K CI LS S 
Sbjct  815467  GLHGRLLVV*G-LVHASLVLDGMK---NSYSWKVYKACIPLSGSG  815345

 Score = 50.4 bits (119),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 6/57 (11%)
 Frame = +2

Query  302      RCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                +CG T     PQPIP DG ++       G+TH GPCEV+LDD  VL  DNC +   G
Sbjct  1038107  KCGNTVVTGTPQPIPSDGKVKWLGNGGGGFTHVGPCEVYLDDKMVLHGDNCEDEYKG  1038277

 Score = 26.9 bits (58),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 14/26 (54%), Gaps = 4/26 (15%)
 Frame = +3

Query  362      CNGSCTLYWYWLGVRYLKQVYSWQVY  387
                CNG CTL +YWL      Q   WQ Y
Sbjct  1038318  CNGKCTLSFYWLAF----QNEQWQAY  1038383

 Score = 42.7 bits (99),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 30/57 (53%), Gaps = 5/57 (9%)
 Frame = +2

Query  105      CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG  156
                CG T      QPIP++G          G+T  GPCE+++D+ + L G NC  E+  G
Sbjct  1038110  CGNTVVTGTPQPIPSDGKVKWLGNGGGGFTHVGPCEVYLDDKMVLHGDNCEDEYKGG  1038280

>PHRA:scaffold_267
Length=29552

 Score = 220 bits (561),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +3

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ+V+LP P +T + KD ++ PLAFLE + F+T +DF  + D NG+ SLR FMD+ + Y
Sbjct  9342  AHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKY  9518

Query  294   SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             +V   ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  9519  NVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  9698

Query  353   KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             K Y +DYS+C G+CTL WYWLG+R+LK  YSWQVYK C+P+
Sbjct  9699  KDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPL  9821

 Score = 157 bits (396),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 101/163 (62%), Gaps = 1/163 (1%)
 Frame = +3

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             QVVL P P +  D  D + +P+A+LE +G  T  +  +W  E GY +LR  MD+   Y+V
Sbjct  9348  QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  9524

Query  98    TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              +   F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  9525  ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  9704

Query  158   HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
             +T+DYS C  +C + W+WLGI++    YSWQV+K CI L+  +
Sbjct  9705  YTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGS  9833

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 219 bits (559),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = +2

Query  23      LCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGY  82
               +C   +RL S L EGQVVLYP P F+VD    +G  +AYL++QG+ T+IEAQ+W  E GY
Sbjct  161192  VCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGY  161371

Query  83      ATLRALMDDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNT  141
                +LRA++DD  LY V+++ +FDCG T  P+   Q IPTNG+  +SGYTLDGPCE+W D+T
Sbjct  161372  VSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDT  161551

Query  142     LALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                  +GRNC TEFP G H +DYS CG+SC + W+WLGI+Y    YSWQV+KNCI L
Sbjct  161552  QVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  161716

 Score = 145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = +2

Query  236     QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
               Q+V+ P+P + V+    + K LA+L+ Q   T+ +   +   +G+ SLRA +DD SLY V
Sbjct  161237  QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  161416

Query  296     NASADFRCGFTD-PDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
               +  A F CGFT  P    Q IP +G + S+GYT DGPCEVW DDT+V    NC       
Sbjct  161417  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  161596

Query  354     TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                + +DYS+C  SCTL WYWLG++Y+  +YSWQVYK C+
Sbjct  161597  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  161710

>PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2249:1:3349:1 
REF
Length=3349

 Score = 217 bits (552),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = -3

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ VILPAPT+TV+ +  ++ PLAFLE Q F TT DF  Y  A G+ +LRAFMDD S Y
Sbjct  1916  AHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAY  1737

Query  294   SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              V   ADF CG+T     PQPIP    +RSTGYTHDGPCEVWLD TRVL+  NCH    G
Sbjct  1736  KVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPG  1557

Query  353   KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              T+ +DYS+C GSC L WYW+G+R+LK  YSWQVYK CVP+
Sbjct  1556  TTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPV  1434

 Score = 160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 101/169 (60%), Gaps = 0/169 (0%)
 Frame = -3

Query  31    DSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90
             D+ +   Q V+ P P F V     + +P+A+LE QG  T  +   +   +GY TLRA MD
Sbjct  1931  DTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMD  1752

Query  91    DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCH  150
             D   Y V +   F+CG T      QPIP+  +  ++GYT DGPCE+W+D T  L G NCH
Sbjct  1751  DKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCH  1572

Query  151   TEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
             +EFP     IDYS C  SC + W+W+GI++   +YSWQV+KNC+ ++ S
Sbjct  1571  SEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGS  1425

>PHRA:scaffold_79
Length=220511

 Score = 217 bits (552),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -1

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ+V+LP P +T + KD ++ PLAFLEGQ F+T  DF  +   NG+ +LR FMD  + Y
Sbjct  26150  AHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDR-AKY  25974

Query  294    SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
              +V   AD+ CG+TDP+  PQPIP G MRSTGYTHDGPCEVWLD+TRVLQ DNCHE    K
Sbjct  25973  TVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDK  25794

Query  354    TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               Y +DYS+C G+CTL+WYW+GVR+LK  YSWQVYK C+ +
Sbjct  25793  DYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISL  25674

 Score = 159 bits (402),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 104/167 (62%), Gaps = 2/167 (1%)
 Frame = -1

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              QVVL P P +  D  D + +P+A+LE QG  T  +   W  + GY TLR  MD    Y+V
Sbjct  26144  QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDR-AKYTV  25968

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              TE   + CG T PN   QPIP  G+  ++GYT DGPCE+W+DNT  L G NCH +FP+  
Sbjct  25967  TEGADYFCGWTDPNGTPQPIPA-GNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKD  25791

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
              + IDYS C  +C + W+W+G+++    YSWQV+K CI+L++   + M
Sbjct  25790  YPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQRLRM  25650

>PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_4828:1:781:1 
REF
Length=781

 Score = 199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 120/164 (73%), Gaps = 4/164 (2%)
 Frame = +3

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-NFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
            AHQ+V+LP PT+T+EGK  +W+P+A+LEGQ  FS   DF GYL + GF ++R FMD+D L
Sbjct  117  AHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKL  296

Query  293  YSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH-EVI  350
            Y   + ADF+CG+T  D  PQPIP +  +R+TGYTH+GPCE+WLDD +V    NCH +V 
Sbjct  297  YRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVA  476

Query  351  SGKTY-DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            SG  +  LD+S+C G CT+YWYW+G+R   +  SWQ+YK C+P+
Sbjct  477  SGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  608

 Score = 137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 98/170 (58%), Gaps = 3/170 (2%)
 Frame = +3

Query  30   LDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLE-QQGVHTAIEAQTWLAERGYATLRAL  88
            LDS     Q+V+ P P + ++G   +  P+AYLE Q G     +   +L+ +G+ T+R  
Sbjct  99   LDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREF  278

Query  89   MDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRN  148
            MD+D LY    +  F CG T  + E QPIP N    T+GYT +GPCEIW+D+     G+N
Sbjct  279  MDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKN  458

Query  149  CHTEFPEGHH--TIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            CH +   G +   +D+S C   C + W+W+GI+  G+  SWQ++K CI L
Sbjct  459  CHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  608

>PHSO:scaffold_35
Length=32414

 Score = 215 bits (548),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = -3

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               HQ+V+LP P +T   K+ ++ PLAFLE + F+T +DF  +   NG+ SLR FMD  + Y
Sbjct  18612  THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR-AKY  18436

Query  294    SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               V + ADF CGFTDP   PQPIP+G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  18435  DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  18256

Query  353    KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  18255  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  18133

 Score = 155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 103/176 (59%), Gaps = 1/176 (1%)
 Frame = -3

Query  28     RRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRA  87
              RR    +   Q+VL P P +  +  + + +P+A+LE +G  T  +   W  E GY +LR 
Sbjct  18636  RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  18457

Query  88     LMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR  147
               MD    Y VT    F CG T P    QPIP      ++GYT DGPCE+W+D+T+ L G 
Sbjct  18456  FMDR-AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  18280

Query  148    NCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
              NCH +FP   +T+DYS C  +C + W+WLG+++    YSWQV+K CI L++ ++ +
Sbjct  18279  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAS  18112

>PHSO:scaffold_5
Length=6830280

 Score = 215 bits (548),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                HQ+V+LP P +T   K+ ++ PLAFLE + F+T +DF  +   NG+ SLR FMD  + Y
Sbjct  682465  THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR-AKY  682289

Query  294     SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                V + ADF CGFTDP   PQPIP+G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  682288  DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  682109

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  682108  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  681986

 Score = 155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 103/176 (59%), Gaps = 1/176 (1%)
 Frame = -3

Query  28      RRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRA  87
               RR    +   Q+VL P P +  +  + + +P+A+LE +G  T  +   W  E GY +LR 
Sbjct  682489  RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  682310

Query  88      LMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR  147
                MD    Y VT    F CG T P    QPIP      ++GYT DGPCE+W+D+T+ L G 
Sbjct  682309  FMDR-AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  682133

Query  148     NCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
               NCH +FP   +T+DYS C  +C + W+WLG+++    YSWQV+K CI L++ ++ +
Sbjct  682132  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAS  681965

 Score = 42.7 bits (99),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 43/91 (47%), Gaps = 14/91 (15%)
 Frame = +3

Query  286      FMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI--MRSTGYTHDGPCEVWLDDTRVLQH  343
                 +D  SLY      D  C FT+ +  PQPIP     + S G  H G CE  L D ++L  
Sbjct  3040320  MLDGMSLY------DAACSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  3040481

Query  344      DNC-----HEVISGKT-YDLDYSACNGSCTL  368
                D+C     H  ++ KT   +DY   NG C +
Sbjct  3040482  DDCYSEYSHLNVNVKTESSIDYLCENGGCKM  3040574

 Score = 38.5 bits (88),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 15/92 (16%)
 Frame = -1

Query  286      FMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI--MRSTGYTHDGPCEVWLDDTRVLQH  343
                 +D  SLY      D    FT+ +  PQPIP     + S G  + G CE  L D ++L  
Sbjct  4992948  MLDGMSLY------DAAYSFTNRNGTPQPIPTNANAITSHGLIYTGSCEF*LGDKKLLYA  4992787

Query  344      DNC-----HEVISGKT-YDLDYSAC-NGSCTL  368
                D+C     H  ++ KT   +DY +C NG C +
Sbjct  4992786  DDCYSEYSHLNVNVKTESSIDYLSCENGGCKM  4992691

 Score = 35.0 bits (79),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 9/74 (12%)
 Frame = -1

Query  101      GLFDCGLTFPNTE--TQPIPTNGSFITS-GYTLDGPCEIWIDNTLALAGRNCHTEFP---  154
                 L+D   +F N     QPIPTN + ITS G    G CE  + +   L   +C++E+    
Sbjct  4992933  SLYDAAYSFTNRNGTPQPIPTNANAITSHGLIYTGSCEF*LGDKKLLYADDCYSEYSHLN  4992754

Query  155      ---EGHHTIDYSVC  165
                   +   +IDY  C
Sbjct  4992753  VNVKTESSIDYLSC  4992712

>PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_113, whole genome shotgun sequence
Length=380982

 Score = 212 bits (539),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +3

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ+V+LP P +    KD R+ PLAFLE QNF TT D   Y   N F +LR FMD+ + Y
Sbjct  94689  AHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDN-AKY  94865

Query  294    SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              +V   AD  CGFTDP+  PQPIP +  MRSTGYTHDGPCEVWL++TRVL   NCHE   G
Sbjct  94866  TVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPG  95045

Query  353    KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              K Y +DYS+C  +C L WYWLGVR+LK+ YSWQVYKAC+P+
Sbjct  95046  KDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPL  95168

 Score = 162 bits (409),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 106/171 (62%), Gaps = 1/171 (1%)
 Frame = +3

Query  30     LDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALM  89
              L   +   Q+VL P P +  +  D R +P+A+LE Q   T  +AQ +  +  + TLR  M
Sbjct  94671  LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  94850

Query  90     DDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
              D+   Y+V +     CG T PN   QPIP N +  ++GYT DGPCE+W++NT  L+  NC
Sbjct  94851  DN-AKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNC  95027

Query  150    HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              H +FP   +TIDYS C ++C + W+WLG+++  E+YSWQV+K CI LS SA
Sbjct  95028  HEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSA  95180

>PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_761.1_contig_1:1:9298:1 
REF
Length=9298

 Score = 209 bits (532),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = -2

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +  + K+ ++ PLAFLE Q F+T +D   +   NG+ +LRAFMD  + Y
Sbjct  867  AHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDM-AKY  691

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V   AD+ CG+TDP+   QPIP+G  MRSTGYTHDGPCEVW+D+TRVL+  NCHE I+G
Sbjct  690  QVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITG  511

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYSAC G+C L WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  510  KDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPL  388

 Score = 155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 1/163 (1%)
 Frame = -2

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  D  + + +P+A+LE QG  T  +A  W  + GY TLRA MD    Y V
Sbjct  861  QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDM-AKYQV  685

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            TE   + CG T PN   QPIP  G+  ++GYT DGPCE+WIDNT  L   NCH       
Sbjct  684  TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKD  505

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C  +C + W+WLG+++    YSWQV+K CI L++ +
Sbjct  504  YTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTSGS  376

>PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.66, whole genome shotgun 
sequence
Length=310063

 Score = 205 bits (522),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 117/163 (72%), Gaps = 4/163 (2%)
 Frame = -1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+ P P +T + KD ++ PLAFLEGQ F T +DF  +   NG+ +LR FMD  + Y
Sbjct  163105  AHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKY  162929

Query  294     SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +V   AD+ CG+TDP   PQPIP  G MRSTGYTHDGPCEVWLDD RVL+  NCHE I G
Sbjct  162928  TVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPG  162749

Query  353     KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS+C   G C L WYWLGVR+LK  YSWQVYK C+P+
Sbjct  162748  KDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  162620

 Score = 149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 97/164 (59%), Gaps = 3/164 (2%)
 Frame = -1

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +  D  D + +P+A+LE QG  T  +   W  + GY TLR  MD    Y+V
Sbjct  163099  QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKYTV  162923

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               TE   + CG T P    QPIP  G+  ++GYT DGPCE+W+D+   L G NCH   P   
Sbjct  162922  TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  162743

Query  158     HTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
               +TIDYS C +   C + W+WLG+++    YSWQV+K CI L+ +
Sbjct  162742  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTT  162611

>PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.46, whole genome shotgun 
sequence
Length=493760

 Score = 205 bits (522),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 117/163 (72%), Gaps = 4/163 (2%)
 Frame = -3

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ+V+ P P +T + KD ++ PLAFLEGQ F T +DF  +   NG+ +LR FMD  + Y
Sbjct  3966  AHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKY  3790

Query  294   SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             +V   AD+ CG+TDP   PQPIP  G MRSTGYTHDGPCEVWLDD RVL+  NCHE I G
Sbjct  3789  TVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPG  3610

Query  353   KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             K Y +DYS+C   G C L WYWLGVR+LK  YSWQVYK C+P+
Sbjct  3609  KDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  3481

 Score = 149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 97/164 (59%), Gaps = 3/164 (2%)
 Frame = -3

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             Q+VL P P +  D  D + +P+A+LE QG  T  +   W  + GY TLR  MD    Y+V
Sbjct  3960  QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKYTV  3784

Query  98    TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
             TE   + CG T P    QPIP  G+  ++GYT DGPCE+W+D+   L G NCH   P   
Sbjct  3783  TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  3604

Query  158   HTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
             +TIDYS C +   C + W+WLG+++    YSWQV+K CI L+ +
Sbjct  3603  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTT  3472

>PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.20, whole genome shotgun 
sequence
Length=1049362

 Score = 202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+ PAP +  + +D +  PLAFLE Q F T +DF  +   NG+ +LR FM+  + Y
Sbjct  363587  AHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH-AKY  363763

Query  294     SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               +V   ADF CG+T+P   PQPIP  GIMRSTGYTH+GPCE+W+ DT+V Q DNCH  + G
Sbjct  363764  TVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPG  363943

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               K Y +DYS C G+C LYWYWLGVR+LK  YSWQVYK C+P+
Sbjct  363944  KEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPL  364066

 Score = 148 bits (373),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 98/163 (60%), Gaps = 1/163 (1%)
 Frame = +2

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL+P P ++ D  D + +P+A+LE QG  T  + ++W  + GY TLR  M+    Y+V
Sbjct  363593  QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH-AKYTV  363769

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               TE   F CG T P    QPIP  G   ++GYT +GPCE+W+ +T      NCH   P   
Sbjct  363770  TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKE  363949

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               + IDYS C  +C + W+WLG+++    YSWQV+K CI L+ ++
Sbjct  363950  YPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  364078

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 18/107 (17%)
 Frame = +3

Query  295     VNASADFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHE  348
               ++   D +CG T  +  PQPIP DG ++       G+TH GPCE++LDD  VL  D+C +
Sbjct  581133  LDMVKDQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCED  581312

Query  349     VISG------KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                  G      +T D+  D+S+CNG C L  YWL      Q   WQ Y
Sbjct  581313  EFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTY  581441

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 17/99 (17%)
 Frame = +3

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHH-  158
               CG T  N + QPIP +G          G+T  GPCEI++D+ + L G +C  EF  G + 
Sbjct  581157  CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  581336

Query  159     -------TIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                       +D+S C   C ++ +WL      +   WQ +
Sbjct  581337  SKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTY  581441

>PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 
genomic scaffold, whole genome shotgun sequence
Length=313873

 Score = 135 bits (341),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +1

Query  310     AAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTL  368
                 PQPIP G  MRSTGYTHDGPCEVWLDD  VL  DNCHE   GK Y +DYS+C G+CTL
Sbjct  267289  GTPQPIPAGDAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCKGTCTL  267468

Query  369     YWYWLGVRYLKQVYSWQVYKACVPI  393
                WYWLG+R+LK  YSWQVYKAC+P+
Sbjct  267469  RWYWLGIRFLKNKYSWQVYKACIPL  267543

 Score = 97.8 bits (242),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = +3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T + KD ++ PLAFLE Q F    DF  + D NG+ SLR FM D + Y
Sbjct  267039  AHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM-DRAKY  267215

Query  294     SVNASADFRCGFTDPDAAPQPIPDG  318
                V + ADF CGFTDP   PQPIP G
Sbjct  267216  DVTSGADFSCGFTDPKGTPQPIPAG  267290

 Score = 106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  115     QPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWF  174
               QPIP   +  ++GYT DGPCE+W+D+ + L G NCH +FP   +T+DYS C  +C + W+
Sbjct  267298  QPIPAGDAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWY  267477

Query  175     WLGIKYQGERYSWQVFKNCINLSASA  200
               WLGI++   +YSWQV+K CI L+ S 
Sbjct  267478  WLGIRFLKNKYSWQVYKACIPLAGSG  267555

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 44/90 (49%), Gaps = 1/90 (1%)
 Frame = +3

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               Q+VL P P +     D + +P+A+LE QG     + + W  E GY +LR  M D   Y V
Sbjct  267045  QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM-DRAKYDV  267221

Query  98      TEEGLFDCGLTFPNTETQPIPTNGSFITSG  127
               T    F CG T P    QPIP   +   SG
Sbjct  267222  TSGADFSCGFTDPKGTPQPIPAGDAAAYSG  267311

>PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2165, whole genome shotgun sequence
Length=94632

 Score = 197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = +1

Query  233    MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
              +AHQ+++LP P +    KD ++ PLAFLE QNF T+ DF GYL  N ++SLR F+   + 
Sbjct  34612  IAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRAN-  34788

Query  293    YSVNASADFRCGFTDPDAAPQPIPDGI-MRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
              Y+V   AD  CGFTDP+  PQPIP G  MR TGYTHDG CE+WLDDT+VL   NCH    
Sbjct  34789  YTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFP  34968

Query  352    GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              GK   +DYS+C  +C +YWYWL VR LK  YSWQVYKAC+P+
Sbjct  34969  GKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPL  35094

 Score = 136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 95/163 (58%), Gaps = 1/163 (1%)
 Frame = +1

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              Q++L P P +  +  D + +P+A+LE Q   T+ +   +L +  Y +LR  +     Y+V
Sbjct  34621  QIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRAN-YTV  34797

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              TE    DCG T PN   QPIP   +   +GYT DG CE+W+D+T  L+G NCH +FP   
Sbjct  34798  TEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKD  34977

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                +DYS C ++C + W+WL ++     YSWQV+K CI L+ S 
Sbjct  34978  CPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSG  35106

>PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.39, whole genome shotgun 
sequence
Length=634653

 Score = 192 bits (488),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 117/167 (70%), Gaps = 7/167 (4%)
 Frame = +3

Query  233     MAHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFM  287
                AHQ+V +P+PT+T     +      W PL+FLE + ++T ++F  Y   NG+ SLR FM
Sbjct  151032  QAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFM  151211

Query  288     DDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNC  346
               D+ + YSV   AD  CG+TDP   PQ IP DG MR++GYTHDGPCE+++ DT  L + NC
Sbjct  151212  DN-AKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNC  151388

Query  347     HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               HE I+ +T+ LDYSAC  SC LYWYWLGVRYLK+ YSWQVYK C+P+
Sbjct  151389  HESITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  151529

 Score = 183 bits (464),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 111/166 (67%), Gaps = 7/166 (4%)
 Frame = +3

Query  234     AHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +PAPT+T      K+ R  W PL+FLE + F T ++F  +   NG+ SLR FMD
Sbjct  149853  AHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD  150032

Query  289     DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
                 + Y V   AD  CG+TDP   PQ IP DG MR+TGYTHDGPCE+++ +   L + NCH
Sbjct  150033  R-AKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCH  150209

Query  348     EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               E I  +T+ LDYS C  SC LYWYWLGVR LK  YSWQVYK C+PI
Sbjct  150210  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  150347

 Score = 129 bits (323),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 1/140 (1%)
 Frame = +3

Query  57      SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
               +P+++LE++G  T      +  + GY +LR  MD+   YSVT+     CG T P    Q 
Sbjct  151113  NPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQ  151289

Query  117     IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
               IP +G+  TSGYT DGPCEI++ +TLAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  151290  IPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWL  151469

Query  177     GIKYQGERYSWQVFKNCINL  196
               G++Y  ++YSWQV+K CI L
Sbjct  151470  GVRYLKKKYSWQVYKECIPL  151529

 Score = 123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 1/138 (1%)
 Frame = +3

Query  57      SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
               +P+++LE++G  T      +  + GY +LR  MD    Y VTE     CG T P    Q 
Sbjct  149931  NPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFMDR-AKYKVTEGADQACGWTDPKGIPQK  150107

Query  117     IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
               IP +G+  T+GYT DGPCEI++   LAL+  NCH   PE    +DYS CG+SC + W+WL
Sbjct  150108  IPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWL  150287

Query  177     GIKYQGERYSWQVFKNCI  194
               G++    +YSWQV+K CI
Sbjct  150288  GVRKLKGKYSWQVYKECI  150341

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 69/137 (50%), Gaps = 16/137 (12%)
 Frame = +2

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
              +G N  + D F     AN F  L+  MDD S+Y  +      CGFT+P+  PQPIP DG 
Sbjct  68759  DGNNPKSVDTFKSLKAANNFKDLKTLMDDTSVYGAD------CGFTNPNGTPQPIPTDGK  68920

Query  320    MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
                 S    H GPC +WLDD  VL  D+C      +  D+      DYS+C NG C  + +
Sbjct  68921  ATFSRALVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRF  69100

Query  371    YWLGVRYLKQVYSWQVY  387
              YWL  + L +   WQ Y
Sbjct  69101  YWLAFQGLNKKTVWQSY  69151

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (48%), Gaps = 15/122 (12%)
 Frame = +2

Query  78     AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
              A   +  L+ LMDD  +Y        DCG T PN   QPIPT+G +  +      GPC I
Sbjct  68804  AANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHGPCGI  68965

Query  137    WIDNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQ  188
              W+D+ + L   +C  ++   +  I      DYS C  G   ++ ++WL  +   ++  WQ
Sbjct  68966  WLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQ  69145

Query  189    VF  190
               +
Sbjct  69146  SY  69151

>PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3459:1:3265:1 
REF
Length=3265

 Score = 189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 107/163 (66%), Gaps = 3/163 (2%)
 Frame = +1

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ V LP   YTV  ++  W P A LE Q + TT DF  YL AN + +LR FMD    Y
Sbjct  2074  AHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAY  2253

Query  294   SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               N+ A F CGFTDP A  QPIP DG  R++GYTH+GPCE+W+DD RV   DNCH  IS 
Sbjct  2254  KPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISE  2433

Query  353   KTY--DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               +   +DYSAC G+C L WYWLG+R   + YSWQ+YKAC+P+
Sbjct  2434  TAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  2562

 Score = 145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 89/162 (55%), Gaps = 2/162 (1%)
 Frame = +1

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             Q V  P   + V   +    P A LE+QG  T  +   +L    Y TLR  MD  G Y  
Sbjct  2080  QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  2259

Query  98    TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                  F+CG T P    QPIP +G+F TSGYT +GPCEIWID+     G NCH +  E  
Sbjct  2260  NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  2439

Query  158   HT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
              T  IDYS C  +C + W+WLGI+  G+ YSWQ++K CI LS
Sbjct  2440  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  2565

>PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_711:1:15030:1 
REF
Length=15030

 Score = 188 bits (478),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 109/162 (67%), Gaps = 3/162 (2%)
 Frame = +1

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ V +P P +TV  K   W PL+FLE     T++   G++   G+ +LRA MDD  LY
Sbjct  5176  AHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLY  5355

Query  294   SVNASAD-FRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
               N++AD F CG+TDP    Q IP D  MR+TGYTH GPCEVW+DD RV+  DNCHE +S
Sbjct  5356  KTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVS  5535

Query  352   GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               T  +DYS C G CT+ WYWLG+RYLK+ +SWQVYK C+ +
Sbjct  5536  NTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIAL  5658

 Score = 160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 1/159 (1%)
 Frame = +2

Query  40     VLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE  99
              V YP PFF++DG     + VA LE Q V T+ +   +L ++GYA+LRA++DD+ LY V  
Sbjct  10793  VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  10972

Query  100    EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
              + +F+CG T P  E+QPIPTNG    +GY  DGPCEIWID+   L+  NC  +FP     
Sbjct  10973  DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  11152

Query  160    IDYSVCGESCRVSWFWLGI-KYQGERYSWQVFKNCINLS  197
              +DYS C   C + W+ L + K  G  YSW+V+KNC+ LS
Sbjct  11153  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  11269

 Score = 151 bits (381),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 100/163 (61%), Gaps = 2/163 (1%)
 Frame = +2

Query  233    MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
              +A+  V  P P + ++G       +A LE QN +T+ D  G+L   G+ SLRA +DD++L
Sbjct  10778  VANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETL  10957

Query  293    YSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
              Y VN  + F CG+TDP    QPIP +G +R TGY  DGPCE+W+DD ++L   NC +   
Sbjct  10958  YDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFP  11137

Query  352    GKTYDLDYSACNGSCTLYWYWLGV-RYLKQVYSWQVYKACVPI  393
              G +  LDYS+C G CTL WY L V +     YSW+VYK CV +
Sbjct  11138  GTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  11266

 Score = 141 bits (355),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 100/176 (57%), Gaps = 2/176 (1%)
 Frame = +1

Query  33    GLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDD  92
             G    Q V  P P + V       +P+++LE+ GV T+     ++ ++GY+TLRALMDD 
Sbjct  5167  GADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDS  5346

Query  93    GLYSVTEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
              LY        F CG T P+  +Q IP + +  T+GYT  GPCE+WID+   +AG NCH 
Sbjct  5347  KLYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHE  5526

Query  152   EFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGL  207
             +       +DYS C   C + W+WLG++Y  +++SWQV+KNCI L+        G+
Sbjct  5527  QVSNTTK-VDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALTGDGAAISKGV  5691

 Score = 108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +3

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ V LPAPT+TV+ +  ++ PLAFLEGQ +  T DF  Y  + G+ +LR FMDD   Y
Sbjct  3558  AHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAY  3737

Query  294   SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGP  330
              V+   +F CG++     PQPIP  G +RSTGYTHDGP
Sbjct  3738  KVDG-GNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  3848

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ V+LP PT+TV+ +  ++ PLAFLE Q F TT DF  Y    G+ +LR FMDD + Y
Sbjct  1051  AHQYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAY  1230

Query  294   SVNASADFRCGFTDPDAAPQPIP  316
              V+   DF CG++     PQPIP
Sbjct  1231  KVDG-GDFECGWSTLKGTPQPIP  1296

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 1/96 (1%)
 Frame = +3

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             Q V  P P + V     + +P+A+LE QG     +   +   +GY  LR  MDD   Y V
Sbjct  3564  QYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKV  3743

Query  98    TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGP  133
              + G F+CG +      QPIP  G+  ++GYT DGP
Sbjct  3744  -DGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  3848

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +1

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             Q VL P P + V     + +P+A+LE QG  T  + + +  ++GY TLR  MDD   Y V
Sbjct  1057  QYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKV  1236

Query  98    TEEGLFDCGLTFPNTETQPIP  118
              + G F+CG +      QPIP
Sbjct  1237  -DGGDFECGWSTLKGTPQPIP  1296

>PHCA:scaffold_67 PHYCAscaffold_67
Length=292061

 Score = 187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 116/166 (70%), Gaps = 7/166 (4%)
 Frame = -1

Query  234     AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +P+PT+T     +      W PL+FLE + ++T ++F  Y   NG+ +LR FMD
Sbjct  219845  AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFMD  219666

Query  289     DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
               + + Y+V   AD  CG++DP+  PQ IP DG MR++GYTHDGPCE+W+ D   L + NCH
Sbjct  219665  N-AKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  219489

Query  348     EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               E I+ +T+ LDYS C  SC LYWYWLGVRYLK+ YSWQVYK C+P+
Sbjct  219488  ESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  219351

 Score = 182 bits (462),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 112/166 (67%), Gaps = 7/166 (4%)
 Frame = -1

Query  234     AHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +P+PT+T      K+ R  W PL+FLE + F T ++F  Y   NG+ SLR FM+
Sbjct  220853  AHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFME  220674

Query  289     DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
                 + Y V+  AD  CG++DP   PQ IP DG MR++GYTHDGPCE+W+ D   L + NCH
Sbjct  220673  K-AKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  220497

Query  348     EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               E I  +T+ LDYS C  SC LYWYWLGVR LK  YSWQVYK C+P+
Sbjct  220496  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  220359

 Score = 128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 1/140 (1%)
 Frame = -1

Query  57      SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
               +P+++LE++G  T      +  + GY  LR  MD+   Y+VT+     CG + PN   Q 
Sbjct  219767  NPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDN-AKYAVTDGADQACGWSDPNGIPQQ  219591

Query  117     IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
               IP +G+  TSGYT DGPCEIW+ + LAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  219590  IPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWL  219411

Query  177     GIKYQGERYSWQVFKNCINL  196
               G++Y  ++YSWQV+K CI L
Sbjct  219410  GVRYLKKKYSWQVYKECIPL  219351

 Score = 125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 93/164 (57%), Gaps = 6/164 (4%)
 Frame = -1

Query  38      QVVLYPPPFFVVDGMDYRG-----SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDD  92
               QVV  P P +       +      +P+++LE++G  T      +  + GY +LR  M+  
Sbjct  220847  QVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFMEK-  220671

Query  93      GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTE  152
                 Y V++     CG + P    Q IP++G+  TSGYT DGPCEIW+ + LAL+  NCH  
Sbjct  220670  AKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHES  220491

Query  153     FPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                PE    +DYS CG+SC + W+WLG++    +YSWQV+K CI L
Sbjct  220490  IPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  220359

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 71/137 (52%), Gaps = 16/137 (12%)
 Frame = +1

Query  261     EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
               +G N  + D F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  112489  DGNNPQSVDTFKSLKAANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  112650

Query  320     MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
                  S    H GPCE+WLDD +VL  D+C      K  D+      DYS+C NG C  + +
Sbjct  112651  ATFSRALVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRF  112830

Query  371     YWLGVRYLKQVYSWQVY  387
               YWL  + L +   WQ Y
Sbjct  112831  YWLAFQGLSKKTVWQSY  112881

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 67/140 (48%), Gaps = 18/140 (13%)
 Frame = +1

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEI  136
               A   +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEI
Sbjct  112534  AANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEI  112695

Query  137     WIDNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQ  188
               W+D+   L   +C +++   +  I      DYS C  G   ++ ++WL  +   ++  WQ
Sbjct  112696  WLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQ  112875

Query  189     VFKN--CI-NLSASALVTMI  205
                +    C+  L  + L+T I
Sbjct  112876  SYSKFLCV*QLR*ATLLTKI  112935

>PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_560:1:21458:1 
REF
Length=21458

 Score = 187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 105/163 (64%), Gaps = 3/163 (2%)
 Frame = +2

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
              AHQ V  P   YT+  +   W P A LE Q + TT DF  YL ANG+ +LR FMD    Y
Sbjct  12578  AHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAY  12757

Query  294    SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                N  A   CG+TDP+A PQPIP +G  R++GYTH+GPCE+W+DD  V    NCH  IS 
Sbjct  12758  KANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISE  12937

Query  353    KTY--DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              K +   +DYSAC G C L WYWLG+R + + YSWQ+YKAC+P+
Sbjct  12938  KAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  13066

 Score = 184 bits (467),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 114/167 (68%), Gaps = 7/167 (4%)
 Frame = -3

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             AHQ V +PAPT+T   ++  W PLAFLE Q     DD  G+L + G  +LR +MD+ + Y
Sbjct  8565  AHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANY  8386

Query  294   SVNA-SADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQH--DNCHEV  349
              + A  A F CG+T+P+ A QPIP +G+MRSTGYTHDGPCEVWLD+TRVL     NCH  
Sbjct  8385  KIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRD  8206

Query  350   ISGK--TYDLDYSACNGSCTLYWYWLGVRYL-KQVYSWQVYKACVPI  393
             +  K  +Y +D+S C G+C L WYWLG R +  + +SWQ+YKACVP+
Sbjct  8205  VGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  8065

 Score = 176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 110/165 (67%), Gaps = 7/165 (4%)
 Frame = -1

Query  235    HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYS  294
              HQ + +PAPT T + ++    PLAFLE Q    TDD  GYL   G  +LR FMD+ + Y 
Sbjct  11303  HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  11127

Query  295    VNAS-ADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVL--QHDNCHEVI  350
              V A+ A F CG+TDP+ A QPIP +G+MRSTGYTHDGPCEVWLD+TRVL     +CH+ I
Sbjct  11126  VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  10947

Query  351    SGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                   +Y +D+S C G+C L WYWL  R +   +SWQVYK CVP+
Sbjct  10946  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  10812

 Score = 154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 94/162 (58%), Gaps = 2/162 (1%)
 Frame = +2

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              Q V +P   + +        P A LE QG  T  +   +L+  GY TLR  MD  G Y  
Sbjct  12584  QRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKA  12763

Query  98     TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               +    +CG T PN   QPIPTNG F TSGYT +GPCEIWID+ +  +G+NCH +  E  
Sbjct  12764  NKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKA  12943

Query  158    HT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
               T  IDYS C   C + W+WLGI+  G++YSWQ++K CI L+
Sbjct  12944  FTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  13069

 Score = 135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 98/172 (57%), Gaps = 6/172 (3%)
 Frame = -1

Query  38     QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
              Q +  P P    D  +   +P+A+LE QGV    +   +L ++G  TLR  MD+   Y V
Sbjct  11300  QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  11124

Query  98     TEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR--NCHTEFP  154
                 G  F+CG T PN   QPIP+NG   ++GYT DGPCE+W+DNT  L     +CH +  
Sbjct  11123  EAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIG  10944

Query  155    EG--HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
              +G   + ID+S C  +C + W+WL  +  G ++SWQV+K C+ L  SA  ++
Sbjct  10943  QGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAARSL  10788

 Score = 131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 94/169 (56%), Gaps = 6/169 (4%)
 Frame = -3

Query  38    QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
             Q V  P P F  +  +   +P+A+LE QGV    +   +L  +G  TLR  MD+   Y +
Sbjct  8559  QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  8380

Query  98    TEEGL-FDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR--NCHTEFP  154
                G  F+CG T PN   QPIP NG   ++GYT DGPCE+W+DNT  L     NCH +  
Sbjct  8379  EARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDVG  8200

Query  155   EG--HHTIDYSVCGESCRVSWFWLGIKY-QGERYSWQVFKNCINLSASA  200
                  + ID+S C  +C + W+WLG +   G+++SWQ++K C+ L  S 
Sbjct  8199  NKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSG  8053

>PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.16, whole genome shotgun 
sequence
Length=1156373

 Score = 186 bits (471),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 6/166 (4%)
 Frame = +2

Query  234     AHQLVILPAPTYT--VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDS  291
               AHQL++ P P +   +  +D RW+PLAFLE Q F    DF G+   +G+ +LR FMD   
Sbjct  488759  AHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAK  488938

Query  292     LY-SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEV  349
                  SV   AD  CG T+    P+PIP DG+M+STGYTHDGPC V+LDD  VL++DNCHE 
Sbjct  488939  YTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEK  489118

Query  350     ISGKTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               + GK+Y +DYS+C   G CTLYW+WLG+R++K  +SWQVYK CVP+
Sbjct  489119  LPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPL  489256

 Score = 126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 93/166 (56%), Gaps = 5/166 (3%)
 Frame = +2

Query  38      QVVLYPPPFFV--VDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLY  95
               Q++L P P +   ++  D R  P+A+LE QG     +   W A+ GY  LR  MD     
Sbjct  488765  QLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYT  488944

Query  96      -SVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
                SVT      CGLT      +PIP +G   ++GYT DGPC +++D+ L L   NCH + P
Sbjct  488945  TSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLP  489124

Query  155     EGHHTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                  + IDYS C +   C + WFWLGI++   R+SWQV+K C+ L+A
Sbjct  489125  GKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLTA  489262

>PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 
genomic scaffold, whole genome shotgun sequence
Length=2518706

 Score = 184 bits (468),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 114/167 (68%), Gaps = 6/167 (4%)
 Frame = -2

Query  233      MAHQLVILPAPTYT--VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDD  290
                +AHQL+  P P +   +  +D RW+PLAFLE Q F   +DF G+   NG+  LR FMD  
Sbjct  1575784  VAHQLIQQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRA  1575605

Query  291      S-LYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHE  348
                  + SV   AD  CG T+    P+PIP DG MRSTGYTHDGPC ++LDD  V+++DNCHE
Sbjct  1575604  KYVTSVTPGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHE  1575425

Query  349      VISGKTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 I G+TY +D+S+C   G CTLYW+WLG+R++K  +SWQVYK C+ +
Sbjct  1575424  SIPGRTYKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISL  1575284

 Score = 129 bits (325),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = -3

Query  286      FMDDDS-LYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQH  343
                FMD    + SV + A   CG T+   +P+PIP DG++ STGYTHDGPC  +LDD  VL++
Sbjct  1594350  FMDRAKYVTSVTSGAHQTCGLTEVKGSPRPIPKDGMVTSTGYTHDGPCAFYLDDVLVLEY  1594171

Query  344      DNCHEVISGKTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 NCHE I+ +T+ +D+S+C   G CTLYW+WLG+R++K  +SWQVYK C+P+
Sbjct  1594170  PNCHESITSRTHKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECIPL  1594015

 Score = 52.4 bits (124),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 2/54 (4%)
 Frame = -2

Query  233      MAHQLVILPAPTYT--VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLR  284
                +AHQL+  P P +   +  +D RW PLAFLE Q F   +DF G+   NG+  LR
Sbjct  1594516  VAHQLIQQPEPIWKPGISDRDTRWNPLAFLESQGFPCQEDFNGWRAKNGYKDLR  1594355

 Score = 119 bits (297),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -1

Query  294      SVNASADFRCGFTDPDAAPQPI-PDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                SV   AD  CG T+    P+PI  DG++ STGYTHDGPC  +LDD  V+++DNCHE I+ 
Sbjct  1596299  SVTPGADQTCGLTEVKGPPRPISKDGMVTSTGYTHDGPCAFYLDDVLVMEYDNCHESITS  1596120

Query  353      KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                +T+ +D+S+C   G  TLYW+WLG+R++K  +S Q YK C+P+
Sbjct  1596119  RTHKIDFSSCQKKGGGTLYWFWLGIRFVKSRWSRQAYKECIPL  1595991

 Score = 56.2 bits (134),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = -3

Query  234      AHQLVILPAPTYT--VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDD  290
                AHQ+++ P P +   +  +D RW+ LAFLE Q F   +DF G+   NG+  LR FMD D
Sbjct  1596477  AHQVMLKPEPIWKPGISDRDTRWRLLAFLESQGFPCQEDFDGWRAKNGYKDLRDFMDRD  1596301

 Score = 124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 94/166 (57%), Gaps = 5/166 (3%)
 Frame = -2

Query  38       QVVLYPPPFFV--VDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDG-L  94
                Q++  P P +   ++  D R  P+A+LE QG     +   W A+ GY  LR  MD    +
Sbjct  1575775  QLIQQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYV  1575596

Query  95       YSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
                 SVT      CGLT      +PIP +G+  ++GYT DGPC I++D+ L +   NCH   P
Sbjct  1575595  TSVTPGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIP  1575416

Query  155      EGHHTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                   + ID+S C +   C + WFWLGI++   R+SWQV+K CI+L+A
Sbjct  1575415  GRTYKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLTA  1575278

 Score = 95.9 bits (237),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 62/107 (58%), Gaps = 2/107 (2%)
 Frame = -3

Query  94       LYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEF  153
                + SVT      CGLT      +PIP +G   ++GYT DGPC  ++D+ L L   NCH   
Sbjct  1594329  VTSVTSGAHQTCGLTEVKGSPRPIPKDGMVTSTGYTHDGPCAFYLDDVLVLEYPNCHESI  1594150

Query  154      PEGHHTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                    H ID+S C +   C + WFWLGI++   R+SWQV+K CI L+A
Sbjct  1594149  TSRTHKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECIPLTA  1594009

 Score = 32.3 bits (72),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 2/53 (4%)
 Frame = -2

Query  38       QVVLYPPPFFV--VDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRAL  88
                Q++  P P +   +   D R +P+A+LE QG     +   W A+ GY  LR L
Sbjct  1594507  QLIQQPEPIWKPGISDRDTRWNPLAFLESQGFPCQEDFNGWRAKNGYKDLREL  1594349

 Score = 80.5 bits (197),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 2/105 (2%)
 Frame = -1

Query  96       SVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPE  155
                SVT      CGLT      +PI  +G   ++GYT DGPC  ++D+ L +   NCH     
Sbjct  1596299  SVTPGADQTCGLTEVKGPPRPISKDGMVTSTGYTHDGPCAFYLDDVLVMEYDNCHESITS  1596120

Query  156      GHHTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                  H ID+S C +     + WFWLGI++   R+S Q +K CI L+A
Sbjct  1596119  RTHKIDFSSCQKKGGGTLYWFWLGIRFVKSRWSRQAYKECIPLTA  1595985

 Score = 35.8 bits (81),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 28/57 (49%), Gaps = 2/57 (4%)
 Frame = -3

Query  38       QVVLYPPPFFV--VDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDD  92
                QV+L P P +   +   D R   +A+LE QG     +   W A+ GY  LR  MD D
Sbjct  1596471  QVMLKPEPIWKPGISDRDTRWRLLAFLESQGFPCQEDFDGWRAKNGYKDLRDFMDRD  1596301

>PHSO:scaffold_12
Length=2105860

 Score = 183 bits (465),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 111/166 (67%), Gaps = 7/166 (4%)
 Frame = -3

Query  234     AHQLVILPAPTYT-----VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +P+PT+T        +   W PLAFLE Q F T  +F  Y   NG+ SLR FMD
Sbjct  168911  AHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQTQ*NFTQYQVDNGYKSLRDFMD  168732

Query  289     DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
               + + Y+V   AD  CG+TDP    Q IP DG MR++GYTHDGPCE+++ D   L + NCH
Sbjct  168731  N-AKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  168555

Query  348     EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               E I+ +T+ LDYS C  SCTLYWYWLGVR+L   YSWQVYK C+PI
Sbjct  168554  ESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  168417

 Score = 181 bits (458),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 8/166 (5%)
 Frame = -1

Query  234     AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +P PT+T     +      WKPLAFLEGQ F+T  +F  ++  NG+ SLR FMD
Sbjct  162415  AHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRDFMD  162236

Query  289     DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
               + + YSV   AD  CG+TDP+  PQ IP DG MR++G+THD PCE+++ D   L + NCH
Sbjct  162235  NGN-YSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCH  162059

Query  348     EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               E I+ + + LDYSAC  SC LYWYWLGVR++K + S QVYK C+PI
Sbjct  162058  ESITSQPFKLDYSACGDSCVLYWYWLGVRFIKGI-S*QVYKECIPI  161924

 Score = 179 bits (453),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 110/166 (66%), Gaps = 7/166 (4%)
 Frame = -2

Query  234     AHQLVILPAPTYT-----VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +P+PT+T        +   W PL+FLE + F T ++F  Y   NG+ SLR FM+
Sbjct  167610  AHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFME  167431

Query  289     DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
                 + Y +   AD  CG+TDP   PQ IP DG MR++GYTHDGPCE+++ D   L + NCH
Sbjct  167430  R-AKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  167254

Query  348     EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               E I+ +T+ LDYS C  SC LYWYWLGVR LK  +SWQVYK C+P+
Sbjct  167253  ESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  167116

 Score = 99.4 bits (246),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  308     PDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSC  366
               P  +PQ IPD  IMR+ GYT DGPCE+WLD+T      +C   +   TY LDYS C  SC
Sbjct  210302  PKRSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASC  210123

Query  367     TLYWYWLGVRYLKQVYSWQVYKACVPI  393
                +YWY LGV    +VYSW+VYK C+P+
Sbjct  210122  VMYWYTLGVAKPDRVYSWEVYKECIPL  210042

 Score = 63.2 bits (152),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 6/79 (8%)
 Frame = -1

Query  234     AHQLVILPAPTYTV-----EGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               A+Q+V +PAPT+T      + +   W PLA+ E Q F+T+ +F  +   NGF +LR FMD
Sbjct  210535  ANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMD  210356

Query  289     DDSLYSVNASADFRCGFTD  307
               + + YSV + AD  CG+TD
Sbjct  210355  NGN-YSVTSGAD*ACGWTD  210302

 Score = 128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 86/138 (62%), Gaps = 1/138 (1%)
 Frame = -3

Query  57      SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
               +P+A+LE QG  T      +  + GY +LR  MD+   Y+VTE     CG T P    Q 
Sbjct  168833  NPLAFLENQGFQTQ*NFTQYQVDNGYKSLRDFMDN-AKYTVTEGADQACGWTDPKGIAQQ  168657

Query  117     IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
               IP++G+  TSGYT DGPCEI++ + LAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  168656  IPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWL  168477

Query  177     GIKYQGERYSWQVFKNCI  194
               G+++   +YSWQV+K CI
Sbjct  168476  GVRFLNNKYSWQVYKECI  168423

 Score = 115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = -2

Query  57      SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
               +P+++LE++G  T      +  + GY +LR  M+    Y +T+     CG T P    Q 
Sbjct  167532  NPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFMER-AKYKLTDGADQACGWTDPKGIPQQ  167356

Query  117     IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
               IP +G+  TSGYT DGPCEI++ + LAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  167355  IPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWL  167176

Query  177     GIKYQGERYSWQVFKNCINL  196
               G++    ++SWQV+K CI L
Sbjct  167175  GVRKLKGKFSWQVYKECIPL  167116

 Score = 112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 90/150 (60%), Gaps = 5/150 (3%)
 Frame = -1

Query  58      PVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPI  117
               P+A+LE QG  T      ++ + GY +LR  MD+ G YSVT+     CG T PN   Q I
Sbjct  162334  PLAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDN-GNYSVTKGADQACGWTDPNGIPQQI  162158

Query  118     PTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLG  177
               P +G+  TSG+T D PCEI++ + L+L+  NCH         +DYS CG+SC + W+WLG
Sbjct  162157  PEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLG  161978

Query  178     IKYQGERYSWQVFKNCI---NLSASALVTM  204
               +++  +  S QV+K CI   N S+ AL ++
Sbjct  161977  VRFI-KGIS*QVYKECIPIYNGSSGALTSI  161891

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 71/141 (50%), Gaps = 16/141 (11%)
 Frame = +2

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
              +G N  + D F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  95171  DGNNAGSVDAFKALKTANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  95332

Query  320    MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
                 S    H GPCE+WLDD +VL  D+C      +  D+      DYS+C NG C  + +
Sbjct  95333  ATFSRAIVHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRF  95512

Query  371    YWLGVRYLKQVYSWQVYKACV  391
              YWL  + +     WQ Y   V
Sbjct  95513  YWLAFQGVDGKTVWQSYSKFV  95575

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 70/137 (51%), Gaps = 16/137 (12%)
 Frame = +2

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
              +G N  + D F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  97583  DGNNAGSVDAFKALKTANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  97744

Query  320    MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
                 S    H GPCE+WLDD +VL  D+C      +  D+      DYS+C NG C  + +
Sbjct  97745  ATFSRAIVHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRF  97924

Query  371    YWLGVRYLKQVYSWQVY  387
              YWL  + +     WQ Y
Sbjct  97925  YWLAFQGVDGKTVWQSY  97975

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = -3

Query  107     LTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCG  166
               L  P    Q IP +    T GYT DGPCEIW+DNTLA +  +C    P   +T+DYS CG
Sbjct  210311  LDRPKRSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCG  210132

Query  167     ESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                SC + W+ LG+      YSW+V+K CI L
Sbjct  210131  ASCVMYWYTLGVAKPDRVYSWEVYKECIPL  210042

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 57/123 (46%), Gaps = 15/123 (12%)
 Frame = +2

Query  81     GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWID  139
               +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEIW+D
Sbjct  95225  NFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLD  95386

Query  140    NTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVFK  191
              +   L   +C +++   +  I      DYS C  G    + ++WL  +    +  WQ + 
Sbjct  95387  DKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYS  95566

Query  192    NCI  194
                +
Sbjct  95567  KFV  95575

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 56/120 (47%), Gaps = 15/120 (13%)
 Frame = +2

Query  80     RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
                +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEIW+
Sbjct  97634  NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  97795

Query  139    DNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVF  190
              D+   L   +C +++   +  I      DYS C  G    + ++WL  +    +  WQ +
Sbjct  97796  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  97975

>PHSO:scaffold_4
Length=7609242

 Score = 181 bits (459),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = -3

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ+V+ P P +T   K+ ++ PLAFLE Q F+T  DF  +   NG+ +LR FMD    Y
Sbjct  4374349  AHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGK-Y  4374173

Query  294      SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                +V   ADF CG+TDP   PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE I+ 
Sbjct  4374172  TVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIAD  4373993

Query  353      KTYDLDYSACNGSCTLYWYW  372
                K Y +DYSAC G+CTL WYW
Sbjct  4373992  KGYTIDYSACKGTCTLRWYW  4373933

 Score = 181 bits (459),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = +1

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                AHQ+V+ P P +T   K+ ++ PLAFLE Q F+T  DF  +   NG+ +LR FMD    Y
Sbjct  4364944  AHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGK-Y  4365120

Query  294      SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
                +V   ADF CG+TDP   PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE I+ 
Sbjct  4365121  TVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIAD  4365300

Query  353      KTYDLDYSACNGSCTLYWYW  372
                K Y +DYSAC G+CTL WYW
Sbjct  4365301  KGYTIDYSACKGTCTLRWYW  4365360

 Score = 128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 1/138 (1%)
 Frame = -3

Query  38       QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
                Q+VL P P +  +  + + +P+A+LE QG  T  + + W  + GY TLR  MD  G Y+V
Sbjct  4374343  QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDH-GKYTV  4374167

Query  98       TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                T+   F CG T P    QPIP   +  ++GYT DGPCE+WIDNT  L G NCH +  +  
Sbjct  4374166  TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  4373987

Query  158      HTIDYSVCGESCRVSWFW  175
                +TIDYS C  +C + W+W
Sbjct  4373986  YTIDYSACKGTCTLRWYW  4373933

 Score = 128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 1/138 (1%)
 Frame = +1

Query  38       QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
                Q+VL P P +  +  + + +P+A+LE QG  T  + + W  + GY TLR  MD  G Y+V
Sbjct  4364950  QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDH-GKYTV  4365126

Query  98       TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                T+   F CG T P    QPIP   +  ++GYT DGPCE+WIDNT  L G NCH +  +  
Sbjct  4365127  TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  4365306

Query  158      HTIDYSVCGESCRVSWFW  175
                +TIDYS C  +C + W+W
Sbjct  4365307  YTIDYSACKGTCTLRWYW  4365360

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 15/92 (16%)
 Frame = -3

Query  286      FMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI--MRSTGYTHDGPCEVWLDDTRVLQH  343
                 +D  SLY      D  C FT+ +  PQPIP     + S G  H G CE  L D ++L  
Sbjct  2631757  MLDGMSLY------DAACSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  2631596

Query  344      DNC-----HEVISGKT-YDLDYSAC-NGSCTL  368
                D+C     H  ++ KT   +DY +C NG C +
Sbjct  2631595  DDCYSEYSHMNVNVKTESSIDYLSCENGGCKM  2631500

>PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_354.1_contig_1:1:38044:1 
REF
Length=38044

 Score = 180 bits (456),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 112/166 (67%), Gaps = 7/166 (4%)
 Frame = +1

Query  234    AHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
              AHQ+V +P+PT+T      K+ R  W PL+FLE +   T ++F  Y   N + SLR FMD
Sbjct  14314  AHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFMD  14493

Query  289    DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
                + Y V+  AD  CG+TDP   PQ IP DG MR++GYTHDGPCE+++ D   L + NCH
Sbjct  14494  K-AKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  14670

Query  348    EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              E I+ +T+ LDYSAC  SC LYWYWLGVR LK  YSWQ+YK C+P+
Sbjct  14671  ESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  14808

 Score = 120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 6/164 (4%)
 Frame = +1

Query  38     QVVLYPPPFFVVDGMDYRG-----SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDD  92
              QVV  P P +       +      +P+++LE++G+ T      +  +  YA+LR  MD  
Sbjct  14320  QVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFMDK-  14496

Query  93     GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTE  152
                Y V++     CG T P    Q IP +G+  TSGYT DGPCEI++ + LAL+  NCH  
Sbjct  14497  AKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHES  14676

Query  153    FPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                +    +DYS CG+SC + W+WLG++     YSWQ++K CI L
Sbjct  14677  ITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  14808

>PHRA:scaffold_33
Length=496317

 Score = 179 bits (455),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 7/166 (4%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +P+PT+T     +      W PL+FLE + F T ++F  +   NG+ SLR F+D
Sbjct  370573  AHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFLD  370752

Query  289     DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
                 + Y V+  AD  CG++DP   PQ IP DG MR++GYTHDGPCE+++ D   L + NCH
Sbjct  370753  K-AKYKVSDGADQACGWSDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  370929

Query  348     EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               E I+ +T+ LDYS C  SC LYWYWLGVRYLK  YSWQVYK C+P+
Sbjct  370930  ESITDQTFKLDYSGCGDSCILYWYWLGVRYLKGSYSWQVYKECIPL  371067

 Score = 80.1 bits (196),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  337     DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               D   L + NCHE I+ +T+ LDYS C  SC LYWYWLG RYLK  YSWQVYK C+
Sbjct  175586  DKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  175422

 Score = 80.1 bits (196),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  337     DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               D   L + NCHE I+ +T+ LDYS C  SC LYWYWLG RYLK  YSWQVYK C+
Sbjct  171227  DKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  171063

 Score = 58.2 bits (139),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = -1

Query  234     AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +P+PT+T     +      W PL+FLE + F T ++F  +   NG+ SLR F+ 
Sbjct  175908  AHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL-  175732

Query  289     DDSLYSVNASADFRCGFTDP  308
               D + Y V+  AD  C ++DP
Sbjct  175731  DKAKYKVSDGADQACWWSDP  175672

 Score = 58.2 bits (139),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = -1

Query  234     AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
               AHQ+V +P+PT+T     +      W PL+FLE + F T ++F  +   NG+ SLR F+ 
Sbjct  171549  AHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL-  171373

Query  289     DDSLYSVNASADFRCGFTDP  308
               D + Y V+  AD  C ++DP
Sbjct  171372  DKAKYKVSDGADQACWWSDP  171313

 Score = 41.2 bits (95),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 1/29 (3%)
 Frame = -3

Query  308     PDAAPQPIP-DGIMRSTGYTHDGPCEVWL  335
               P+  PQ IP DG M  +GYTHDGPCE+++
Sbjct  175675  PNGIPQQIPEDGTMSPSGYTHDGPCEIYM  175589

 Score = 41.2 bits (95),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 1/29 (3%)
 Frame = -3

Query  308     PDAAPQPIP-DGIMRSTGYTHDGPCEVWL  335
               P+  PQ IP DG M  +GYTHDGPCE+++
Sbjct  171316  PNGIPQQIPEDGTMSPSGYTHDGPCEIYM  171230

 Score = 117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = +1

Query  57      SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
               +P+++LE++G  T      +  + GY +LR  +D    Y V++     CG + P    Q 
Sbjct  370651  NPLSFLEKEGFETQENFTQFQVDNGYTSLRDFLDK-AKYKVSDGADQACGWSDPKGIPQQ  370827

Query  117     IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
               IP +G+  TSGYT DGPCEI++ + LAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  370828  IPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWL  371007

Query  177     GIKYQGERYSWQVFKNCINL  196
               G++Y    YSWQV+K CI L
Sbjct  371008  GVRYLKGSYSWQVYKECIPL  371067

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 71/137 (52%), Gaps = 16/137 (12%)
 Frame = -2

Query  261     EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
               +G N  + D F     AN F  L+  MDD S+Y  +      CGFTDPD  PQPIP DG 
Sbjct  430865  DGNNPQSVDTFKSLKTANNFKDLKTLMDDTSVYGAD------CGFTDPDGTPQPIPTDGK  430704

Query  320     MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSACN-GSCT-LYW  370
                  S    H GPCE+WLDDT+VL  D+C      +  D+      DYS+CN G C  + +
Sbjct  430703  ATFSRALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRF  430524

Query  371     YWLGVRYLKQVYSWQVY  387
               YWL  + L     WQ Y
Sbjct  430523  YWLAFQGLDSKTVWQSY  430473

 Score = 60.8 bits (146),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  140     NTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               + LAL+  NCH    +    +DYS CG+SC + W+WLG +Y    YSWQV+K CI L
Sbjct  175586  DKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  175416

 Score = 60.8 bits (146),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  140     NTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               + LAL+  NCH    +    +DYS CG+SC + W+WLG +Y    YSWQV+K CI L
Sbjct  171227  DKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  171057

 Score = 35.4 bits (80),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -3

Query  110     PNTETQPIPTNGSFITSGYTLDGPCEIWI  138
               PN   Q IP +G+   SGYT DGPCEI++
Sbjct  175675  PNGIPQQIPEDGTMSPSGYTHDGPCEIYM  175589

 Score = 35.4 bits (80),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -3

Query  110     PNTETQPIPTNGSFITSGYTLDGPCEIWI  138
               PN   Q IP +G+   SGYT DGPCEI++
Sbjct  171316  PNGIPQQIPEDGTMSPSGYTHDGPCEIYM  171230

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 60/129 (47%), Gaps = 15/129 (12%)
 Frame = -2

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWIDN  140
               +  L+ LMDD  +Y        DCG T P+   QPIPT+G    S   +  GPCEIW+D+
Sbjct  430808  FKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWLDD  430647

Query  141     TLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVFKN  192
               T  L   +C +++   +  I      DYS C  G   ++ ++WL  +    +  WQ +  
Sbjct  430646  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYSK  430467

Query  193     CINLSASAL  201
                  L   A 
Sbjct  430466  LFGLGMPAF  430440

>PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 
genomic scaffold, whole genome shotgun sequence
Length=4768765

 Score = 175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 114/167 (68%), Gaps = 6/167 (4%)
 Frame = -1

Query  233      MAHQLVILPAPTYT--VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDD-  289
                + HQL++ P P +   +  +D RW+PLAFLE Q F    DF  +   NG+ +LR FMD  
Sbjct  3545341  VPHQLLLEPEPIWKAGINDRDTRWRPLAFLESQGFPCQADFNSWRAQNGYKNLRDFMDRG  3545162

Query  290      DSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHE  348
                +   +V   A+  CG T  +  P+PIP +G++RSTGY+H+GPC  +LDD  V++ DNCHE
Sbjct  3545161  NYTTTVTPGAN*TCGLTKLNGPPRPIPKNGVIRSTGYSHEGPCAAYLDDVLVMEFDNCHE  3544982

Query  349      VISGKTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 I GKT+ +DYS+C   GSCTLYW+WLG+R++K  +SWQVYK CVP+
Sbjct  3544981  KIPGKTHKIDYSSCEKKGSCTLYWFWLGIRFVKSRWSWQVYKECVPL  3544841

 Score = 129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 94/166 (57%), Gaps = 5/166 (3%)
 Frame = -1

Query  38       QVVLYPPPFFV--VDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLY  95
                Q++L P P +   ++  D R  P+A+LE QG     +  +W A+ GY  LR  MD     
Sbjct  3545332  QLLLEPEPIWKAGINDRDTRWRPLAFLESQGFPCQADFNSWRAQNGYKNLRDFMDRGNYT  3545153

Query  96       SVTEEGLF-DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
                +    G    CGLT  N   +PIP NG   ++GY+ +GPC  ++D+ L +   NCH + P
Sbjct  3545152  TTVTPGAN*TCGLTKLNGPPRPIPKNGVIRSTGYSHEGPCAAYLDDVLVMEFDNCHEKIP  3544973

Query  155      EGHHTIDYSVCGE--SCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                   H IDYS C +  SC + WFWLGI++   R+SWQV+K C+ L+A
Sbjct  3544972  GKTHKIDYSSCEKKGSCTLYWFWLGIRFVKSRWSWQVYKECVPLTA  3544835

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 53/102 (52%), Gaps = 18/102 (18%)
 Frame = -2

Query  300      DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
                D +CG+T  D  PQPIP DG ++       G+TH GPCE+++DD  VL  D+C     G 
Sbjct  3973404  DKKCGYTRTDVDPQPIPSDGKVKWWGNGGGGFTHTGPCELYIDDKMVLHGDDCEAEFPGG  3973225

Query  353      -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                           +D+S+CNG CTL  YWL      Q   WQ Y
Sbjct  3973224  PDGSNKMSEMPVDFSSCNGKCTLTIYWLAF----QNTQWQSY  3973111

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 56/98 (57%), Gaps = 16/98 (16%)
 Frame = +3

Query  300      DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
                D +CG+T  D  PQPIP DG ++       G+TH GPCE+++DD  VL  D+C E   G 
Sbjct  3740892  DKKCGYTRADVDPQPIPSDGKVKWWGNGGGGFTHTGPCELYIDDKMVLHGDDCEEEFPGG  3741071

Query  353      -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYS  383
                           +D+S+CNG CTL  YWLG  +LK+  +
Sbjct  3741072  PNGSNKMSEMPVDFSSCNGKCTLTIYWLG--FLKRAVA  3741179

 Score = 62.0 bits (149),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 57/121 (47%), Gaps = 18/121 (15%)
 Frame = +3

Query  76       WLAERGYATLRALMDDDGLYSVTEEGL-----FDCGLTFPNTETQPIPTNGSFI-----T  125
                W+  R    +  +M  +   SV +  L       CG T  + + QPIP++G         
Sbjct  3740799  WIRRRPSRQVYKIMAKEKGMSVKDVVLDMVKDKKCGYTRADVDPQPIPSDGKVKWWGNGG  3740978

Query  126      SGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHH--------TIDYSVCGESCRVSWFWLG  177
                 G+T  GPCE++ID+ + L G +C  EFP G +         +D+S C   C ++ +WLG
Sbjct  3740979  GGFTHTGPCELYIDDKMVLHGDDCEEEFPGGPNGSNKMSEMPVDFSSCNGKCTLTIYWLG  3741158

Query  178      I  178
                 
Sbjct  3741159  F  3741161

 Score = 20.8 bits (42),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 8/18 (44%), Positives = 9/18 (50%), Gaps = 0/18 (0%)
 Frame = +1

Query  187      WQVFKNCINLSASALVTM  204
                WQ + NC  L  S  VT 
Sbjct  3741175  WQAYVNCAPLQGSGSVTQ  3741228

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 17/99 (17%)
 Frame = -2

Query  105      CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
                CG T  + + QPIP++G          G+T  GPCE++ID+ + L G +C  EFP G   
Sbjct  3973395  CGYTRTDVDPQPIPSDGKVKWWGNGGGGFTHTGPCELYIDDKMVLHGDDCEAEFPGGPDG  3973216

Query  157      -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                        +D+S C   C ++ +WL      +   WQ +
Sbjct  3973215  SNKMSEMPVDFSSCNGKCTLTIYWLAF----QNTQWQSY  3973111

 Score = 48.9 bits (115),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 34/64 (53%), Gaps = 9/64 (14%)
 Frame = +2

Query  329      GPCEVWLDDTRVLQHDNCHEVISGKTYD--------LDYSACNGSCTLYWYWLGVRYLK-  379
                GPCE+++DD  VL  D+C     G   D        +DYS+CN SC    YWLG +  + 
Sbjct  3744944  GPCELYIDDKMVLHSDDCESDYPGGPNDSGEMSVMPVDYSSCNASCIFSIYWLGFQNAR*  3745123

Query  380      QVYS  383
                Q YS
Sbjct  3745124  QAYS  3745135

 Score = 28.9 bits (63),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (56%), Gaps = 6/34 (18%)
 Frame = +3

Query  300      DFRCGFTDPDAAPQPIP-DGIMR-----STGYTH  327
                D +CGFT  +  PQPIP DG  +       G+TH
Sbjct  3744780  DKKCGFTTTEVEPQPIPTDGKAKWLGNDGGGFTH  3744881

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 47/87 (54%), Gaps = 14/87 (16%)
 Frame = +2

Query  302      RCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHE------V  349
                +CG T  +   QP+P D  ++       G+TH GPCE++LDD  VL  D+C +      V
Sbjct  3872537  KCGNTLENGDAQPVPSDATVKWLGNGGGGFTHTGPCEIYLDDKMVLHGDDCEDEYKGGAV  3872716

Query  350      ISGKTYDL--DYSACNGSCTLYWYWLG  374
                 S +T D+  D+S+CNG C   W   G
Sbjct  3872717  GSTQTSDMPVDFSSCNGKCDAPWLAEG  3872797

 Score = 47.0 bits (110),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +2

Query  114      TQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVC  165
                T  IP N   +TS   L GPCE++ID+ + L   +C +++P G +         +DYS C
Sbjct  3744902  TDLIPYN--LLTS--DL*GPCELYIDDKMVLHSDDCESDYPGGPNDSGEMSVMPVDYSSC  3745069

Query  166      GESCRVSWFWLGIK  179
                  SC  S +WLG +
Sbjct  3745070  NASCIFSIYWLGFQ  3745111

 Score = 25.4 bits (54),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 11/18 (61%), Gaps = 0/18 (0%)
 Frame = +3

Query  105      CGLTFPNTETQPIPTNGS  122
                CG T    E QPIPT+G 
Sbjct  3744789  CGFTTTEVEPQPIPTDGK  3744842

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 18/99 (18%)
 Frame = +2

Query  105      CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
                CG T  N + QP+P++ +         G+T  GPCEI++D+ + L G +C  E+  G   
Sbjct  3872540  CGNTLENGDAQPVPSDATVKWLGNGGGGFTHTGPCEIYLDDKMVLHGDDCEDEYKGGAVG  3872719

Query  157      -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                        +D+S C   C   W       +G   SW ++
Sbjct  3872720  STQTSDMPVDFSSCNGKCDAPWL-----AEGRDESWVLW  3872821

>PHSO:scaffold_64
Length=40116

 Score = 167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +3

Query  242    APTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADF  301
              A  +T   K+ ++ PLAFLE Q F+T  DF  +   NG+ +LR FMD    Y+V   ADF
Sbjct  37920  AAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDH-GKYTVTKGADF  38096

Query  302    RCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYS  360
               CG+TDP   PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE I+ K Y +DYS
Sbjct  38097  SCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYS  38276

Query  361    ACNGSCTLYWYW  372
              AC G+CTL WYW
Sbjct  38277  ACKGTCTLRWYW  38312

 Score = 119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = +3

Query  57     SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
              +P+A+LE QG  T  + + W  + GY TLR  MD  G Y+VT+   F CG T P    QP
Sbjct  37959  NPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDH-GKYTVTKGADFSCGWTDPKGTPQP  38135

Query  117    IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFW  175
              IP   +  ++GYT DGPCE+WIDNT  L G NCH +  +  +TIDYS C  +C + W+W
Sbjct  38136  IPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  38312

>PHRA:scaffold_494
Length=11395

 Score = 80.1 bits (196),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -1

Query  257   LAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
             L+FLE + F T ++F+ +   NG+ SLR F+D  + Y V+  AD  CG++DP   PQ IP
Sbjct  8560  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDK-AKYKVSDGADQACGWSDPKGIPQQIP  8384

Query  317   -DGIMRSTGYTHDGPCEVWL  335
              DG M  +GYTHDGPCE+++
Sbjct  8383  EDGTMSPSGYTHDGPCEIYM  8324

 Score = 79.7 bits (195),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -3

Query  337   DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             D   L + NCHE I+ +T+ LDYS C  SC LYWYWLG RYLK  YSWQVYK C+
Sbjct  8321  DKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  8157

 Score = 23.9 bits (50),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 8/13 (62%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -2

Query  234   AHQLVILPAPTYT  246
             AHQ+V +P+PT+T
Sbjct  8616  AHQVVCIPSPTWT  8578

 Score = 62.0 bits (149),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  140   NTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             + LAL+  NCH    +    +DYS CG+SC + W+WLG +Y    YSWQV+K CI L
Sbjct  8321  DKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  8151

 Score = 54.3 bits (129),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -1

Query  59    VAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP  118
             +++LE++G  T      +  + GY +LR  +D    Y V++     CG + P    Q IP
Sbjct  8560  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDK-AKYKVSDGADQACGWSDPKGIPQQIP  8384

Query  119   TNGSFITSGYTLDGPCEIWI  138
              +G+   SGYT DGPCEI++
Sbjct  8383  EDGTMSPSGYTHDGPCEIYM  8324

>PHRA:scaffold_2892
Length=2014

 Score = 80.1 bits (196),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -1

Query  257   LAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
             L+FLE + F T ++F+ +   NG+ SLR F+D  + Y V+  AD  CG++DP   PQ IP
Sbjct  1924  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDK-AKYKVSDGADQACGWSDPKGIPQQIP  1748

Query  317   -DGIMRSTGYTHDGPCEVWL  335
              DG M  +GYTHDGPCE+++
Sbjct  1747  EDGTMSPSGYTHDGPCEIYM  1688

 Score = 79.7 bits (195),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -3

Query  337   DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             D   L + NCHE I+ +T+ LDYS C  SC LYWYWLG RYLK  YSWQVYK C+
Sbjct  1685  DKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  1521

 Score = 21.9 bits (45),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 7/13 (54%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -2

Query  234   AHQLVILPAPTYT  246
              HQ+V +P+PT+T
Sbjct  1980  VHQVVCIPSPTWT  1942

 Score = 62.0 bits (149),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -3

Query  140   NTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             + LAL+  NCH    +    +DYS CG+SC + W+WLG +Y    YSWQV+K CI L
Sbjct  1685  DKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  1515

 Score = 54.3 bits (129),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -1

Query  59    VAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP  118
             +++LE++G  T      +  + GY +LR  +D    Y V++     CG + P    Q IP
Sbjct  1924  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDK-AKYKVSDGADQACGWSDPKGIPQQIP  1748

Query  119   TNGSFITSGYTLDGPCEIWI  138
              +G+   SGYT DGPCEI++
Sbjct  1747  EDGTMSPSGYTHDGPCEIYM  1688

>PYAP:scaffold_182 pag1_scaffold_182 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_182:1:48098:1 
REF
Length=48098

 Score = 85.5 bits (210),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 4/68 (6%)
 Frame = +3

Query  330   PCEVWLDDTRVL--QHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
             PCEVW+D+TRVL  +  NCH+ I     +Y +D+S C G C + WYWLG+R L + +SWQ
Sbjct  1740  PCEVWIDNTRVLGSKLGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQ  1919

Query  386   VYKACVPI  393
             VYKAC+PI
Sbjct  1920  VYKACIPI  1943

 Score = 69.7 bits (169),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +1

Query  270   DFVGYLDANGFDSLRAFMDDDSLYSVNAS-ADFRCGFTDPDAAPQPIP-DGIMRSTGYTH  327
             D   Y ++ G  +LR FMDD + Y V A+ A F CG TDP+   QPIP +G+MRSTG+TH
Sbjct  1555  DLTSYFNSKGIKTLRHFMDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTH  1734

Query  328   DG  329
             DG
Sbjct  1735  DG  1740

 Score = 75.1 bits (183),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = +3

Query  133   PCEIWIDNTLALAGR--NCHTEFPEG--HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
             PCE+WIDNT  L  +  NCH    +G   + ID+S C   C + W+WLG++  G+++SWQ
Sbjct  1740  PCEVWIDNTRVLGSKLGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQ  1919

Query  189   VFKNCINLSASA  200
             V+K CI + AS 
Sbjct  1920  VYKACIPIRASG  1955

 Score = 53.1 bits (126),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 33/59 (56%), Gaps = 1/59 (2%)
 Frame = +1

Query  75    TWLAERGYATLRALMDDDGLYSVTEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDG  132
             ++   +G  TLR  MDD   Y V   G  F+CG T PN   QPIP NG   ++G+T DG
Sbjct  1564  SYFNSKGIKTLRHFMDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG  1740

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 17/123 (14%)
 Frame = +1

Query  269   DDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP--DGIMRSTGYT  326
             +++      +G   LR+++D         +    CG +  D +P+PIP  + +      T
Sbjct  4834  NEWAAAAKQHGVKDLRSYID---------AKITECGDSLKDVSPKPIPKTNTVTFERALT  4986

Query  327   HDGPCEVWLDDTRVLQHDNCHEVISGK-TYDLDYSACNG-SCTLYWYWLGVRYLKQVYSW  384
             H GPCE W+DDTRV Q+++C      K T  LDYS C G +C L +YWLG+    Q   W
Sbjct  4987  HKGPCEFWIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGL----QNSDW  5154

Query  385   QVY  387
             QVY
Sbjct  5155  QVY  5163

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +1

Query  94    LYSVTEEGLFDCGLTFPNTETQPIP-TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTE  152
             L S  +  + +CG +  +   +PIP TN        T  GPCE WID+T      +C   
Sbjct  4876  LRSYIDAKITECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEFWIDDTRVFQNNDCEPY  5055

Query  153   FPEGHHT-IDYSVC-GESCRVSWFWLGIKYQGERYSWQVF  190
             F E     +DYS C G++C + ++WLG+    +   WQV+
Sbjct  5056  FKEKSTVPLDYSPCTGKTCLLRFYWLGL----QNSDWQVY  5163

>PHSO:scaffold_11
Length=2192408

 Score = 122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 71/104 (68%), Gaps = 5/104 (5%)
 Frame = -3

Query  247      VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFT  306
                VE KD ++ PLAFLEGQ F+T + F      NG+ +LR FMD    Y+V   AD+ CG+T
Sbjct  2022897  VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGK-YTVTQGADYFCGWT  2022721

Query  307      DPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVI  350
                +P   PQPIP    RSTGYTHDGPCE+WLDD RVL+  NCHE I
Sbjct  2022720  NPKGTPQPIP----RSTGYTHDGPCEIWLDDVRVLESGNCHETI  2022601

 Score = 78.2 bits (191),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 57/107 (53%), Gaps = 6/107 (6%)
 Frame = -3

Query  48       VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGL  107
                 V+  D + +P+A+LE QG  T         + GY TLR  MD  G Y+VT+   + CG 
Sbjct  2022900  AVEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDR-GKYTVTQGADYFCGW  2022724

Query  108      TFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
                T P    QPIP      ++GYT DGPCEIW+D+   L   NCH   P
Sbjct  2022723  TNPKGTPQPIPR-----STGYTHDGPCEIWLDDVRVLESGNCHETIP  2022598

 Score = 49.3 bits (116),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = -1

Query  159      TIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                TIDYS C +   C + W+WLG+++    YSWQV+K CI L+A+
Sbjct  2022596  TIDYSSCEKKGGCTMHWYWLGVRFLKNSYSWQVYKECIPLTAA  2022468

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 12/86 (14%)
 Frame = -2

Query  295     VNASADFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHE  348
               ++ + D +CG T  DA+PQP+P DG+++       G+TH GPCEV++DD  V+  DNC +
Sbjct  645115  LDMTKDKKCGETLADASPQPVPSDGLVKWLGNGGGGFTHVGPCEVYIDDKMVVHGDNCED  644936

Query  349     VIS----GKTYD--LDYSACNGSCTL  368
                      G T D  +DYS+CNG CTL
Sbjct  644935  EFQGGGVGSTLDNPVDYSSCNGKCTL  644858

 Score = 52.8 bits (125),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = -1

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               D +CG T  + A QPIP DG ++       G+TH GPCE++LDD  VL  DNC +   G
Sbjct  471029  DQKCGNTLDNGAAQPIPSDGKVKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEFKG  470853

 Score = 34.7 bits (78),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 18/34 (53%), Gaps = 4/34 (12%)
 Frame = -2

Query  359     YSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
               YS+CNG CTL  YWL      Q   WQ Y   VP
Sbjct  470821  YSSCNGDCTLTIYWLAF----QNAQWQAYGKFVP  470732

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 60/136 (44%), Gaps = 12/136 (9%)
 Frame = +1

Query  261     EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM  320
                G  FST   F       G+ SLR  +D      V   A+ R   +  D A   +     
Sbjct  989533  RGPEFSTAT-FTSAFPNTGYSSLRDMLDQ----QVADCANTRIDVSPVDVAGLTVVTWEN  989697

Query  321     RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRY  377
                +   +H GPCEVW+DD  V   D+C       T      ++S C G CTL +YWL +  
Sbjct  989698  GNGITSHRGPCEVWVDDIVVNHQDDCVATYGAGTQIKVPANFSKCLGDCTLRFYWLALHE  989877

Query  378     LKQVYSWQVYKACVPI  393
                K    WQ+YK CVPI
Sbjct  989878  PK----WQIYKQCVPI  989913

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 16/92 (17%)
 Frame = -1

Query  304      GFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSAC-  362
                G   P  AP+  P       G+T    C  W   T            + ++  +DYS+C 
Sbjct  2022710  GRRSPFRAPRVTPMTARVRFGWTT---CACWSPAT-----------ATRRSPTIDYSSCE  2022573

Query  363      -NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  G CT++WYWLGVR+LK  YSWQVYK C+P+
Sbjct  2022572  KKGGCTMHWYWLGVRFLKNSYSWQVYKECIPL  2022477

 Score = 44.7 bits (104),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 6/50 (12%)
 Frame = -1

Query  309     DAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
               D  PQ IP DG+ +     S G+TH GPCE+++D+T VL  DNC +   G
Sbjct  500501  DGTPQAIPTDGMAKWLGNGSGGFTHVGPCEIYIDNTMVLHGDNCEDEYPG  500352

 Score = 33.9 bits (76),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (4%)
 Frame = -2

Query  357     LDYSACNGSCTLYWYWLGVRYLK-QVYS  383
               +DYS+CNG CTL  YWL  +  + QVYS
Sbjct  500317  IDYSSCNGDCTLTIYWLAFQNEQ*QVYS  500234

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 8/61 (13%)
 Frame = -1

Query  324     GYTHDGPCEVWLDDTRVLQHDNCHEVISG------KTYDL--DYSACNGSCTLYWYWLGV  375
               G+TH GPCEV++DD  V   DNC +   G      +T D+  DYS+CNG CTL  YWL  
Sbjct  498995  GFTHVGPCEVYIDDKMVAHGDNCEDEFKGGDVGSKETSDIPADYSSCNGKCTLTMYWLAF  498816

Query  376     R  376
               +
Sbjct  498815  Q  498813

 Score = 46.2 bits (108),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 5/47 (11%)
 Frame = -1

Query  115     QPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG  156
               Q IPT+G        + G+T  GPCEI+IDNT+ L G NC  E+P G
Sbjct  500489  QAIPTDGMAKWLGNGSGGFTHVGPCEIYIDNTMVLHGDNCEDEYPGG  500349

 Score = 24.6 bits (52),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 4/37 (11%)
 Frame = -2

Query  160     IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               IDYS C   C ++ +WL   +Q E+   QV+  C   
Sbjct  500317  IDYSSCNGDCTLTIYWLA--FQNEQ--*QVYSKCFGF  500219

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 11/79 (14%)
 Frame = -2

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  +   QP+P++G          G+T  GPCE++ID+ + + G NC  EF  G   
Sbjct  645091  CGETLADASPQPVPSDGLVKWLGNGGGGFTHVGPCEVYIDDKMVVHGDNCEDEFQGGGVG  644912

Query  157     ---HHTIDYSVCGESCRVS  172
                   + +DYS C   C ++
Sbjct  644911  STLDNPVDYSSCNGKCTLT  644855

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 5/57 (9%)
 Frame = -1

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG  156
               CG T  N   QPIP++G          G+T  GPCEI++D+ + L G NC  EF  G
Sbjct  471020  CGNTLDNGAAQPIPSDGKVKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEFKGG  470850

 Score = 43.5 bits (101),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 60/139 (43%), Gaps = 34/139 (24%)
 Frame = +1

Query  81      GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT---------NGSFITSGYTLD  131
               GY++LR ++D         + + DC  T    +  P+           NG+ ITS     
Sbjct  989584  GYSSLRDMLD---------QQVADCANT--RIDVSPVDVAGLTVVTWENGNGITSHR---  989721

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               GPCE+W+D+ +     +C   +  G       ++S C   C + ++WL +        WQ
Sbjct  989722  GPCEVWVDDIVVNHQDDCVATYGAGTQIKVPANFSKCLGDCTLRFYWLAL----HEPKWQ  989889

Query  189     VFKNCI----NLSASALVT  203
               ++K C+    N  A AL T
Sbjct  989890  IYKQCVPIVNNSGARALRT  989946

 Score = 43.5 bits (101),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (51%), Gaps = 10/67 (15%)
 Frame = -1

Query  127     GYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGESCRVSWFWLGI  178
               G+T  GPCE++ID+ +   G NC  EF  G            DYS C   C ++ +WL  
Sbjct  498995  GFTHVGPCEVYIDDKMVAHGDNCEDEFKGGDVGSKETSDIPADYSSCNGKCTLTMYWLA-  498819

Query  179     KYQGERY  185
                +Q E++
Sbjct  498818  -FQNEQW  498801

 Score = 34.3 bits (77),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 33/67 (49%), Gaps = 10/67 (15%)
 Frame = +3

Query  293    YSVNASADFRCGFTDPDAAPQPIPD--------GIMRSTGYTHDGPCEVWLDDTRVLQHD  344
              +S +++  F CG   PD AP P+P          + RS   T +GP    LD    LQ D
Sbjct  45255  FSGSSAGTFACGLCSPDLAP-PLPSVPSPASIAEVQRSASVTGNGPLRDLLDGYARLQ-D  45428

Query  345    NCHEVIS  351
              +CH +++
Sbjct  45429  HCHALMA  45449

>PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 
genomic scaffold, whole genome shotgun sequence
Length=3552875

 Score = 116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 7/127 (6%)
 Frame = -2

Query  234      AHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
                AHQ+V +P+PT+T      K+ R  W PL+FLE + F T ++F  +   NG+ SL  FMD
Sbjct  2748892  AHQVVNVPSPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLLDFMD  2748713

Query  289      DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
                  + Y V+  AD  CG+TDP   PQ IP DG MR+TGYTHDGPCE+++ +   L + NCH
Sbjct  2748712  R-AKYKVSKGADQACGWTDPKGIPQQIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCH  2748536

Query  348      EVISGKT  354
                E I  +T
Sbjct  2748535  ESIPEQT  2748515

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  337      DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                DT  L   NCHE I+ +T+ LDYSAC  +C LYWYWLGVRYLK+ YSWQVYK C+
Sbjct  2704661  DTLALSSLNCHESITDQTFKLDYSACGDTCVLYWYWLGVRYLKKKYSWQVYKECI  2704497

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 47/88 (53%), Gaps = 8/88 (9%)
 Frame = -2

Query  261      EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
                +G N  + D F     AN F  LR  MDD S+Y  +      CGFT+P+  PQPIP DG 
Sbjct  2828029  DGNNAKSVDTFKSLKAANNFKDLRTLMDDTSVYGAD------CGFTNPNDTPQPIPSDGK  2827868

Query  320      MR-STGYTHDGPCEVWLDDTRVLQHDNC  346
                   S    H GPC +WLDD  VL  D+C
Sbjct  2827867  ATFSRALVHHGPCGIWLDDKMVLYEDDC  2827784

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -1

Query  140      NTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                +TLAL+  NCH    +    +DYS CG++C + W+WLG++Y  ++YSWQV+K CI+ + +
Sbjct  2704661  DTLALSSLNCHESITDQTFKLDYSACGDTCVLYWYWLGVRYLKKKYSWQVYKECISCTLA  2704482

Query  200      ALV  202
                 +V
Sbjct  2704481  LVV  2704473

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = -2

Query  57       SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
                +P+++LE++G  T      +  + GY +L   MD    Y V++     CG T P    Q 
Sbjct  2748814  NPLSFLEKEGFKTQENFTQFQVDNGYKSLLDFMDR-AKYKVSKGADQACGWTDPKGIPQQ  2748638

Query  117      IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPE  155
                IP +G+  T+GYT DGPCEI++   LAL+  NCH   PE
Sbjct  2748637  IPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPE  2748521

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  350      ISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                IS +T+ LDYS C  SC +YWYWLGVR LK  YSWQVYK C+P+
Sbjct  2743307  ISTQTFKLDYSGCGDSCIIYWYWLGVRKLKGKYSWQVYKECIPV  2743176

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 5/60 (8%)
 Frame = -1

Query  234      AHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
                AHQ+V +P+PT+T      K+ R  W PL+FLE +  +T ++F  +   NG+ SLR FMD
Sbjct  2722874  AHQVVYVPSPTWTRVNATSKERRVLWNPLSFLEKKEVTTQENFTQFQVDNGYKSLRDFMD  2722695

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 39/77 (51%), Gaps = 7/77 (9%)
 Frame = -2

Query  78       AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
                A   +  LR LMDD  +Y        DCG T PN   QPIP++G +  +      GPC I
Sbjct  2827984  AANNFKDLRTLMDDTSVYGA------DCGFTNPNDTPQPIPSDGKATFSRALVHHGPCGI  2827823

Query  137      WIDNTLALAGRNCHTEF  153
                W+D+ + L   +C  ++
Sbjct  2827822  WLDDKMVLYEDDCFAKY  2827772

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  160      IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                +DYS CG+SC + W+WLG++    +YSWQV+K CI
Sbjct  2743286  LDYSGCGDSCIIYWYWLGVRKLKGKYSWQVYKECI  2743182

>PYIW:scaffold_7003 piw_scaffold_7003 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_7003:1:774:1 
REF
Length=774

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  DFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTH  327
            +F       GF++LR++++D            +CG TDP+A  + IP D +++ S    H
Sbjct  165  NFAKVSKEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIVH  317

Query  328  DGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
             GPCE+W+DDTRV+Q DNC +    K  T+ +D+SAC G C L W+WLG++   +   WQ
Sbjct  318  PGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDSGK--RWQ  491

Query  386  VY  387
            VY
Sbjct  492  VY  497

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 60/115 (52%), Gaps = 14/115 (12%)
 Frame = +3

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-NGSFITSGYTLDGPCEIW  137
            E+G+ TLR+ ++D G           CG T PN + + IP+ N    +      GPCE+W
Sbjct  186  EKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCELW  338

Query  138  IDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
            ID+T  +   NC   F     T  ID+S C   C + WFWLG++  G+R  WQV+
Sbjct  339  IDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDSGKR--WQVY  497

>PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 
genomic scaffold, whole genome shotgun sequence
Length=1472

 Score = 100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 7/109 (6%)
 Frame = -3

Query  233  MAHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFM  287
             AHQ+V +P+PT+T      K+ R  W PL+FLE +  +T ++F  +   NG+ SLR FM
Sbjct  753  QAHQVVYVPSPTWTRVNATSKERRVLWNPLSFLEKKEVTTQENFTQFQVDNGYKSLRDFM  574

Query  288  DDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWL  335
             D   Y V   AD  CG++DP+  PQ IP DG MR++ YTHDGPCE+++
Sbjct  573  -DSPRYKVTEGADQACGWSDPNGIPQQIPEDGTMRTSNYTHDGPCEIYM  430

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -3

Query  57   SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
            +P+++LE++ V T      +  + GY +LR  MD    Y VTE     CG + PN   Q 
Sbjct  672  NPLSFLEKKEVTTQENFTQFQVDNGYKSLRDFMDS-PRYKVTEGADQACGWSDPNGIPQQ  496

Query  117  IPTNGSFITSGYTLDGPCEIWI  138
            IP +G+  TS YT DGPCEI++
Sbjct  495  IPEDGTMRTSNYTHDGPCEIYM  430

>PHRA:scaffold_9
Length=727265

 Score = 102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 17/134 (13%)
 Frame = +1

Query  271     FVGYLDANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTH  327
               +    ++NG+  +R  +D D SLY  +      CGFTDP+A P+  P       S G  H
Sbjct  217975  YTSLKESNGYSDIRTLLDSDTSLYGAD------CGFTDPNATPKDPPSTGDATFSRGMVH  218136

Query  328     DGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLK  379
                GPCE+WLDDT+VL +DNC       T +       +DYS+C +G CTL +YWL  + L 
Sbjct  218137  AGPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLD  218316

Query  380     QVYSWQVYKACVPI  393
                   WQVYK CVP+
Sbjct  218317  SSTVWQVYKNCVPL  218358

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 63/128 (49%), Gaps = 16/128 (13%)
 Frame = +1

Query  80      RGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIW  137
                GY+ +R L+D D  LY        DCG T PN   +  P+ G +  + G    GPCEIW
Sbjct  217996  NGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATFSRGMVHAGPCEIW  218157

Query  138     IDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQV  189
               +D+T  L+  NC   + +G          +DYS C    C + ++WL  +       WQV
Sbjct  218158  LDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSSTVWQV  218337

Query  190     FKNCINLS  197
               +KNC+ L+
Sbjct  218338  YKNCVPLT  218361

>PYIR:scaffold_155 pir_scaffold_155 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_155:1:48358:1 
REF
Length=48358

 Score = 100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 77/132 (58%), Gaps = 16/132 (12%)
 Frame = -2

Query  264   NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-  321
             N+    +F       GF++LR++++D             CG T+P+A+P+ IP D +++ 
Sbjct  2862  NWKDPKNFATVSKQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKF  2710

Query  322   STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLK  379
             S    H GPCE+WLDD RV+Q DNC      K  T+ +D+S+C GSC L W+WLG++   
Sbjct  2709  SRAIVHPGPCEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSG  2530

Query  380   QVYSWQVY-KAC  390
             +   WQVY K+C
Sbjct  2529  K--RWQVYSKSC  2500

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 65/132 (49%), Gaps = 14/132 (11%)
 Frame = -2

Query  79    ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
             ++G+ TLR+ ++D G           CG T PN   + IP++     +      GPCEIW
Sbjct  2823  QKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIW  2671

Query  138   IDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
             +D+   +   NC   F     T  ID+S C  SC + WFWLG++  G+R  WQV+    +
Sbjct  2670  LDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGKR--WQVYSKSCD  2497

Query  196   LSASALVTMIGL  207
              S   ++ +  +
Sbjct  2496  SSPLCIIPIASM  2461

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = +2

Query  329   GPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
             GPCE+WLDD RV+Q DNC      K  T+ +D+S+C GSC L W+WLG++   +   WQV
Sbjct  5909  GPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGE--RWQV  6082

Query  387   Y  387
             Y
Sbjct  6083  Y  6085

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 74/175 (42%), Gaps = 24/175 (14%)
 Frame = -2

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEG---------QNFS--TTDDFVGYLDA----N  278
             AH  + LP P ++   K N   PL  ++G         Q+++  T  +   Y+ A     
Sbjct  7980  AHSQMTLPNPKFSDVSKANS--PLGTVDGPTVLPPPSGQSYAMGTDTNIKAYVQAFKAQT  7807

Query  279   GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDT  338
              + SL+  + D+ +       D  CG TD   A QP+P  +    G  H GPCEVW DDT
Sbjct  7806  KYTSLKQLIMDNYV-EAGTIPDRACGLTDKTYA-QPLPAEVEWQAG-QHPGPCEVWCDDT  7636

Query  339   RVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  D+C     G     D S C G   L+  +L +     V  WQVY  C  I
Sbjct  7635  LAFHDDDCATNYPGIKLPYDRSKCVGKKVLWSMFLAMH----VPQWQVYMGCTAI  7483

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = -1

Query  329  GPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
            GPCE+WLD+ RV Q+DNC  V   K   + +D+S+C G+C L ++WLG++   Q   WQV
Sbjct  535  GPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQV  362

Query  387  Y  387
            Y
Sbjct  361  Y  359

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 8/80 (10%)
 Frame = +2

Query  130   LDGPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSW  187
             L GPCE+W+D+   +   NC   F     T  ID+S C  SC + WFWLG++  GER  W
Sbjct  5903  LQGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGER--W  6076

Query  188   QVFKN----CINLSASALVT  203
             QV+      C++   S L T
Sbjct  6077  QVYSKWIHRCVDCGGSTLPT  6136

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 67/158 (42%), Gaps = 18/158 (11%)
 Frame = -2

Query  45    PFFVVDGMDYRGSPVAYLEQQGVHTAIEA--QTWLAERGYATLRALMDDDGLYSVTEEGL  102
             P   VDG      P       G  T I+A  Q + A+  Y +L+ L+ D+ +    E G 
Sbjct  7920  PLGTVDGPTVLPPPSGQSYAMGTDTNIKAYVQAFKAQTKYTSLKQLIMDNYV----EAGT  7753

Query  103   FD---CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
                  CGLT   T  QP+P    +    +   GPCE+W D+TLA    +C T +P     
Sbjct  7752  IPDRACGLTD-KTYAQPLPAEVEWQAGQHP--GPCEVWCDDTLAFHDDDCATNYPGIKLP  7582

Query  160   IDYSVCGESCRVSW-FWLGIKYQGERYSWQVFKNCINL  196
              D S C    +V W  +L +        WQV+  C  +
Sbjct  7581  YDRSKCVGK-KVLWSMFLAMHVP----QWQVYMGCTAI  7483

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 4/61 (7%)
 Frame = -1

Query  132  GPCEIWIDNTLALAGRNCHTEFPEGH--HTIDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
            GPCE+W+DN       NC   F        ID+S C  +C + +FWLG++ QG+R  WQV
Sbjct  535  GPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQDQGKR--WQV  362

Query  190  F  190
            +
Sbjct  361  Y  359

>PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.5, whole genome shotgun 
sequence
Length=2147012

 Score = 100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 73/134 (54%), Gaps = 17/134 (13%)
 Frame = +2

Query  271      FVGYLDANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTH  327
                +    ++NG+  +RA +D D+ LY  N      CGFTDPDA P+  P       S G  H
Sbjct  1020590  YTSLKESNGYSDIRALLDSDTDLYGAN------CGFTDPDATPKDPPTTGDATFSRGMVH  1020751

Query  328      DGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSACN-GSCTLYWYWLGVRYLK  379
                 GPCE+WLDDT VL +D+C       T D       +DYS+C+ G C L +YWL  + + 
Sbjct  1020752  AGPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVD  1020931

Query  380      QVYSWQVYKACVPI  393
                    WQVYK CVP+
Sbjct  1020932  SKMVWQVYKDCVPL  1020973

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 88/181 (49%), Gaps = 29/181 (16%)
 Frame = +2

Query  233      MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDD-----FVGYLDANGFDS  282
                 AH  +  PAP++  + + N W  +  +E Q     + S  D+     F      N +  
Sbjct  1014488  QAHGYIAKPAPSWK-DKETNDW--VVEIEPQWKGGWDESKGDEGLLATFKELAPKNNYKD  1014658

Query  283      LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
                +R+ MD + +Y  +      CGFTDP   P +P  DG    S G  H GPCE+WLDD  V
Sbjct  1014659  VRSLMDGNPVYGED------CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDKMV  1014820

Query  341      LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
                LQ+D+C       T         +DYS+C +G C L +YWL ++ L     WQ YK C+P
Sbjct  1014821  LQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIP  1015000

Query  393      I  393
                +
Sbjct  1015001  L  1015003

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 69/128 (54%), Gaps = 17/128 (13%)
 Frame = +3

Query  277      ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
                +NG+  +R  +D D+ LY  +      CG+T+PDA  +  P       S G  H GPCE+
Sbjct  1068762  SNGYSDIRTLLDSDTDLYGAD------CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  1068923

Query  334      WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
                WLDDT VL +DNC       T D       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  1068924  WLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  1069103

Query  386      VYKACVPI  393
                VYK CVP+
Sbjct  1069104  VYKDCVPL  1069127

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (54%), Gaps = 17/128 (13%)
 Frame = +1

Query  277      ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
                +N    +R  +D D SLY  +      CG+T+PD  P+ P  DG    S G  H GPCE+
Sbjct  1016176  SNNAKDIRTLLDSDTSLYGAD------CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  1016337

Query  334      WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
                WLDD  VLQ+D+C       T +       +DYS+C +G C   +YWL ++ L     WQ
Sbjct  1016338  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  1016517

Query  386      VYKACVPI  393
                VYK C+P+
Sbjct  1016518  VYKNCIPL  1016541

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 17/128 (13%)
 Frame = +3

Query  277      ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTHDGPCEV  333
                +N    +R  +D D+ LY  +      CG TDP A P+  P       S G  H GPCE+
Sbjct  1018416  SNNVKDIRTMIDGDAKLYGED------CGNTDPKATPKDPPSTGDATFSRGIVHAGPCEI  1018577

Query  334      WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
                WLDD  VLQ+D+C       T         +DYS+C +G C   +YWL ++       WQ
Sbjct  1018578  WLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLWQ  1018757

Query  386      VYKACVPI  393
                VYK C+P+
Sbjct  1018758  VYKNCIPL  1018781

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 70/136 (51%), Gaps = 16/136 (12%)
 Frame = +3

Query  75       TWLAERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDG  132
                T  +  GY+ +R L+D D  LY        DCG T P+   +  PT G +  + G    G
Sbjct  1068750  TLKSSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVG  1068911

Query  133      PCEIWIDNTLALAGRNCHTEFPEG-------HHTIDYSVCGES-CRVSWFWLGIKYQGER  184
                PCEIW+D+T+ L+  NC T + +G          +DYS C  S C + ++WL  +    +
Sbjct  1068912  PCEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSK  1069091

Query  185      YSWQVFKNCINLSASA  200
                  WQV+K+C+ L+  A
Sbjct  1069092  MVWQVYKDCVPLTGPA  1069139

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 68/132 (52%), Gaps = 16/132 (12%)
 Frame = +2

Query  79       ERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
                  GY+ +RAL+D D  LY        +CG T P+   +  PT G +  + G    GPCEI
Sbjct  1020608  SNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATFSRGMVHAGPCEI  1020769

Query  137      WIDNTLALAGRNCHTEFPEGHH-------TIDYSVCGE-SCRVSWFWLGIKYQGERYSWQ  188
                W+D+T+ L+  +C T + +G          +DYS C    C + ++WL  +    +  WQ
Sbjct  1020770  WLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSKMVWQ  1020949

Query  189      VFKNCINLSASA  200
                V+K+C+ L+  A
Sbjct  1020950  VYKDCVPLTGPA  1020985

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 16/133 (12%)
 Frame = +1

Query  78       AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCE  135
                A      +R L+D D  LY        DCG T P+   +  PT+G+   S G    GPCE
Sbjct  1016173  ASNNAKDIRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCE  1016334

Query  136      IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
                IW+D+ + L   +C + + +G          +DYS C    C   ++WL ++    +  W
Sbjct  1016335  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  1016514

Query  188      QVFKNCINLSASA  200
                QV+KNCI LS  A
Sbjct  1016515  QVYKNCIPLSGPA  1016553

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 15/128 (12%)
 Frame = +2

Query  82       YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDN  140
                Y  +R+LMD + +Y        DCG T P       P++G+   S G    GPCEIW+D+
Sbjct  1014650  YKDVRSLMDGNPVYGE------DCGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDD  1014811

Query  141      TLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKN  192
                 + L   +C + + +G          +DYS C    C + ++WL ++    +  WQ +KN
Sbjct  1014812  KMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKN  1014991

Query  193      CINLSASA  200
                CI L+  A
Sbjct  1014992  CIPLTGPA  1015015

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 64/138 (46%), Gaps = 19/138 (14%)
 Frame = -3

Query  262      GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM  320
                G  +   DD   +   N   SL+ F+   + Y  + S    CG T+     QP+P DG  
Sbjct  1529259  GDYYQAVDD---WFTKNNVASLKEFI---TTYGTDIS---ECGNTEKKGTAQPVPSDGYA  1529107

Query  321      R--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGV  375
                +  + G +H GPCE+W DDTRV    NC    SG++     +D S C  S    +YWL +
Sbjct  1529106  QHDTLGNSHPGPCEIWCDDTRVFHDTNCVVTFSGQSPAKIPIDVSTCKSSSEFVFYWLAL  1528927

Query  376      RYLKQVYSWQVYKACVPI  393
                        WQVY  CV +
Sbjct  1528926  H----AQPWQVYINCVAL  1528885

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 16/123 (13%)
 Frame = +3

Query  85       LRALMDDDG-LYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTL  142
                +R ++D D  LY        DCG T P    +  P+ G +  + G    GPCEIW+D+ +
Sbjct  1018434  IRTMIDGDAKLYGE------DCGNTDPKATPKDPPSTGDATFSRGIVHAGPCEIWLDDEM  1018595

Query  143      ALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCI  194
                 L   +C + + +G          +DYS C    C   ++WL ++ +  +  WQV+KNCI
Sbjct  1018596  VLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLWQVYKNCI  1018775

Query  195      NLS  197
                 LS
Sbjct  1018776  PLS  1018784

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 61/124 (49%), Gaps = 16/124 (13%)
 Frame = -2

Query  274      YLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR--STGYTHDGP  330
                +  AN  DS++ F++    Y  +      CG T  +  P+ +P DG ++  S G +H GP
Sbjct  1507480  WFTANNVDSVKDFVE---TYIPDLP---ECGNTKKNGTPRQLPSDGYVKHDSLGNSHPGP  1507319

Query  331      CEVWLDDTRVLQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                CEVW DDTRV    NC    +G+      +D   C  S  L +YWL +     V  WQVY
Sbjct  1507318  CEVWCDDTRVFHDTNCAGKFAGQVPTKIPIDLKTCKSSSELVFYWLAL----HVQPWQVY  1507151

Query  388      KACV  391
                  CV
Sbjct  1507150  INCV  1507139

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 54/126 (43%), Gaps = 15/126 (12%)
 Frame = -3

Query  76       WLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYTLDGP  133
                W  +   A+L+  +   G        + +CG T      QP+P++G     T G +  GP
Sbjct  1529232  WFTKNNVASLKEFITTYGT------DISECGNTEKKGTAQPVPSDGYAQHDTLGNSHPGP  1529071

Query  134      CEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                CEIW D+T      NC   F         ID S C  S    ++WL +  Q     WQV+
Sbjct  1529070  CEIWCDDTRVFHDTNCVVTFSGQSPAKIPIDVSTCKSSSEFVFYWLALHAQ----PWQVY  1528903

Query  191      KNCINL  196
                 NC+ L
Sbjct  1528902  INCVAL  1528885

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 49/104 (47%), Gaps = 9/104 (9%)
 Frame = -2

Query  102      LFDCGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
                L +CG T  N   + +P++G     + G +  GPCE+W D+T      NC  +F     T
Sbjct  1507420  LPECGNTKKNGTPRQLPSDGYVKHDSLGNSHPGPCEVWCDDTRVFHDTNCAGKFAGQVPT  1507241

Query  160      ---IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                   ID   C  S  + ++WL +  Q     WQV+ NC+ L  + 
Sbjct  1507240  KIPIDLKTCKSSSELVFYWLALHVQ----PWQVYINCVTLDGAG  1507121

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (54%), Gaps = 14/69 (20%)
 Frame = -1

Query  329      GPCEVWLDDTRVLQHDNCHEVISGKTY--------DLDYSACNGS-CTLYWYWLGVR---  376
                GPCE+WLDD  VL  D+C +      Y         +DYS+C+ S C   +YW+  +   
Sbjct  1010297  GPCEIWLDDKMVLHDDDCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQGSD  1010118

Query  377      --YLKQVYS  383
                  Y++Q+YS
Sbjct  1010117  NGYVRQIYS  1010091

 Score = 40.8 bits (94),  Expect = 0.085, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (46%), Gaps = 9/70 (13%)
 Frame = -1

Query  130      LDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGES-CRVSWFWLGIKY  180
                L GPCEIW+D+ + L   +C   F    +         IDYS C  S C   ++W+  + 
Sbjct  1010303  LQGPCEIWLDDKMVLHDDDCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQG  1010124

Query  181      QGERYSWQVF  190
                    Y  Q++
Sbjct  1010123  SDNGYVRQIY  1010094

 Score = 27.7 bits (60),  Expect(2) = 7.5, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +2

Query  330      PCEVWLDDTRVLQHDN  345
                PCE+W+DDT V  +D+
Sbjct  1002734  PCEIWIDDTMVFHNDD  1002781

 Score = 24.3 bits (51),  Expect(2) = 7.5, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 15/31 (48%), Gaps = 2/31 (6%)
 Frame = +3

Query  283      LRAFMDDDSLYSVNASADFRCGFTDPDAAPQ  313
                L   +D  S+  V    D  CGF  PDA P+
Sbjct  1002537  LTCVVDTKSISIVTVKTD--CGFPSPDAKPK  1002623

>PYAP:scaffold_216 pag1_scaffold_216 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_216:1:44217:1 
REF
Length=44217

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 75/132 (57%), Gaps = 14/132 (11%)
 Frame = +2

Query  265    FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
              F T   +       GF  LR+F++D             CG + P+A+P+PIP DG ++ +
Sbjct  25622  FKTGAQYAAVAPGKGFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLA  25774

Query  323    TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
              +   H GPCEVWLD+TR   +D+C +   S  ++ +D+ AC GSC L +YWLG++   + 
Sbjct  25775  STIEHAGPCEVWLDNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQDGGK-  25951

Query  382    YSWQVYKACVPI  393
                WQ YK C+P+
Sbjct  25952  -RWQSYKNCIPL  25984

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 73/132 (55%), Gaps = 14/132 (11%)
 Frame = -3

Query  265   FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
             F T   +       G   LR+F++D             CG T+P+A  +PIP DG+++  
Sbjct  2101  FKTGAQYAAEAKKRGIKDLRSFLEDKGPL---------CGNTNPNAKAKPIPKDGLIKFK  1949

Query  323   TGYTHDGPCEVWLDDTRVLQHDNCHEVIS-GKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
             +   H GPCE W+D+TRV Q+D+C +++   K   ++ SAC G C L +YWLG++   + 
Sbjct  1948  STLEHAGPCEFWVDNTRVFQNDDCEKLLGPAKQVKVNLSACKGKCMLRFYWLGLQDGGK-  1772

Query  382   YSWQVYKACVPI  393
               WQ YK CVP+
Sbjct  1771  -RWQSYKNCVPM  1739

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 70/132 (53%), Gaps = 14/132 (11%)
 Frame = +3

Query  265    FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
              F T   +       G  +LRAF++         S    CG T+P+A  +PIP DG+++  
Sbjct  34377  FRTGAQYDAERKKRGIKNLRAFLE---------SKGPECGRTNPNAKRKPIPSDGLIKFG  34529

Query  323    TGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT-YDLDYSACNGSCTLYWYWLGVRYLKQV  381
              +   H GPCEVW D+T V    +C +     T + +DYS C G+C L +YWLG++   + 
Sbjct  34530  SSMEHPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQDGGK-  34706

Query  382    YSWQVYKACVPI  393
                WQ YK CVPI
Sbjct  34707  -RWQSYKNCVPI  34739

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 72/133 (54%), Gaps = 14/133 (11%)
 Frame = -1

Query  264   NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-  321
              + T   +       G   LR+F++         S    CG T+P+A  + IP DG+++ 
Sbjct  3696  KYKTGAQYAAEAKKRGIKDLRSFLE---------SKGPVCGNTNPNARAKAIPGDGMVKF  3544

Query  322   STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT-YDLDYSACNGSCTLYWYWLGVRYLKQ  380
              +   H GPCE+WLD+TRV Q+D+C + +   T   +++SAC G C + +YWLG++    
Sbjct  3543  QSTLEHPGPCEIWLDNTRVYQNDDCEKSLGQSTSVKVNFSACKGKCMMRFYWLGLQ--DS  3370

Query  381   VYSWQVYKACVPI  393
                WQ YK C+P+
Sbjct  3369  GTRWQSYKNCIPL  3331

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 71/130 (55%), Gaps = 15/130 (12%)
 Frame = +3

Query  79     ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD--GPCEI  136
              +RG   LRA ++  G          +CG T PN + +PIP++G  I  G +++  GPCE+
Sbjct  34413  KRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDG-LIKFGSSMEHPGPCEV  34562

Query  137    WIDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
              W DNTL  +  +C   F       IDYS C  +C + ++WLG++  G+R  WQ +KNC+ 
Sbjct  34563  WFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQDGGKR--WQSYKNCVP  34736

Query  196    LSASALVTMI  205
              + ++     I
Sbjct  34737  IGSATKSRSI  34766

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 72/132 (55%), Gaps = 14/132 (11%)
 Frame = -3

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
            F T   +       G   LR+F++         S    CG +  +A  + IP DG ++ +
Sbjct  763  FKTGAQYAAEAKKRGIKDLRSFLE---------SKGPVCGNSLINAKAKAIPGDGTIKFA  611

Query  323  TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            +   H GPCE+WLD+TRV Q+D+C +   S  +  +++SAC G CTL +YWLG++   + 
Sbjct  610  STLEHPGPCEIWLDNTRVFQNDDCEKKFGSATSTKINFSACKGKCTLRFYWLGLQDGGK-  434

Query  382  YSWQVYKACVPI  393
              WQ YK C+P+
Sbjct  433  -RWQSYKNCIPL  401

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 13/119 (11%)
 Frame = +2

Query  80     RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIWI  138
              +G+  LR+ ++D G           CG + PN   +PIP++G+  + S     GPCE+W+
Sbjct  25661  KGFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWL  25813

Query  139    DNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              DNT A    +C   F       +D+  C  SC + ++WLG++  G+R  WQ +KNCI L
Sbjct  25814  DNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQDGGKR--WQSYKNCIPL  25984

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 70/140 (50%), Gaps = 19/140 (14%)
 Frame = -3

Query  64    QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF  123
             + G   A EA+    +RG   LR+ ++D G           CG T PN + +PIP +G  
Sbjct  2098  KTGAQYAAEAK----KRGIKDLRSFLEDKGPL---------CGNTNPNAKAKPIPKDG-L  1961

Query  124   ITSGYTLD--GPCEIWIDNTLALAGRNCHTEF-PEGHHTIDYSVCGESCRVSWFWLGIKY  180
             I    TL+  GPCE W+DNT      +C     P     ++ S C   C + ++WLG++ 
Sbjct  1960  IKFKSTLEHAGPCEFWVDNTRVFQNDDCEKLLGPAKQVKVNLSACKGKCMLRFYWLGLQD  1781

Query  181   QGERYSWQVFKNCINLSASA  200
              G+R  WQ +KNC+ + +S 
Sbjct  1780  GGKR--WQSYKNCVPMGSSG  1727

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 74/147 (50%), Gaps = 19/147 (13%)
 Frame = -3

Query  56   GSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQ  115
            G P +   + G   A EA+    +RG   LR+ ++  G           CG +  N + +
Sbjct  784  GPPWSGTFKTGAQYAAEAK----KRGIKDLRSFLESKGPV---------CGNSLINAKAK  644

Query  116  PIPTNGSFITSGYTLD--GPCEIWIDNTLALAGRNCHTEFPEGHHT-IDYSVCGESCRVS  172
             IP +G+ I    TL+  GPCEIW+DNT      +C  +F     T I++S C   C + 
Sbjct  643  AIPGDGT-IKFASTLEHPGPCEIWLDNTRVFQNDDCEKKFGSATSTKINFSACKGKCTLR  467

Query  173  WFWLGIKYQGERYSWQVFKNCINLSAS  199
            ++WLG++  G+R  WQ +KNCI L  S
Sbjct  466  FYWLGLQDGGKR--WQSYKNCIPLGGS  392

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 64/128 (50%), Gaps = 15/128 (12%)
 Frame = +1

Query  264    NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPD--GIMR  321
               F T   +       GF  LR+F++D             CG T+P+A P+ +P    ++ 
Sbjct  38173  TFKTGAQYAVVAKDKGFKDLRSFLEDKGP---------ACGKTNPNAKPRNVPSDSKVVF  38325

Query  322    STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLK  379
              S    H GPCE+W+DDT V  +D+C      K   + +D+S+C G C L +YWLG++   
Sbjct  38326  SRPMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQDSG  38505

Query  380    QVYSWQVY  387
              +   WQ Y
Sbjct  38506  K--RWQSY  38523

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 67/139 (48%), Gaps = 19/139 (14%)
 Frame = -1

Query  64    QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF  123
             + G   A EA+    +RG   LR+ ++  G           CG T PN   + IP +G  
Sbjct  3690  KTGAQYAAEAK----KRGIKDLRSFLESKGPV---------CGNTNPNARAKAIPGDG-M  3553

Query  124   ITSGYTLD--GPCEIWIDNTLALAGRNCHTEFPEGHHT-IDYSVCGESCRVSWFWLGIKY  180
             +    TL+  GPCEIW+DNT      +C     +     +++S C   C + ++WLG++ 
Sbjct  3552  VKFQSTLEHPGPCEIWLDNTRVYQNDDCEKSLGQSTSVKVNFSACKGKCMMRFYWLGLQD  3373

Query  181   QGERYSWQVFKNCINLSAS  199
              G R  WQ +KNCI L  S
Sbjct  3372  SGTR--WQSYKNCIPLGGS  3322

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 18/138 (13%)
 Frame = +1

Query  64     QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF  123
              + G   A+ A+    ++G+  LR+ ++D G           CG T PN + + +P++   
Sbjct  38179  KTGAQYAVVAK----DKGFKDLRSFLEDKGPA---------CGKTNPNAKPRNVPSDSKV  38319

Query  124    ITSGYTLD-GPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKY  180
              + S   +  GPCE+WID+T+     +C  EF +      +D+S C   C + ++WLG++ 
Sbjct  38320  VFSRPMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQD  38499

Query  181    QGERYSWQVFKNCINLSA  198
               G+R  WQ +   I  S+
Sbjct  38500  SGKR--WQSYSTYIAESS  38547

 Score = 39.3 bits (90),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 4/56 (7%)
 Frame = +2

Query  340    VLQHDNCHEVISGKT--YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              V  +D+C       T  + +++SAC   C L +YWLG++   Q    Q YK C+P+
Sbjct  23084  VYHNDDCKVAFGSSTPGFKVNFSACKNKCMLRFYWLGLQDKGQ--RMQSYKNCIPL  23245

 Score = 37.0 bits (84),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +2

Query  160    IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
              +++S C   C + ++WLG++ +G+R   Q +KNCI L++
Sbjct  23141  VNFSACKNKCMLRFYWLGLQDKGQR--MQSYKNCIPLAS  23251

>PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 
genomic scaffold, whole genome shotgun sequence
Length=4722445

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 86/181 (48%), Gaps = 29/181 (16%)
 Frame = -3

Query  233      MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDD-----FVGYLDANGFDS  282
                 AH  +  PAP++    K N W  +  +E Q     + S  D+     F      N F  
Sbjct  3774503  QAHGYIAKPAPSWKAS-KTNNW--VVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFKD  3774333

Query  283      LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
                +R+ MD + ++         CGFTDP   P +P  DG    S G  H GPCE+WLDD  V
Sbjct  3774332  VRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKMV  3774171

Query  341      LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
                LQ+D+C       T         +DYS+C  G C L +YWL ++ LK    WQ YK C+P
Sbjct  3774170  LQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIP  3773991

Query  393      I  393
                +
Sbjct  3773990  L  3773988

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 17/128 (13%)
 Frame = -3

Query  277      ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
                +N    +R  +D D SLY  +      CG+T+PD +P+ P  DG    S G  H GPCE+
Sbjct  3772796  SNNAKDIRTLLDSDTSLYGAD------CGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEI  3772635

Query  334      WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
                WLDD  VLQ+D+C       T +       +DYS+C +G C L +YWL ++ L     WQ
Sbjct  3772634  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQ  3772455

Query  386      VYKACVPI  393
                VYK C+P+
Sbjct  3772454  VYKNCIPL  3772431

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 65/128 (51%), Gaps = 17/128 (13%)
 Frame = -3

Query  277      ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
                +N    +R  +D D+ LY  +      CG TDP A P+  P       S G  H GPCE+
Sbjct  3770609  SNNIKDIRTMIDGDAKLYGED------CGNTDPKATPKDPPTTGDATFSRGIVHAGPCEI  3770448

Query  334      WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
                WLDD  VLQ+D+C       T         +DYS+C +G C   +YWL ++   Q   WQ
Sbjct  3770447  WLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLWQ  3770268

Query  386      VYKACVPI  393
                VYK C+P+
Sbjct  3770267  VYKNCIPL  3770244

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 65/133 (49%), Gaps = 16/133 (12%)
 Frame = -3

Query  78       AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCE  135
                A      +R L+D D  LY        DCG T P+   +  PT+G+   S G    GPCE
Sbjct  3772799  ASNNAKDIRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCE  3772638

Query  136      IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
                IW+D+ + L   +C + + +G          +DYS C    C + ++WL ++    +  W
Sbjct  3772637  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYW  3772458

Query  188      QVFKNCINLSASA  200
                QV+KNCI LS  A
Sbjct  3772457  QVYKNCIPLSGPA  3772419

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 49/96 (51%), Gaps = 10/96 (10%)
 Frame = -2

Query  302      RCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT---Y  355
                 CG T  +  PQP+P DG ++  S G +H GPCEVW DD RV    NC    +G+     
Sbjct  2171406  ECGNTKKNGTPQPLPSDGYVKHDSLGNSHPGPCEVWCDDIRVFHDMNCAGKFAGEVPTKV  2171227

Query  356      DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                 +D   C  S  L +YWL +     V  WQVY  CV
Sbjct  2171226  PIDMKTCKSSSELVFYWLAL----HVQPWQVYINCV  2171131

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 64/128 (50%), Gaps = 15/128 (12%)
 Frame = -3

Query  82       YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDN  140
                +  +R+LMD + ++        +CG T P  +    P++G+   S G    GPCEIW+D+
Sbjct  3774341  FKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDD  3774180

Query  141      TLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKN  192
                 + L   +C + + +G          +DYS C    C + ++WL ++    +  WQ +KN
Sbjct  3774179  KMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKN  3774000

Query  193      CINLSASA  200
                CI L+  A
Sbjct  3773999  CIPLTGPA  3773976

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 16/122 (13%)
 Frame = -3

Query  85       LRALMDDDG-LYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTL  142
                +R ++D D  LY        DCG T P    +  PT G +  + G    GPCEIW+D+ +
Sbjct  3770591  IRTMIDGDAKLYGE------DCGNTDPKATPKDPPTTGDATFSRGIVHAGPCEIWLDDEM  3770430

Query  143      ALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCI  194
                 L   +C + + +G          +DYS C    C   ++WL ++ + ++  WQV+KNCI
Sbjct  3770429  VLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLWQVYKNCI  3770250

Query  195      NL  196
                 L
Sbjct  3770249  PL  3770244

 Score = 34.7 bits (78),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 1/38 (3%)
 Frame = -1

Query  357      LDYSACNGS-CTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                +DYS C+ S C L +YWL  + +     WQVYK CV +
Sbjct  3570697  VDYSLCSTSGCMLRFYWLAFQGVDSDMVWQVYKDCVSL  3570584

 Score = 33.1 bits (74),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 9/34 (26%)
 Frame = -3

Query  313      QPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNC  346
                +P P GI+         P E+WLDDT VL HD+C
Sbjct  3570815  RPSPVGIV---------PFEIWLDDTMVLSHDDC  3570741

 Score = 29.6 bits (65),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 23/41 (56%), Gaps = 7/41 (17%)
 Frame = -2

Query  277      ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQPIP  316
                +NG+  +R  +D D+ LY  +      CG+TDPDA  +  P
Sbjct  3570933  SNGYSDIRTLLDSDTDLYGAD------CGYTDPDATAKDPP  3570829

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 47/98 (48%), Gaps = 9/98 (9%)
 Frame = -2

Query  104      DCGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--  159
                +CG T  N   QP+P++G     + G +  GPCE+W D+       NC  +F     T  
Sbjct  2171406  ECGNTKKNGTPQPLPSDGYVKHDSLGNSHPGPCEVWCDDIRVFHDMNCAGKFAGEVPTKV  2171227

Query  160      -IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                 ID   C  S  + ++WL +  Q     WQV+ NC+ L
Sbjct  2171226  PIDMKTCKSSSELVFYWLALHVQ----PWQVYINCVTL  2171125

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +2

Query  302      RCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
                 CG T  +  PQP+P DG ++  S G +H GPCEVW DDTRV    NC    +G+ 
Sbjct  2170709  ECGNTKKNGTPQPLPSDGYVKHDSLGNSHPGPCEVWCDDTRVFHDINCAGKFAGEV  2170876

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = -1

Query  233      MAHQLVILPAPTYT--VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANG  279
                +AHQL+  P P +   +  +D RW+PLAFLE Q F   +DF G+   NG
Sbjct  2838214  VAHQLIQQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNG  2838068

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 14/69 (20%)
 Frame = +1

Query  329      GPCEVWLDDTRVLQHDNCHEVISGKTY--------DLDYSACNGS-CTLYWYWLGVR---  376
                GPCE+WLDD  VL  D+C ++     +         +DYS+C+ S C   +YW+  +   
Sbjct  3795985  GPCEIWLDDKMVLHDDDCEKIFGTADHMTQKSILKPIDYSSCSASGCVYRFYWIAFQGSN  3796164

Query  377      --YLKQVYS  383
                  Y++Q+YS
Sbjct  3796165  NGYVRQIYS  3796191

 Score = 45.4 bits (106),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 9/92 (10%)
 Frame = +1

Query  108      TFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------  159
                 F +     +P     + S   + GPCEIW+D+ + L   +C   F    H         
Sbjct  3795913  NFFHVRINLLPE*QKVLNSRILMQGPCEIWLDDKMVLHDDDCEKIFGTADHMTQKSILKP  3796092

Query  160      IDYSVCGES-CRVSWFWLGIKYQGERYSWQVF  190
                IDYS C  S C   ++W+  +     Y  Q++
Sbjct  3796093  IDYSSCSASGCVYRFYWIAFQGSNNGYVRQIY  3796188

 Score = 35.0 bits (79),  Expect(2) = 0.067, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = -1

Query  160      IDYSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                +DYS+C  S C + ++WL  +       WQV+K+C++L+ 
Sbjct  3570697  VDYSLCSTSGCMLRFYWLAFQGVDSDMVWQVYKDCVSLTG  3570578

 Score = 24.3 bits (51),  Expect(2) = 0.067, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (58%), Gaps = 0/26 (0%)
 Frame = -3

Query  133      PCEIWIDNTLALAGRNCHTEFPEGHH  158
                P EIW+D+T+ L+  +C      GH 
Sbjct  3570791  PFEIWLDDTMVLSHDDCIRGRRPGHQ  3570714

 Score = 39.3 bits (90),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 28/52 (54%), Gaps = 2/52 (4%)
 Frame = +2

Query  104      DCGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLALAGRNCHTEF  153
                +CG T  N   QP+P++G     + G +  GPCE+W D+T      NC  +F
Sbjct  2170709  ECGNTKKNGTPQPLPSDGYVKHDSLGNSHPGPCEVWCDDTRVFHDINCAGKF  2170864

>PHCA:scaffold_93 PHYCAscaffold_93
Length=150113

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 71/127 (56%), Gaps = 16/127 (13%)
 Frame = -3

Query  277     ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVW  334
               +N +  +R+ MD +S+Y  +      CGFTDP+  P  P  DG    S G  H GPCE+W
Sbjct  144744  SNNYKDVRSMMDGNSVYGED------CGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIW  144583

Query  335     LDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQV  386
               LDD  VLQ+D+C       T D       +DYS+C +G C L +YWLG++ L     WQ 
Sbjct  144582  LDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQA  144403

Query  387     YKACVPI  393
               YK C+P+
Sbjct  144402  YKNCIPL  144382

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 65/129 (50%), Gaps = 15/129 (12%)
 Frame = -3

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
               A   Y  +R++MD + +Y        DCG T PN      PT+G+   S G    GPCEI
Sbjct  144747  ASNNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEI  144586

Query  137     WIDNTLALAGRNCHTEFPEGHH-------TIDYSVCGES-CRVSWFWLGIKYQGERYSWQ  188
               W+D+ + L   +C + + +G          +DYS C    C + ++WLG++    +  WQ
Sbjct  144585  WLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQ  144406

Query  189     VFKNCINLS  197
                +KNCI L+
Sbjct  144405  AYKNCIPLT  144379

>PHRA:scaffold_4
Length=963095

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 70/128 (55%), Gaps = 17/128 (13%)
 Frame = +3

Query  277     ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
               +NG+  +R  +D D SLY  +      CGFT+PDA  +  P       S G  H GPCE+
Sbjct  333138  SNGYSDIRTLLDSDTSLYGAD------CGFTNPDATAKDPPTTGDATFSRGMVHVGPCEI  333299

Query  334     WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
               WLDDT+VL +DNC       T D       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  333300  WLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSSMVWQ  333479

Query  386     VYKACVPI  393
               VYK CVP+
Sbjct  333480  VYKNCVPL  333503

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 71/134 (53%), Gaps = 17/134 (13%)
 Frame = +3

Query  271     FVGYLDANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTH  327
               + G   +NG+  +R  +D D SLY  +      CG+T+PDA  +  P       S G  H
Sbjct  331365  YTGLKSSNGYSDIRTLLDSDTSLYGAD------CGYTNPDATAKDPPTTGDATFSRGMVH  331526

Query  328     DGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLK  379
                GPCE+WLDDT VL +D+C       T D       +DYS+C+ S C L +YWL  + + 
Sbjct  331527  VGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVD  331706

Query  380     QVYSWQVYKACVPI  393
                   WQVYK CVP+
Sbjct  331707  SEIVWQVYKDCVPL  331748

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 82/180 (46%), Gaps = 28/180 (16%)
 Frame = +3

Query  233     MAHQLVILPAPTYTVEGKDNRW----KPLAFLEGQNFSTTDD-----FVGYLDANGFDSL  283
                AH  +  PAPT+  E + N W     PL +  G + S  DD     F      N +  L
Sbjct  235011  QAHGYIANPAPTWKKE-ETNDWVVEIAPL-WKGGWDESKGDDGILAVFKELSATNNYKDL  235184

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEVWLDDTRVL  341
               +  MD              CGFTDP+  P  P  DG    S G  H GPCE+WLDD  VL
Sbjct  235185  KTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKMVL  235343

Query  342     QHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               Q+D+C       T +       +DYS C  G C L +YWL ++ L     WQ YK C+P+
Sbjct  235344  QNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPL  235523

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (54%), Gaps = 17/128 (13%)
 Frame = +2

Query  277     ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
               +NG+  +R  +D D+ LY  N      CGFT+PDA  +  P       S G  H GPCE+
Sbjct  239789  SNGYSDIRTLLDSDTTLYGAN------CGFTNPDATAKDPPTTGDATFSRGMVHAGPCEI  239950

Query  334     WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
               WLDDT VL +D+C       + +       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  239951  WLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSKTVWQ  240130

Query  386     VYKACVPI  393
               VYK CVP+
Sbjct  240131  VYKDCVPL  240154

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (54%), Gaps = 17/128 (13%)
 Frame = +2

Query  277     ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTHDGPCEV  333
               +N    +R  +D D+ LY  N      CG+T+PDA+P+  P       S G  H GPCE+
Sbjct  236627  SNNAKDIRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEI  236788

Query  334     WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
               WLDD  VLQ+D+C       T +       +DYS+C +G C   +YWL ++ L     WQ
Sbjct  236789  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQ  236968

Query  386     VYKACVPI  393
               VYK C+P+
Sbjct  236969  VYKNCIPL  236992

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 17/128 (13%)
 Frame = +2

Query  277     ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTHDGPCEV  333
               +N    +R  +D D+ LY  +      CGFTDP A P+  P       S G  H GPCEV
Sbjct  238244  SNNIKDIRTMIDSDTKLYGAD------CGFTDPKATPKDPPSTGDATFSRGMVHAGPCEV  238405

Query  334     WLDDTRVLQHDNCHEVISGKT-------YDLDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
               WLDD  VLQ+D+C       T         +DYS+C  G C   ++WL ++       WQ
Sbjct  238406  WLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQ  238585

Query  386     VYKACVPI  393
               VYK CVP+
Sbjct  238586  VYKNCVPL  238609

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (52%), Gaps = 16/132 (12%)
 Frame = +2

Query  79      ERGYATLRALMDDDG-LYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
                 GY+ +R L+D D  LY        +CG T P+   +  PT G +  + G    GPCEI
Sbjct  239789  SNGYSDIRTLLDSDTTLYGA------NCGFTNPDATAKDPPTTGDATFSRGMVHAGPCEI  239950

Query  137     WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQ  188
               W+D+TL L+  +C T + +G          +DYS C  S C + ++WL  +    +  WQ
Sbjct  239951  WLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSKTVWQ  240130

Query  189     VFKNCINLSASA  200
               V+K+C+ L+  A
Sbjct  240131  VYKDCVPLTGPA  240166

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 66/133 (50%), Gaps = 16/133 (12%)
 Frame = +3

Query  78      AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
               +  GY+ +R L+D D  LY        DCG T P+   +  PT G +  + G    GPCE
Sbjct  333135  SSNGYSDIRTLLDSDTSLYGA------DCGFTNPDATAKDPPTTGDATFSRGMVHVGPCE  333296

Query  136     IWIDNTLALAGRNCHTEFPEGHH-------TIDYSVCGES-CRVSWFWLGIKYQGERYSW  187
               IW+D+T  L+  NC   + +G          +DYS C  S C + ++WL  +       W
Sbjct  333297  IWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSSMVW  333476

Query  188     QVFKNCINLSASA  200
               QV+KNC+ L+  A
Sbjct  333477  QVYKNCVPLTGPA  333515

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 16/131 (12%)
 Frame = +3

Query  78      AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
               +  GY+ +R L+D D  LY        DCG T P+   +  PT G +  + G    GPCE
Sbjct  331380  SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  331541

Query  136     IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
               IW+D+T+ L+  +C T + +G          +DYS C  S C + ++WL  +       W
Sbjct  331542  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVW  331721

Query  188     QVFKNCINLSA  198
               QV+K+C+ L+ 
Sbjct  331722  QVYKDCVPLTG  331754

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 63/133 (47%), Gaps = 16/133 (12%)
 Frame = +2

Query  78      AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
               A      +R ++D D  LY        DCG T P    +  P+ G +  + G    GPCE
Sbjct  238241  ASNNIKDIRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATFSRGMVHAGPCE  238402

Query  136     IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVC-GESCRVSWFWLGIKYQGERYSW  187
               +W+D+ + L   +C + + +G          IDYS C    C   +FWL ++ +  +  W
Sbjct  238403  VWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWW  238582

Query  188     QVFKNCINLSASA  200
               QV+KNC+ LS  A
Sbjct  238583  QVYKNCVPLSGPA  238621

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 62/132 (47%), Gaps = 16/132 (12%)
 Frame = +3

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
               A   Y  L+ LMD         E   DCG T PN      PT+G+   S G    GPCEI
Sbjct  235161  ATNNYKDLKTLMD-------GPEFGEDCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEI  235319

Query  137     WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQ  188
               W+D+ + L   +C + + +G          +DYS C    C + ++WL ++    +  WQ
Sbjct  235320  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQ  235499

Query  189     VFKNCINLSASA  200
                +KNCI L+  A
Sbjct  235500  SYKNCIPLTGPA  235535

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 63/133 (47%), Gaps = 16/133 (12%)
 Frame = +2

Query  78      AERGYATLRALMDDDG-LYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
               A      +R L+D D  LY        +CG T P+   +  P+ G +  + G    GPCE
Sbjct  236624  ASNNAKDIRTLLDSDTTLYGA------NCGYTNPDASPKDPPSTGDATFSRGIVHAGPCE  236785

Query  136     IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSW  187
               IW+D+ + L   +C + + +G          +DYS C    C   ++WL ++    +  W
Sbjct  236786  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWW  236965

Query  188     QVFKNCINLSASA  200
               QV+KNCI LS  A
Sbjct  236966  QVYKNCIPLSGPA  237004

 Score = 53.9 bits (128),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 10/71 (14%)
 Frame = -2

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTY--------DLDYSACNGS-CTLYWYWLGVR-YL  378
               GPCE+WLDDT VL +D+C +  S + Y         +DYS+C+ S C   +YWL  +   
Sbjct  228487  GPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGST  228308

Query  379     KQVYSWQVYKA  389
                  Y WQ+Y A
Sbjct  228307  SGKYVWQIYSA  228275

 Score = 25.8 bits (55),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (58%), Gaps = 8/40 (20%)
 Frame = -3

Query  281     DSLRAFMDDD-SLYSVNASADFRCGFTDPDA-APQPIPDG  318
               +++R  +D D SLY  +      CGF+DP+A A  P  DG
Sbjct  228678  NNIRKLLDSDTSLYGAD------CGFSDPNAKAKDPPSDG  228577

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 38/72 (53%), Gaps = 9/72 (13%)
 Frame = -3

Query  325     YTHDGPCEVWLDDTRVLQHDNCHEVISGKTY--------DLDYSACNGS-CTLYWYWLGV  375
               +   GPCE+WLDDT VL  D+C +      Y         +DYS+C+ S C L +YWL  
Sbjct  230421  FCRQGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRFYWLAF  230242

Query  376     RYLKQVYSWQVY  387
               +     Y WQ+Y
Sbjct  230241  QGSNDGYVWQIY  230206

 Score = 44.7 bits (104),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (51%), Gaps = 14/73 (19%)
 Frame = -2

Query  130     LDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGES-CRVSWFWLGIKY  180
               + GPCEIW+D+T+ L   +C   F    +         IDYS C  S C   ++WL   +
Sbjct  228493  VQGPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLA--F  228320

Query  181     QGE---RYSWQVF  190
               QG    +Y WQ++
Sbjct  228319  QGSTSGKYVWQIY  228281

 Score = 27.7 bits (60),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 8/46 (17%)
 Frame = -3

Query  79      ERGYAT-LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGS  122
               E GYA  +R L+D D  LY        DCG + PN + +  P++G+
Sbjct  228693  EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGT  228574

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (49%), Gaps = 9/74 (12%)
 Frame = -3

Query  128     YTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGES-CRVSWFWLGI  178
               +   GPCEIW+D+T+ L   +C   F    +         IDYS C  S C + ++WL  
Sbjct  230421  FCRQGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRFYWLAF  230242

Query  179     KYQGERYSWQVFKN  192
               +   + Y WQ++  
Sbjct  230241  QGSNDGYVWQIYSK  230200

>PHSO:scaffold_2
Length=11587142

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 17/129 (13%)
 Frame = +1

Query  276      DANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCE  332
                D+N    +R  +D D+ LY  N      CG+T+PDA P+ P  DG    S G  H GPCE
Sbjct  2550685  DSNNAKDIRTLLDSDTKLYGAN------CGYTNPDATPEDPPTDGTATFSRGIVHAGPCE  2550846

Query  333      VWLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSW  384
                +WLDD  VLQ+D+C       T +       +DYS+C +G C   +YWL ++ L     W
Sbjct  2550847  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  2551026

Query  385      QVYKACVPI  393
                QVYK C+P+
Sbjct  2551027  QVYKNCIPL  2551053

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 88/181 (49%), Gaps = 29/181 (16%)
 Frame = +3

Query  233      MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDD-----FVGYLDANGFDS  282
                 AH  +  P P++  + K N W  +  +E Q     + S  D+     F     AN +  
Sbjct  2546097  QAHGYIAKPEPSWK-DKKTNDW--VVEIEPQWKGGWDESKGDEGLLATFKELSAANNYKD  2546267

Query  283      LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
                +R+ MD + +Y  +      CGFTDP   P  P  DG    S G  H GPCE+WLDD  V
Sbjct  2546268  VRSLMDGNPVYGED------CGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWLDDKMV  2546429

Query  341      LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
                LQ+D+C       T +       +DYS+C +G C L +YWL ++ L     WQ YK C+P
Sbjct  2546430  LQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIP  2546609

Query  393      I  393
                +
Sbjct  2546610  L  2546612

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 17/129 (13%)
 Frame = +3

Query  276      DANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCE  332
                ++NG+  +R  +D D SLY  +      CGFT+PDA+P+  P       S    H  PCE
Sbjct  2559771  ESNGYSDIRTLLDSDTSLYGAD------CGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  2559932

Query  333      VWLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSW  384
                +WLDDT VL +D+C       T +       +DYS+C+ S C L +YWL  + +     W
Sbjct  2559933  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  2560112

Query  385      QVYKACVPI  393
                QVYK CVP+
Sbjct  2560113  QVYKDCVPL  2560139

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 17/128 (13%)
 Frame = +2

Query  277      ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
                AN    +R  +D D+ LY  +      CGFTDP   PQ  P       S G  H GPCE+
Sbjct  2558303  ANNVKDIRTMIDSDTKLYGED------CGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEI  2558464

Query  334      WLDDTRVLQHDNCHEVISGKT-------YDLDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
                WLDD  VLQ+D+C       T         +DYS+C +G C   +YWL ++       WQ
Sbjct  2558465  WLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYWQ  2558644

Query  386      VYKACVPI  393
                VYK C+P+
Sbjct  2558645  VYKNCIPL  2558668

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 16/132 (12%)
 Frame = +3

Query  79       ERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDG-PCEI  136
                  GY+ +R L+D D  LY        DCG T P+   +  PT G    S   +   PCEI
Sbjct  2559774  SNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCEI  2559935

Query  137      WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQ  188
                W+D+T+ L+  +C T + +G          +DYS C  S C + ++WL  +    +  WQ
Sbjct  2559936  WLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  2560115

Query  189      VFKNCINLSASA  200
                V+K+C+ L+  A
Sbjct  2560116  VYKDCVPLTGPA  2560151

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 65/132 (49%), Gaps = 15/132 (11%)
 Frame = +3

Query  78       AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
                A   Y  +R+LMD + +Y        DCG T P  +    PT+G+   S G    GPCEI
Sbjct  2546247  AANNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEI  2546408

Query  137      WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQ  188
                W+D+ + L   +C + + +G          +DYS C    C + ++WL ++    +  WQ
Sbjct  2546409  WLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQ  2546588

Query  189      VFKNCINLSASA  200
                 +KNCI L+  A
Sbjct  2546589  AYKNCIPLTGPA  2546624

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 16/126 (13%)
 Frame = +2

Query  85       LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTL  142
                +R ++D D  LY        DCG T P  + Q  PT G +  + G    GPCEIW+D+ +
Sbjct  2558321  IRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEIWLDDKM  2558482

Query  143      ALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCI  194
                 L   +C + + +G          +DYS C    C   ++WL ++ +  +  WQV+KNCI
Sbjct  2558483  VLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYWQVYKNCI  2558662

Query  195      NLSASA  200
                 L+  A
Sbjct  2558663  PLTGPA  2558680

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 16/126 (13%)
 Frame = +1

Query  85       LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDNTL  142
                +R L+D D  LY        +CG T P+   +  PT+G+   S G    GPCEIW+D+ +
Sbjct  2550706  IRTLLDSDTKLYGA------NCGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  2550867

Query  143      ALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCI  194
                 L   +C + + +G          +DYS C    C   ++WL ++    +  WQV+KNCI
Sbjct  2550868  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  2551047

Query  195      NLSASA  200
                 LS  A
Sbjct  2551048  PLSGPA  2551065

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 46/80 (58%), Gaps = 8/80 (10%)
 Frame = -3

Query  322      STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWL  373
                S G  H GPCE+WLDDT VL +D+C       T +       +DYS+C+ S C L +YWL
Sbjct  2680080  SRGMVHVGPCEIWLDDTMVLSNDDCMTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWL  2679901

Query  374      GVRYLKQVYSWQVYKACVPI  393
                  + +     WQVYK CVP+
Sbjct  2679900  AFQGVDSEIVWQVYKDCVPL  2679841

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 70/154 (45%), Gaps = 47/154 (31%)
 Frame = -2

Query  277      ANGFDS-LRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTH-----  327
                A G+++ +R  +D D+ LY  +      CG++DP+A+P+ P  DG    S G  H     
Sbjct  2543569  AEGYENNIRKLLDGDTKLYGAD------CGYSDPNASPKDPSTDGTATFSRGIAHHVRMK  2543408

Query  328      --------------------DGPCEVWLDDTRVLQHDNCHEVISGKTYD--------LDY  359
                                     GPCE+WLDD  +L  D+C E      Y+        +DY
Sbjct  2543407  MN*P*ST*PGLPNLYMFISGQGPCEIWLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDY  2543228

Query  360      SACNGS-CTLYWYWL---GVRYLKQVYSWQVYKA  389
                S+C+ + C L++YWL   G       Y WQ+Y A
Sbjct  2543227  SSCSANGCMLHFYWLAFQGRTTGNSKYVWQIYSA  2543126

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = -3

Query  110      PNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT-------ID  161
                P+   +  PT G +  + G    GPCEIW+D+T+ L+  +C T + +G          +D
Sbjct  2680128  PDVTAKDPPTTGDATFSRGMVHVGPCEIWLDDTMVLSNDDCMTAYGDGTQETASVFTPVD  2679949

Query  162      YSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                YS C  S C + ++WL  +       WQV+K+C+ L+  A
Sbjct  2679948  YSSCSTSGCMLRFYWLAFQGVDSEIVWQVYKDCVPLTGPA  2679829

 Score = 41.2 bits (95),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 35/70 (50%), Gaps = 12/70 (17%)
 Frame = +2

Query  329      GPCEVWLDDTRVLQHDNCHEVISGKTY----------DLDYSACNGSCTLYWYWLGVR-Y  377
                GPCE+WLDDT VL +D+C +  S + Y          D    + +G C   +YWL  +  
Sbjct  2541395  GPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPID*SSCSSSG-CMFRFYWLAFQGS  2541571

Query  378      LKQVYSWQVY  387
                    Y WQ+Y
Sbjct  2541572  TSGKYVWQIY  2541601

 Score = 27.7 bits (60),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 24/40 (60%), Gaps = 8/40 (20%)
 Frame = +3

Query  281      DSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDG  318
                +++R  +D D+ LY  +      CGF++PDA P+ P  DG
Sbjct  2541186  NNIRKLLDSDTNLYGAD------CGFSNPDAKPKDPPTDG  2541287

 Score = 44.3 bits (103),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 15/92 (16%)
 Frame = +2

Query  286      FMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI--MRSTGYTHDGPCEVWLDDTRVLQH  343
                 +D  SLY      D  C FT+ +  PQPIP     + S G  H G CE  L D ++L  
Sbjct  1607606  MLDGMSLY------DAACSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  1607767

Query  344      DNC-----HEVISGKTYD-LDYSAC-NGSCTL  368
                D+C     H  ++ KT   +DY +C NG C +
Sbjct  1607768  DDCYSEYSHLNVNVKTESFIDYLSCENGGCKM  1607863

 Score = 35.4 bits (80),  Expect(2) = 0.013, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 32/71 (45%), Gaps = 14/71 (20%)
 Frame = +2

Query  132      GPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSV---------CGESCRVSWFWLGIKYQG  182
                GPCEIW+D+T+ L   +C   F    +    SV             C   ++WL   +QG
Sbjct  2541395  GPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPID*SSCSSSGCMFRFYWLA--FQG  2541568

Query  183      E---RYSWQVF  190
                    +Y WQ++
Sbjct  2541569  STSGKYVWQIY  2541601

 Score = 26.6 bits (57),  Expect(2) = 0.013, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 8/46 (17%)
 Frame = +3

Query  79       ERGYAT-LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGS  122
                E GYA  +R L+D D  LY        DCG + P+ + +  PT+G+
Sbjct  2541171  EAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGT  2541290

 Score = 40.8 bits (94),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 61/160 (38%), Gaps = 45/160 (28%)
 Frame = -2

Query  70       AIEAQTWLAERGYATLRALMD-DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSG-  127
                A+ A+   AE     +R L+D D  LY        DCG + PN   +   T+G+   S  
Sbjct  2543593  ALYAEKAKAEGYENNIRKLLDGDTKLYGA------DCGYSDPNASPKDPSTDGTATFSRG  2543432

Query  128      -------------------------YTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT---  159
                                          +  GPCEIW+D+ + L   +C   F    +    
Sbjct  2543431  IAHHVRMKMN*P*ST*PGLPNLYMFISGQGPCEIWLDDKMILHDDDCEETFGTSDYEKIK  2543252

Query  160      -----IDYSVC-GESCRVSWFWLGIKYQ---GERYSWQVF  190
                     IDYS C    C + ++WL  + +     +Y WQ++
Sbjct  2543251  TVFKPIDYSSCSANGCMLHFYWLAFQGRTTGNSKYVWQIY  2543132

>PHCA:scaffold_24 PHYCAscaffold_24
Length=787421

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 71/134 (53%), Gaps = 17/134 (13%)
 Frame = +3

Query  271     FVGYLDANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTH  327
               +    ++NG+  +R  +D D+ LY  N      CGFTDPD   +  P       S G  H
Sbjct  171978  YASLKESNGYSDIRTLLDSDTDLYGAN------CGFTDPDVTAKDPPTTGDATFSRGMVH  172139

Query  328     DGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLK  379
                GPCE+WLDDT+VL +D+C       T +       +DYS+C+ S C L +YWL  + + 
Sbjct  172140  AGPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVD  172319

Query  380     QVYSWQVYKACVPI  393
                   WQVYK CVP+
Sbjct  172320  SKIVWQVYKDCVPL  172361

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 86/181 (48%), Gaps = 29/181 (16%)
 Frame = +1

Query  233     MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDD----------FVGYLDANGFDS  282
                AH  +  PAP++  + + N W  +  +E Q     D+          F      N +  
Sbjct  167509  QAHGYIAKPAPSWK-DKETNDW--VVEIEPQWKGGWDESKGDPGLLSTFKELAAKNNYKD  167679

Query  283     LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
               +R  MD + +Y  +      CGFTDP   P  P  DG    S G  H GPCE+WLDD  V
Sbjct  167680  VRTLMDGNPVYGED------CGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIWLDDKMV  167841

Query  341     LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
               LQ+D+C       T +       +DYS+C +G C L +YWL ++ LK    WQ YK C+P
Sbjct  167842  LQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGKTVWQAYKNCIP  168021

Query  393     I  393
               +
Sbjct  168022  L  168024

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 17/128 (13%)
 Frame = +3

Query  277     ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
               +N    +R  +D D+ LY  +      CG+T+PD  P+ P  DG    S G  H GPCE+
Sbjct  169098  SNNAKDIRTLLDSDTKLYGAD------CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  169259

Query  334     WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
               WLDD  VL +D+C       T +       +DYS+C +G C   +YWL ++ L     WQ
Sbjct  169260  WLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  169439

Query  386     VYKACVPI  393
               VYK C+P+
Sbjct  169440  VYKNCIPL  169463

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 62/128 (48%), Gaps = 17/128 (13%)
 Frame = +1

Query  277     ANGFDSLRAFMD-DDSLYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTHDGPCEV  333
               +N    +R  +D D  LY  +      CG TDP A P+  P       S G  H GPCE+
Sbjct  170596  SNNVKDIRTMIDADPKLYGED------CGNTDPKAKPKDPPSTGDATFSRGIVHAGPCEI  170757

Query  334     WLDDTRVLQHDNCHEVISGKT-------YDLDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
               WLDD  VLQ+D+C       T         +DYS+C  G C   +YWL ++       WQ
Sbjct  170758  WLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLWQ  170937

Query  386     VYKACVPI  393
               VYK C+P+
Sbjct  170938  VYKNCIPL  170961

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 67/132 (51%), Gaps = 16/132 (12%)
 Frame = +3

Query  79      ERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
                 GY+ +R L+D D  LY        +CG T P+   +  PT G +  + G    GPCEI
Sbjct  171996  SNGYSDIRTLLDSDTDLYGA------NCGFTDPDVTAKDPPTTGDATFSRGMVHAGPCEI  172157

Query  137     WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQ  188
               W+D+T  L+  +C T + +G          +DYS C  S C + ++WL  +    +  WQ
Sbjct  172158  WLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKIVWQ  172337

Query  189     VFKNCINLSASA  200
               V+K+C+ L+  A
Sbjct  172338  VYKDCVPLTGPA  172373

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 63/132 (48%), Gaps = 15/132 (11%)
 Frame = +1

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
               A+  Y  +R LMD + +Y        DCG T P       PT+G+   S G    GPCEI
Sbjct  167659  AKNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEI  167820

Query  137     WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQ  188
               W+D+ + L   +C   + +G          +DYS C    C + ++WL ++    +  WQ
Sbjct  167821  WLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGKTVWQ  168000

Query  189     VFKNCINLSASA  200
                +KNCI L+  A
Sbjct  168001  AYKNCIPLTGPA  168036

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 65/133 (49%), Gaps = 16/133 (12%)
 Frame = +3

Query  78      AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCE  135
               A      +R L+D D  LY        DCG T P+   +  PT+G+   S G    GPCE
Sbjct  169095  ASNNAKDIRTLLDSDTKLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCE  169256

Query  136     IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSW  187
               IW+D+ + L+  +C + + +G          +DYS C    C   ++WL ++    +  W
Sbjct  169257  IWLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  169436

Query  188     QVFKNCINLSASA  200
               QV+KNCI LS  A
Sbjct  169437  QVYKNCIPLSGPA  169475

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 9/103 (9%)
 Frame = +1

Query  104     DCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT---  159
               DCG T P  + +  P+ G +  + G    GPCEIW+D+ + L   +C + + +G      
Sbjct  170656  DCGNTDPKAKPKDPPSTGDATFSRGIVHAGPCEIWLDDEMVLQNDDCQSAYGDGTKATIS  170835

Query  160     ----IDYSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                   +DYS C    C   ++WL ++ +  +  WQV+KNCI L+
Sbjct  170836  VFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLWQVYKNCIPLT  170964

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 63/144 (44%), Gaps = 41/144 (28%)
 Frame = -1

Query  281     DSLRAFMDDDS-LYSVNASADFRCGFTDPDA-APQPIPDGIMR-STGYTH----------  327
               +++R  +D D+ LY  N      CGF++PDA A  P  DG      G  H          
Sbjct  161135  NNIRKLLDSDTNLYGAN------CGFSNPDAKAKDPPSDGTATFERGLAHHVSIGVLSGV  160974

Query  328     ------------DGPCEVWLDDTRVLQHDNCHEVISGKTY--------DLDYSACNGS-C  366
                            GPCE+WLDD  VL +D+C +  S   Y         +DYS+C+ S C
Sbjct  160973  LSGFFLNRHVRFQGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGC  160794

Query  367     TLYWYWLGVR-YLKQVYSWQVYKA  389
                  +YWL  +      Y WQ+Y A
Sbjct  160793  MFRFYWLAFQGSTSGKYVWQIYSA  160722

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 66/149 (44%), Gaps = 45/149 (30%)
 Frame = -1

Query  79      ERGYAT-LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG---------------  121
               E GYA  +R L+D D  LY        +CG + P+ + +  P++G               
Sbjct  161150  EAGYANNIRKLLDSDTNLYGA------NCGFSNPDAKAKDPPSDGTATFERGLAHHVSIG  160989

Query  122     --SFITSGYTLD------GPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVC  165
                 S + SG+ L+      GPCEIW+D+ + L   +C   F    +         IDYS C
Sbjct  160988  VLSGVLSGFFLNRHVRFQGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSC  160809

Query  166     GES-CRVSWFWLGIKYQGE---RYSWQVF  190
                 S C   ++WL   +QG    +Y WQ++
Sbjct  160808  SSSGCMFRFYWLA--FQGSTSGKYVWQIY  160728

 Score = 43.5 bits (101),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 46/105 (44%), Gaps = 26/105 (25%)
 Frame = -2

Query  271     FVGYLDANGFDS-LRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDG---------  318
               +V     NG+D  +R  +D D+ LY  +      CG++DP+A P+ P  DG         
Sbjct  162703  YVEKAKENGYDKDIRKLLDSDTNLYGAD------CGYSDPNATPKTPPSDGTATFSRGIA  162542

Query  319     --------IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTY  355
                       +   T Y   GPCE+W+ D   L  D+C +    + Y
Sbjct  162541  HHVRGLSPLCNLTYYLPQGPCEIWVGDKMALHDDDCAKTFGAEDY  162407

 Score = 37.0 bits (84),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 39/94 (41%), Gaps = 25/94 (27%)
 Frame = -2

Query  79      ERGY-ATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSG---------  127
               E GY   +R L+D D  LY        DCG + PN   +  P++G+   S          
Sbjct  162685  ENGYDKDIRKLLDSDTNLYGA------DCGYSDPNATPKTPPSDGTATFSRGIAHHVRGL  162524

Query  128     --------YTLDGPCEIWIDNTLALAGRNCHTEF  153
                       Y   GPCEIW+ + +AL   +C   F
Sbjct  162523  SPLCNLTYYLPQGPCEIWVGDKMALHDDDCAKTF  162422

>PHKE:scaffold_221 scf_22126_221.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_221.1:1:58736:1 
REF
Length=58736

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 68/128 (53%), Gaps = 17/128 (13%)
 Frame = -1

Query  277    ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
              AN    +R   D D SLY  N      CGFT+PDA P+ P  DG    S G  H GPCE+
Sbjct  53099  ANNAKDIRTLFDSDTSLYGEN------CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEI  52938

Query  334    WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
              WLDD  VLQ+D+C       T +       +DYS+C  G C   +YW+ ++ L     WQ
Sbjct  52937  WLDDKMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQ  52758

Query  386    VYKACVPI  393
              VYK CVP+
Sbjct  52757  VYKNCVPL  52734

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 69/128 (54%), Gaps = 17/128 (13%)
 Frame = -1

Query  277   ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
             +NG+  +R  +D D SLY  +      CG+T+PDA  +  P       S G  H GPCE+
Sbjct  2618  SNGYSDIRTLLDSDTSLYGAD------CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  2457

Query  334   WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
             WLDDT VL +D+C       T D       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  2456  WLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVWQ  2277

Query  386   VYKACVPI  393
             VYK CVP+
Sbjct  2276  VYKDCVPL  2253

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 17/128 (13%)
 Frame = -3

Query  277    ANGFDSLRAFMD-DDSLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
              +N +  +R   D D+SLY  N      CGFTDP+A P+  P       S G  H G CE+
Sbjct  51438  SNCYSDIRTLPDSDNSLYGAN------CGFTDPNATPKDPPTIGDATFSCGMMHIGSCEI  51277

Query  334    WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGSC-TLYWYWLGVRYLKQVYSWQ  385
              WLDDT VL  D+C       T +       +D S C+ S   L +YWL  + +     WQ
Sbjct  51276  WLDDTMVLSSDDCQAAYRDDTQEKASVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQ  51097

Query  386    VYKACVPI  393
              VYK CVP+
Sbjct  51096  VYKDCVPL  51073

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 16/133 (12%)
 Frame = -1

Query  78    AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
             +  GY+ +R L+D D  LY        DCG T P+   +  PT G +  + G    GPCE
Sbjct  2621  SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  2460

Query  136   IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
             IW+D+T+ L+  +C T + +G          +DYS C  S C + ++WL  +       W
Sbjct  2459  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVW  2280

Query  188   QVFKNCINLSASA  200
             QV+K+C+ L+  A
Sbjct  2279  QVYKDCVPLTGPA  2241

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 61/123 (50%), Gaps = 16/123 (13%)
 Frame = -1

Query  85     LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDNTL  142
              +R L D D  LY        +CG T P+   +  PT+G+   S G    GPCEIW+D+ +
Sbjct  53081  IRTLFDSDTSLYGE------NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  52920

Query  143    ALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCI  194
               L   +C + + +G          +DYS C    C   ++W+ ++    +  WQV+KNC+
Sbjct  52919  VLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCV  52740

Query  195    NLS  197
               L+
Sbjct  52739  PLT  52731

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (49%), Gaps = 16/129 (12%)
 Frame = -3

Query  82     YATLRALMD-DDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWID  139
              Y+ +R L D D+ LY        +CG T PN   +  PT G +  + G    G CEIW+D
Sbjct  51429  YSDIRTLPDSDNSLYGA------NCGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWLD  51268

Query  140    NTLALAGRNCHTEFPEGHHT-------IDYSVCGESC-RVSWFWLGIKYQGERYSWQVFK  191
              +T+ L+  +C   + +           ID S+C  S   + ++WL  +    +  WQV+K
Sbjct  51267  DTMVLSSDDCQAAYRDDTQEKASVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYK  51088

Query  192    NCINLSASA  200
              +C+ L+  A
Sbjct  51087  DCVPLTGPA  51061

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 10/71 (14%)
 Frame = +1

Query  329    GPCEVWLDDTRVLQHDNCHEVISGKTYD--------LDYSACNGS-CTLYWYWLGVRYLK  379
              GPCE+WLDDT VL +D+C E      Y+        +DYS+C+ S C L +YWL  +  K
Sbjct  57631  GPCEIWLDDTMVLHNDDCEEAFGTSDYETIKSVMKPVDYSSCSSSGCMLRFYWLAFQGSK  57810

Query  380    Q-VYSWQVYKA  389
                 Y WQ+Y A
Sbjct  57811  TGKYVWQIYSA  57843

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 37/71 (52%), Gaps = 14/71 (20%)
 Frame = +1

Query  132    GPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGES-CRVSWFWLGIKYQG  182
              GPCEIW+D+T+ L   +C   F    +         +DYS C  S C + ++WL   +QG
Sbjct  57631  GPCEIWLDDTMVLHNDDCEEAFGTSDYETIKSVMKPVDYSSCSSSGCMLRFYWLA--FQG  57804

Query  183    E---RYSWQVF  190
                  +Y WQ++
Sbjct  57805  SKTGKYVWQIY  57837

>PHSO:scaffold_16
Length=803425

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 83/171 (49%), Gaps = 24/171 (14%)
 Frame = +2

Query  234     AHQLVILPAPTYT-------VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAF  286
               AH  +++P   +T       V   D  W    + +G N  + + F     AN F  L+  
Sbjct  521807  AHGYMLIPESQFTGGANSAWVVQIDPVWASDKW-DGNNAGSVEVFKSLKSANNFKDLKTL  521983

Query  287     MDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQHD  344
               MDD S+Y  +      CGFTDP+  PQPIP DG    S    H GPCE+WLD+T+VL  D
Sbjct  521984  MDDTSVYGQD------CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLYED  522145

Query  345     NCHEVISGKTYDL------DYSACN-GSCT-LYWYWLGVRYLKQVYSWQVY  387
               +C      +  D+      DYS+CN G C  + +YWL  + L     WQ Y
Sbjct  522146  DCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSY  522298

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 79/150 (53%), Gaps = 26/150 (17%)
 Frame = -1

Query  250     KDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPD  309
               K ++W      +G N  + + F  +   N F  L+  MDD S+Y  +      CGFTDP+
Sbjct  524548  KSDKW------DGNNPGSVEVFTSFKSVNNFKDLKTLMDDTSVYGQD------CGFTDPN  524405

Query  310     AAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQHDNCH--------EVISGKTYDLDY  359
                 PQPIP DG    S G  H GPCE+WLDD +VL  D+C+        +VI+  T+ +DY
Sbjct  524404  GTPQPIPTDGKATFSRGLIHVGPCEIWLDDNKVLSEDDCYSKYGNPNQDVIT--TFPVDY  524231

Query  360     SAC-NGSCT-LYWYWLGVRYLKQVYSWQVY  387
               S+C NG C  +  Y LG + L     WQ Y
Sbjct  524230  SSCNNGGCKEMRCYCLGFQGLVDKTVWQSY  524141

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 72/126 (57%), Gaps = 17/126 (13%)
 Frame = -1

Query  277     ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DG-IMRSTGYTHDGPCEVW  334
               AN F  L+  +DD SLY  +      CGFTDP+  PQPIP DG  + S G  H GPCE W
Sbjct  554095  ANNFKDLKTMLDDTSLYGPD------CGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFW  553934

Query  335     LDDTRVLQHDNC-----HEVISGKT-YDLDYSAC-NGSCTLY-WYWLGVRYLKQVYS-WQ  385
               LDD +VL  D+C     H  ++ KT + +DYS+C NG C +  +YWLG + L    + WQ
Sbjct  553933  LDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQ  553754

Query  386     VYKACV  391
                Y   +
Sbjct  553753  TYSTLL  553736

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 72/126 (57%), Gaps = 17/126 (13%)
 Frame = +2

Query  277     ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DG-IMRSTGYTHDGPCEVW  334
               AN F  L+  +DD SLY  +      CGFTDP+  PQPIP DG  + S G  H GPCE W
Sbjct  557057  ANNFKDLKTMLDDTSLYGPD------CGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFW  557218

Query  335     LDDTRVLQHDNC-----HEVISGKT-YDLDYSAC-NGSCTLY-WYWLGVRYLKQVYS-WQ  385
               LDD +VL  D+C     H  ++ KT + +DYS+C NG C +  +YWLG + L    + WQ
Sbjct  557219  LDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQ  557398

Query  386     VYKACV  391
                Y   +
Sbjct  557399  TYSTLL  557416

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 84/171 (49%), Gaps = 24/171 (14%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWK-------PLAFLEGQNFSTTDDFVGYLDANGFDSLRAF  286
               AH  + +P   +   G++++W        P     G    +   F     ++ +  LR  
Sbjct  551633  AHGYIYVPQSQF-FGGENSQWSVQIPPVWPSNDWYGNTQKSVQVFNSLKTSHNYKDLRTL  551457

Query  287     MDDDSLYSVNASADFRCGFTDPDAAPQPIPDG--IMRSTGYTHDGPCEVWLDDTRVLQHD  344
               +D+ ++Y  N      CG+T+P+  PQPIP     + S G  H GPCE+WLDD +V+  D
Sbjct  551456  LDNTAVYGPN------CGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWLDDKKVMAAD  551295

Query  345     NC-----HEVISGKT-YDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVY  387
               +C     H  ++ KT + +DYS C   G C + +YWLG + L +   WQ Y
Sbjct  551294  DCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTY  551142

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 19/127 (15%)
 Frame = -3

Query  79      ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIW  137
                  Y  LR L+D+  +Y        +CG T PN   QPIPTNG  I S G    GPCEIW
Sbjct  551486  SHNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIW  551325

Query  138     IDNTLALAGRNCHTEFPEGHHT--------IDYSVCGES--CRVSWFWLGIKYQGERYSW  187
               +D+   +A  +C++++  GH          +DYS C     C + ++WLG +  G++  W
Sbjct  551324  LDDKKVMAADDCYSKY--GHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVW  551151

Query  188     QVFKNCI  194
               Q +   +
Sbjct  551150  QTYSTLL  551130

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 79/171 (46%), Gaps = 24/171 (14%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWK-------PLAFLEGQNFSTTDDFVGYLDANGFDSLRAF  286
               AH  + +P   +   G +++W        P     G    +   F     ++ +  LR  
Sbjct  543146  AHGYIYVPQSQFK-GGANSQWSVQIDPVWPSKDWYGNTQKSVQVFNSLKGSHNYKDLRTL  542970

Query  287     MDDDSLYSVNASADFRCGFTDPDAAPQPIPDG--IMRSTGYTHDGPCEVWLDDTRVLQHD  344
               +DD S Y  N      CG+T+P+  P PIP     + S G  H GPCE+WLD+ +V+  D
Sbjct  542969  LDDTSKYGPN------CGYTNPNGTP*PIPTNGKAIFSRGLIHTGPCEIWLDNKKVMAAD  542808

Query  345     NC-----HEVISGKT-YDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVY  387
               +C     H  ++ KT + +DYS C   G C + +Y L  + L +   WQ Y
Sbjct  542807  DCYNRYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYCLAFQALGKKTVWQTY  542655

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 64/144 (44%), Gaps = 25/144 (17%)
 Frame = -3

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
                   Y  LR L+DD   Y        +CG T PN    PIPTNG  I S G    GPCEI
Sbjct  543002  GSHNYKDLRTLLDDTSKYGP------NCGYTNPNGTP*PIPTNGKAIFSRGLIHTGPCEI  542841

Query  137     WIDNTLALAGRNCH-----------TEFPEGHHTIDYSVCGES--CRVSWFWLGIKYQGE  183
               W+DN   +A  +C+           TEFP     +DYS C     C + ++ L  +  G+
Sbjct  542840  WLDNKKVMAADDCYNRYGHSNVNVKTEFP-----VDYSYCKAKGGCMMRFYCLAFQALGK  542676

Query  184     RYSWQVFKNCINLSASALVTMIGL  207
               +  WQ +   ++ S      MI L
Sbjct  542675  KTVWQTYSKLLDASCCLTCIMIEL  542604

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 63/140 (45%), Gaps = 15/140 (11%)
 Frame = +2

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEI  136
               +   +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEI
Sbjct  521951  SANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEI  522112

Query  137     WIDNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQ  188
               W+DNT  L   +C +++   +  I      DYS C  G    + ++WL  +    +  WQ
Sbjct  522113  WLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQ  522292

Query  189     VFKNCINLSASALVTMIGLQ  208
                +          L+   GL+
Sbjct  522293  SYSKFTGYELRQLLVSCGLR  522352

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 20/127 (16%)
 Frame = -1

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWI  138
                 +  L+ ++DD  LY        DCG T PN   QPIPT+G  + S G    GPCE W+
Sbjct  554092  NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  553931

Query  139     DNTLALAGRNCHTEFPEGHHT--------IDYSVC--GESCRVSWFWLGIKYQGERYS-W  187
               D+   L   +C++E+  GH          IDYS C  G    + ++WLG +   ++ + W
Sbjct  553930  DDKKVLYADDCYSEY--GHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVW  553757

Query  188     QVFKNCI  194
               Q +   +
Sbjct  553756  QTYSTLL  553736

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 20/127 (16%)
 Frame = +2

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWI  138
                 +  L+ ++DD  LY        DCG T PN   QPIPT+G  + S G    GPCE W+
Sbjct  557060  NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  557221

Query  139     DNTLALAGRNCHTEFPEGHHT--------IDYSVC--GESCRVSWFWLGIKYQGERYS-W  187
               D+   L   +C++E+  GH          IDYS C  G    + ++WLG +   ++ + W
Sbjct  557222  DDKKVLYADDCYSEY--GHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVW  557395

Query  188     QVFKNCI  194
               Q +   +
Sbjct  557396  QTYSTLL  557416

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 60/120 (50%), Gaps = 15/120 (13%)
 Frame = -1

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWI  138
                 +  L+ LMDD  +Y        DCG T PN   QPIPT+G +  + G    GPCEIW+
Sbjct  524482  NNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGPCEIWL  524321

Query  139     DNTLALAGRNCHTEFPEGHH------TIDYSVCGE-SCR-VSWFWLGIKYQGERYSWQVF  190
               D+   L+  +C++++   +        +DYS C    C+ +  + LG +   ++  WQ +
Sbjct  524320  DDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKTVWQSY  524141

>PHKE:scaffold_949 scf_22126_949.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_949.1_contig_1:1:5261:1 
REF
Length=5261

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 68/128 (53%), Gaps = 17/128 (13%)
 Frame = +2

Query  277   ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
             AN    +R  +D D+ LY  +      CGFTDP A P+ P  DG    S G  H GPCE+
Sbjct  2651  ANNVKDIRTMLDSDTKLYGQD------CGFTDPKATPKDPPTDGAATFSRGIVHAGPCEI  2812

Query  334   WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
             WLDD  VLQ+D+C       T +       +DYS+C  G C   +YWL ++ L     WQ
Sbjct  2813  WLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQ  2992

Query  386   VYKACVPI  393
             VYK CVP+
Sbjct  2993  VYKNCVPL  3016

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 62/131 (47%), Gaps = 16/131 (12%)
 Frame = +2

Query  78    AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCE  135
             A      +R ++D D  LY        DCG T P    +  PT+G+   S G    GPCE
Sbjct  2648  AANNVKDIRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCE  2809

Query  136   IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSW  187
             IW+D+ + L   +C + + +G          +DYS C    C   ++WL ++    +  W
Sbjct  2810  IWLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFW  2989

Query  188   QVFKNCINLSA  198
             QV+KNC+ LS 
Sbjct  2990  QVYKNCVPLSG  3022

>PYAR:scaffold_88 par_scaffold_88 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_88:1:34485:1 
REF
Length=34485

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 71/131 (54%), Gaps = 13/131 (10%)
 Frame = +2

Query  265   FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-ST  323
             F T   +       GF +LRAF++D             CG T P+A P+P    +++ ++
Sbjct  3686  FRTGAQYAAVAPDKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLAS  3838

Query  324   GYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
                H GPCE+WLDD+     D+C +   S  ++ +D+SAC GSC L +YWLG++   +  
Sbjct  3839  TIEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQNSGK--  4012

Query  383   SWQVYKACVPI  393
              WQ YK C+P+
Sbjct  4013  RWQSYKNCIPL  4045

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 14/133 (11%)
 Frame = +2

Query  264   NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-  321
              F T   +       GF +LR+F++         S    CG +   A P+PIP DG+++ 
Sbjct  2408  KFKTGAQYAAVAPGKGFKNLRSFLE---------SKGPTCGNSLSSAKPKPIPSDGMVKF  2560

Query  322   STGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQ  380
             ++   H GPCE+WLD+T     D+C +   S  +  +++SAC GSC L +YWLG++    
Sbjct  2561  ASTLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DS  2734

Query  381   VYSWQVYKACVPI  393
                WQ YK CVP+
Sbjct  2735  GTRWQSYKNCVPL  2773

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 69/132 (52%), Gaps = 12/132 (9%)
 Frame = +2

Query  79    ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWI  138
             ++G+  LRA ++D G           CG T PN + +P       + S     GPCEIW+
Sbjct  3722  DKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLASTIEHPGPCEIWL  3874

Query  139   DNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
             D++LA    +C  +F       +D+S C  SC + ++WLG++  G+R  WQ +KNCI L 
Sbjct  3875  DDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQNSGKR--WQSYKNCIPLG  4048

Query  198   ASALVTMIGLQH  209
              +   ++ G ++
Sbjct  4049  GAQSRSIDGEEY  4084

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 69/130 (53%), Gaps = 19/130 (15%)
 Frame = +2

Query  80    RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD--GPCEIW  137
             +G+  LR+ ++  G           CG +  + + +PIP++G  +    TL+  GPCEIW
Sbjct  2450  KGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDG-MVKFASTLEHPGPCEIW  2599

Query  138   IDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
             +D T+A    +C  +F  G  T   +++S C  SC + ++WLG++  G R  WQ +KNC+
Sbjct  2600  LDETMAFHSDDCEKQF--GSSTSVKVNFSACKGSCMLRFYWLGLQDSGTR--WQSYKNCV  2767

Query  195   NLSASALVTM  204
              L      +M
Sbjct  2768  PLGGGKSRSM  2797

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +2

Query  327  HDGPCEVWLDDTRVLQHDNC-HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
            H GPCE+WLD+T V  +D+C  E  S  +  +++SAC GSC L +YWLG++       WQ
Sbjct  455  HPGPCEMWLDETMVFHNDDCKKEFGSSTSVKINFSACKGSCMLRFYWLGLQ--DSGTRWQ  628

Query  386  VYKACVPI  393
             YK CVP+
Sbjct  629  SYKNCVPL  652

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 3/66 (5%)
 Frame = +2

Query  132  GPCEIWIDNTLALAGRNCHTEFPEGHH-TIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
            GPCE+W+D T+     +C  EF       I++S C  SC + ++WLG++  G R  WQ +
Sbjct  461  GPCEMWLDETMVFHNDDCKKEFGSSTSVKINFSACKGSCMLRFYWLGLQDSGTR--WQSY  634

Query  191  KNCINL  196
            KNC+ L
Sbjct  635  KNCVPL  652

>PHIF:NW_003303738.1 Phytophthora infestans T30-4 supercont1.21 
genomic scaffold, whole genome shotgun sequence
Length=2319577

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 73/141 (52%), Gaps = 14/141 (10%)
 Frame = -3

Query  262      GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR  321
                G     T +F     A+ + SL+ FM+D+ +  VN      CG+T+PDA PQP+P   + 
Sbjct  1058903  GSPTDNTANFNKGFAASKYKSLKEFMNDN-MVLVNEDFTKECGYTNPDATPQPLPKTYVE  1058727

Query  322      -----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYW  372
                       G+T  H+GPCEV+ D+TRV Q DNC +        L  D+ AC GS  L  YW
Sbjct  1058726  WSHGAGEGFTLSHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYW  1058547

Query  373      LGVRYLKQVYSWQVYKACVPI  393
                + +       SWQVY  C P+
Sbjct  1058546  IALHSP----SWQVYINCAPL  1058496

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = +2

Query  235      HQLVILPAPTYTVEGKDNRW----------KPLAFLEGQNFSTTDDFVGYLDANGFDSLR  284
                H  +  PA T+     DN            K +    G     T  F    +++ + SL+
Sbjct  1081631  HGYMTDPAVTFLSSSTDNTQFIATIEASASKFIGTFSGSPADNTAAFTTAFESSSYTSLK  1081810

Query  285      AFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLDD  337
                  ++  +  +V   A   CG  DPD   QP+P+  +      + G+T  H+GPCEVW DD
Sbjct  1081811  QLINALATVTVT-DATLTCGSCDPDETAQPLPETYVEWSHSSTEGFTSSHEGPCEVWCDD  1081987

Query  338      TRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 RV Q ++C    +    +L  D+ AC G+ TL +YWL +       +WQVY  C P+
Sbjct  1081988  VRVFQDNDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH----SSTWQVYINCAPL  1082149

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 73/135 (54%), Gaps = 15/135 (11%)
 Frame = -3

Query  268      TDDFVGYLDANGFDSLRAFMDDDSLYSVNAS-ADFRCGFTDPDAAPQPIPDGI----MRS  322
                T+ F     ++ F S++ F+   +L  V A+ A+ +CG TDP+  PQP+P+ I      +
Sbjct  1071398  TETFWTAFSSSKFTSIKEFVT--ALGQVVATGANLQCGLTDPNETPQPLPEQIEWTHSDT  1071225

Query  323      TGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYL  378
                 G+T  H+GPCE W DDT+V Q  NC    +     L Y  +AC+G+  L +YWL +   
Sbjct  1071224  EGFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAPAKLPYNKAACSGASRLAFYWLALHS-  1071048

Query  379      KQVYSWQVYKACVPI  393
                    +WQVY  C  +
Sbjct  1071047  ---STWQVYANCAAL  1071012

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 64/129 (50%), Gaps = 12/129 (9%)
 Frame = +2

Query  271      FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRS----TGYT  326
                F    +A+ + S++  +DD +   V   A   CG  DP+  PQP+PD +  S     G+T
Sbjct  1220693  FTKAFEASKYKSIKEVIDDKAKIIVTG-ATLTCGIADPNTTPQPLPDKVEWSHSEGEGFT  1220869

Query  327      --HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
                  H+ PCEVW D  RV   DNC    + +    + S C+G+  L  YW+ +       SW
Sbjct  1220870  STHESPCEVWCDMKRVFYDDNCAAQFTAE-LPYEKSKCSGASVLTMYWMAMHGP----SW  1221034

Query  385      QVYKACVPI  393
                QVY  C P+
Sbjct  1221035  QVYVNCAPL  1221061

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 85/179 (47%), Gaps = 25/179 (14%)
 Frame = +2

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQN------FSTT-----DDFVGYLDANGFDS  282
                AH  +  P  T++ E  D + + +A +E  +      F+T        F    DA+ + S
Sbjct  1247216  AHGWLSKPEATFSNEAGD-KTQFIATIEASSSGFKGTFNTAPKENVASFTKAFDASTYKS  1247392

Query  283      LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT--HDGPCEVWLD  336
                L+AF+DD +  +V+  A   CG  +PDA  QP+P  +      S G+T  H+GPCE W D
Sbjct  1247393  LKAFIDDKAKITVSG-ATLTCGNAEPDATAQPLPAKLEWYHSESEGFTASHEGPCEAWCD  1247569

Query  337      DTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                + RV   +NC  H   +      +   C G+  L ++W+ +       +WQVY  C  +
Sbjct  1247570  NERVFHDENCAAHFTTAPAVMPYEKRKCAGASKLTFFWMAMHGP----TWQVYVNCATL  1247734

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 80/179 (45%), Gaps = 26/179 (15%)
 Frame = +3

Query  235      HQLVILPAPTYTVEGKDNRWKPLAFLEGQ--NFS---------TTDDFVGYLDANGFDSL  283
                H  +  PA T+     DN  + +A +E     FS          T  F    +++ + SL
Sbjct  1046679  HGYMTEPAVTFLSSSTDNT-QFIATIEASASKFSGTFSGSPADNTAAFTTAFESSSYTSL  1046855

Query  284      RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
                +  ++  +  +V   A   CG  DPD   QP+P+  +      + G+T  H+GP EVW D
Sbjct  1046856  KELINALTTVTVT-DATLTCGSCDPDETAQPLPETYVEWSHSSTEGFTSSHEGP*EVWCD  1047032

Query  337      DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                D R  Q  NC    +     L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  1047033  DVRAFQDRNCAADYTSAPAKLPYDRDACLGTSTLTFYWLAL----HSSTWQVYINCAPL  1047197

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 71/153 (46%), Gaps = 15/153 (10%)
 Frame = +1

Query  48       VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGL  107
                V DGM Y G P++  E     TA  A  + + +       +++ D LY        +CG 
Sbjct  1089778  VPDGMGYEGDPLSNTE--AYWTAFNASKYTSLKELVWKNEVVNTDSLYGT---ATIECGF  1089942

Query  108      TFPNTETQPIPTNGSF--ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--S  163
                ++ N   + +P    +  +T+G+  DGPCEIW D+TL  A +NC   +P+   +  Y  +
Sbjct  1089943  SWTNGTARDLPDEVQWDKLTTGH--DGPCEIWCDDTLVFADQNCAVNYPDSPASFPYDKA  1090116

Query  164      VCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                 C     ++  WL +        WQVF NC  L
Sbjct  1090117  ACEGKSMLTAIWLAL----HSPPWQVFTNCAPL  1090203

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 61/133 (46%), Gaps = 15/133 (11%)
 Frame = +1

Query  271      FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDP---DAAPQP---IPDGIMRSTG  324
                F     A+ + SL+ F  D +   V   A   CG  DP    AAP P   I      S G
Sbjct  1284565  FTKAFKASKYTSLKEFFTDKAKIGVPG-ATLTCGSCDPK*RSAAPCP*STIEWSHSASEG  1284741

Query  325      YT--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQ  380
                +T  H+GPCEVW  + R  Q DNC  H  +       D  AC G+ TL +YW+ +     
Sbjct  1284742  FTPSHEGPCEVWCGNVRTFQDDNCPAHYTMVPAVLPFDREACMGATTLTFYWMAM----H  1284909

Query  381      VYSWQVYKACVPI  393
                  SWQVY  C P+
Sbjct  1284910  SESWQVYVNCAPL  1284948

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 78/183 (43%), Gaps = 32/183 (17%)
 Frame = +1

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFL--------------EGQNFSTTDDFVGYLDANG  279
                AH  + LP PT+  E   N   P   +              EG   S T+ +    +A+ 
Sbjct  1089682  AHSKMSLPKPTWIYEDGTNS--PAGTVDSSSVLPVPDGMGYEGDPLSNTEAYWTAFNASK  1089855

Query  280      FDSLRAFM------DDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT-HDGPCE  332
                + SL+  +      + DSLY    +A   CGF+  +   + +PD +      T HDGPCE
Sbjct  1089856  YTSLKELVWKNEVVNTDSLY---GTATIECGFSWTNGTARDLPDEVQWDKLTTGHDGPCE  1090026

Query  333      VWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
                +W DDT V    NC  +   S  ++  D +AC G   L   WL +        WQV+  C
Sbjct  1090027  IWCDDTLVFADQNCAVNYPDSPASFPYDKAACEGKSMLTAIWLALHSPP----WQVFTNC  1090194

Query  391      VPI  393
                 P+
Sbjct  1090195  APL  1090203

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 79/177 (45%), Gaps = 24/177 (14%)
 Frame = +2

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLE---------GQNFST-----TDDFVGYLDANG  279
                AH  + +P PT+  EG  N+  P   ++         G +++T     T  +    +A+ 
Sbjct  1088171  AHNKMTVPVPTWP-EGVYNQNSPSGIIDPSDVLPVPSGMSYTTDPGSNTKAYWTAFNASK  1088347

Query  280      FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRST-GYTHDGPCEVWLDDT  338
                + SL+    D     +  SA   CGF+  D  P+ +PD +       +H GPCEVW DDT
Sbjct  1088348  YKSLKELSWDSQ--KLEGSASNECGFSLVDGTPRDLPDEVQWDFFTASHQGPCEVWCDDT  1088521

Query  339      RVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 V ++ NC         +L Y  + C G+  L  YW+ +        WQVY  C P+
Sbjct  1088522  LVFENWNCAVDYPETPANLPYDKAKCKGAAMLTSYWIALH----TTPWQVYTNCAPL  1088680

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 30/182 (16%)
 Frame = +3

Query  234      AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNF--------------STTDDFVGYLDANG  279
                AH  +  P PT++V      +  L  ++GQ++              S T+ +    +A+ 
Sbjct  1105092  AHSYMSDPMPTWSVGFPSTNYAGL--IDGQDYLPVPKGMSYGGTPESNTEAYWTAFNASK  1105265

Query  280      FDSLRAFMDDDSLY---SVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
                + SL+   D   +    S    A   CGF+ P    + +P  +  +  GY+H GPCEVW 
Sbjct  1105266  YTSLKDLADKTMVLQSLSPFGKATKECGFSTPKGTKRNLPAKVQWKDFGYSHQGPCEVWC  1105445

Query  336      DDTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                DD       NC     EV +   YD+D   C G+  +  YW+ +  L     WQ+Y  C 
Sbjct  1105446  DDKLAFMDTNCALHYPEVPAYLPYDID--VCVGAKMIQSYWIALHGLP----WQLYLNCA  1105607

Query  392      PI  393
                P+
Sbjct  1105608  PL  1105613

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 13/128 (10%)
 Frame = -3

Query  77       LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--  130
                 A   Y +L+  M+D+ +  V E+   +CG T P+   QP+P            G+TL  
Sbjct  1058864  FAASKYKSLKEFMNDN-MVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSH  1058688

Query  131      DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                +GPCE++ D T      NC   FP     +  D+  C  S ++S +W+ +       SWQ
Sbjct  1058687  EGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIAL----HSPSWQ  1058520

Query  189      VFKNCINL  196
                V+ NC  L
Sbjct  1058519  VYINCAPL  1058496

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 75/171 (44%), Gaps = 22/171 (13%)
 Frame = +3

Query  32       SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
                +GL +GQ  L  P      GM Y G+P +  E     TA  A        Y +L+ L D 
Sbjct  1105155  AGLIDGQDYLPVP-----KGMSYGGTPESNTE--AYWTAFNASK------YTSLKDLADK  1105295

Query  92       DG-LYSVTEEG--LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRN  148
                   L S++  G    +CG + P    + +P    +   GY+  GPCE+W D+ LA    N
Sbjct  1105296  TMVLQSLSPFGKATKECGFSTPKGTKRNLPAKVQWKDFGYSHQGPCEVWCDDKLAFMDTN  1105475

Query  149      CHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                C   +PE   +   D  VC  +  +  +W+ +        WQ++ NC  L+
Sbjct  1105476  CALHYPEVPAYLPYDIDVCVGAKMIQSYWIAL----HGLPWQLYLNCAPLT  1105616

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 16/137 (12%)
 Frame = +2

Query  73       AQTWLA--ERGYATLRALMDDDG-LYSVTEEGL--FDCGLTFPNTETQPIPTN---GSFI  124
                AQ W A  +  Y +L+ L+D    + +++  G+   +CG +  N   + +P+     + +
Sbjct  1286870  AQHWTAFNKSTYTSLKDLVDKTAKVETLSPFGMATLECGFSLANGTARDLPSEYVEWNQL  1287049

Query  125      TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSV--CGESCRVSWFWLGIKYQG  182
                T G+  DGPCE+W D+ LA    NC   +PE      + V  C  + R++ +W+ +    
Sbjct  1287050  TEGH--DGPCEVWCDDVLAFGDDNCAVNYPETPSKWPFDVYKCSGASRLTAYWIALH---  1287214

Query  183      ERYSWQVFKNCINLSAS  199
                    WQVF NC+ L+ S
Sbjct  1287215  -GLPWQVFINCVPLTGS  1287262

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 48/101 (48%), Gaps = 11/101 (11%)
 Frame = -3

Query  103      FDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEIWIDNTLALAGRNCHTEFPEGH  157
                  CGLT PN   QP+P    +    T G+T   +GPCE W D+T      NC   F    
Sbjct  1071302  LQCGLTDPNETPQPLPEQIEWTHSDTEGFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAP  1071123

Query  158      HTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                  + Y  + C  + R++++WL +       +WQV+ NC  L
Sbjct  1071122  AKLPYNKAACSGASRLAFYWLALH----SSTWQVYANCAAL  1071012

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 56/122 (46%), Gaps = 12/122 (10%)
 Frame = +2

Query  82       YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--DGPCEI  136
                Y +L+A +DD    +V+   L  CG   P+   QP+P    +  S   G+T   +GPCE 
Sbjct  1247384  YKSLKAFIDDKAKITVSGATL-TCGNAEPDATAQPLPAKLEWYHSESEGFTASHEGPCEA  1247560

Query  137      WIDNTLALAGRNCHTEFPEGHHTIDYS--VCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                W DN       NC   F      + Y    C  + ++++FW+ +       +WQV+ NC 
Sbjct  1247561  WCDNERVFHDENCAAHFTTAPAVMPYEKRKCAGASKLTFFWMAM----HGPTWQVYVNCA  1247728

Query  195      NL  196
                 L
Sbjct  1247729  TL  1247734

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = +3

Query  315      IPDGIMRSTGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYW  370
                +PD    S G+T  H+GPCE+W DD RV Q ++C    +     L  D+ AC GS  L  
Sbjct  1057305  VPDCQHCSEGFTASHEGPCEIWCDDVRVFQGNDCAADYTTAPAKLPYDHDACLGSSVLN-  1057481

Query  371      YWLGVRYLKQVYSWQVYKACVPI  393
                YW+ +       +WQVY  C P+
Sbjct  1057482  YWMAL----HSSTWQVYVNCAPL  1057538

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 46/99 (46%), Gaps = 8/99 (8%)
 Frame = +2

Query  299      ADFRCGFTDPDAAPQPIPDGIMRSTGYT--HDGPCEVWLDDTRVLQHDNC--HEVISGKT  354
                A   CGF+  +   + +P   +     T  HDGPCEVW DD      DNC  +   +   
Sbjct  1286969  ATLECGFSLANGTARDLPSEYVEWNQLTEGHDGPCEVWCDDVLAFGDDNCAVNYPETPSK  1287148

Query  355      YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                +  D   C+G+  L  YW+ +  L     WQV+  CVP+
Sbjct  1287149  WPFDVYKCSGASRLTAYWIALHGLP----WQVFINCVPL  1287253

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 55/122 (45%), Gaps = 15/122 (12%)
 Frame = +2

Query  82       YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP-------TNGSFITSGYTLDGPC  134
                Y +++ ++DD     VT   L  CG+  PNT  QP+P       + G   TS  T + PC
Sbjct  1220720  YKSIKEVIDDKAKIIVTGATL-TCGIADPNTTPQPLPDKVEWSHSEGEGFTS--THESPC  1220890

Query  135      EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                E+W D        NC  +F       + S C  +  ++ +W+ +       SWQV+ NC 
Sbjct  1220891  EVWCDMKRVFYDDNCAAQF-TAELPYEKSKCSGASVLTMYWMAM----HGPSWQVYVNCA  1221055

Query  195      NL  196
                 L
Sbjct  1221056  PL  1221061

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 51/116 (44%), Gaps = 19/116 (16%)
 Frame = +2

Query  287      MDDDSLYSVNASADFRCGFTDPDAAPQPI---------PDGIMRSTGYTHDGPCEVWLDD  337
                M +D+   V+  A   CGF+ P+                D I    G+ H GPCE W D+
Sbjct  1160306  MINDNQVLVSDDATATCGFSSPEKTSHGALNDTIYWGRNDDITMDEGFVHPGPCETWCDN  1160485

Query  338      TRVLQHDNCHEVI---SGK---TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                TR+ Q   C E     SGK      +D + C  +  L +YW+G+       +WQVY
Sbjct  1160486  TRIQQDMTCMETYNTPSGKGAAPIPIDNAKCTDAKRLTFYWIGM----HGSTWQVY  1160641

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 60/133 (45%), Gaps = 13/133 (10%)
 Frame = +2

Query  75       TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
                T      Y +L+ L++     +VT+  L  CG   P+   QP+P          T G+T 
Sbjct  1081775  TAFESSSYTSLKQLINALATVTVTDATL-TCGSCDPDETAQPLPETYVEWSHSSTEGFTS  1081951

Query  131      --DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYS  186
                  +GPCE+W D+       +C  ++      +  D+  C  +  ++++WL +       +
Sbjct  1081952  SHEGPCEVWCDDVRVFQDNDCAADYTSAPAELPYDHDACLGTSTLTFYWLAL----HSST  1082119

Query  187      WQVFKNCINLSAS  199
                WQV+ NC  L ++
Sbjct  1082120  WQVYINCAPLEST  1082158

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 13/133 (10%)
 Frame = +3

Query  75       TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
                T      Y +L+ L++     +VT+  L  CG   P+   QP+P          T G+T 
Sbjct  1046823  TAFESSSYTSLKELINALTTVTVTDATL-TCGSCDPDETAQPLPETYVEWSHSSTEGFTS  1046999

Query  131      --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
                  +GP E+W D+  A   RNC  ++      + Y    C  +  ++++WL +       +
Sbjct  1047000  SHEGP*EVWCDDVRAFQDRNCAADYTSAPAKLPYDRDACLGTSTLTFYWLAL----HSST  1047167

Query  187      WQVFKNCINLSAS  199
                WQV+ NC  L ++
Sbjct  1047168  WQVYINCAPLEST  1047206

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 57/126 (45%), Gaps = 17/126 (13%)
 Frame = +3

Query  280      FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPI---------PDGIMRSTGYTHDGP  330
                + SLRA ++D+ +  V++ A   CGF+ P+                D I    G+ H GP
Sbjct  1083231  YKSLRAGIEDNQVL-VSSEAPASCGFSSPEQTSYGAVNNTVYWDRSDDITVGEGFVHPGP  1083407

Query  331      CEVWLDDTRVLQH---DNCHEVISGK---TYDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
                CEVW  D R  Q    D  +    GK      +D S C  +  L ++W     + Q+YS 
Sbjct  1083408  CEVWCGDNRAHQDMTGDKTYNPPPGKGAAPVPIDKSLCKEATRLTFFWYMHGPMWQIYS-  1083584

Query  385      QVYKAC  390
                ++ ++C
Sbjct  1083585  KLLRSC  1083602

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 49/101 (49%), Gaps = 10/101 (10%)
 Frame = +2

Query  104      DCGLTFPNTETQPIP--TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTID  161
                +CG +  +   + +P      F T+ +   GPCE+W D+TL     NC  ++PE    + 
Sbjct  1088408  ECGFSLVDGTPRDLPDEVQWDFFTASH--QGPCEVWCDDTLVFENWNCAVDYPETPANLP  1088581

Query  162      Y--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                Y  + C  +  ++ +W+ +        WQV+ NC  L+ ++
Sbjct  1088582  YDKAKCKGAAMLTSYWIAL----HTTPWQVYTNCAPLTGAS  1088692

 Score = 40.8 bits (94),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 51/118 (43%), Gaps = 15/118 (13%)
 Frame = +3

Query  72       EAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF--------  123
                + Q    +  Y +LRA ++D+ +  V+ E    CG + P   +     N  +        
Sbjct  1083201  QRQVHYKKSKYKSLRAGIEDNQVL-VSSEAPASCGFSSPEQTSYGAVNNTVYWDRSDDIT  1083377

Query  124      ITSGYTLDGPCEIWIDNTLA---LAGRNCHTEFP---EGHHTIDYSVCGESCRVSWFW  175
                +  G+   GPCE+W  +  A   + G   +   P        ID S+C E+ R+++FW
Sbjct  1083378  VGEGFVHPGPCEVWCGDNRAHQDMTGDKTYNPPPGKGAAPVPIDKSLCKEATRLTFFW  1083551

 Score = 39.7 bits (91),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (48%), Gaps = 7/69 (10%)
 Frame = +2

Query  287      MDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGI------MRSTGYTHDGPCEVWLDDTR  339
                M +D+   V+  A   CGF+ P+      + D I      + + G+ H GPCE W DD R
Sbjct  1113341  MINDNQVLVSDDATATCGFSSPEKTSYGALNDTIYWGRKDVMTLGFGHPGPCETWCDDKR  1113520

Query  340      VLQHDNCHE  348
                + Q   C E
Sbjct  1113521  IQQDMTCME  1113547

 Score = 39.3 bits (90),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 33/70 (47%), Gaps = 7/70 (10%)
 Frame = -1

Query  287      MDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGI------MRSTGYTHDGPCEVWLDDTR  339
                M +D+   V+  A   CGF+ P+      + D I      + + G+ H GPCE W DD R
Sbjct  1166137  MINDNQVLVSDDATATCGFSSPEKTSYGALNDTIYWGRKDVMTLGFGHPGPCETWCDDKR  1165958

Query  340      VLQHDNCHEV  349
                + Q   C E 
Sbjct  1165957  IQQDMTCMET  1165928

 Score = 38.9 bits (89),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 16/73 (22%)
 Frame = +1

Query  131      DGPCEIWIDNTLALAGRNCHTEFPEGHHTI-------DYSVCGESCRVSWFWLGIKYQGE  183
                +GPCE+W  N       NC       H+T+       D   C  +  ++++W+ +  +  
Sbjct  1284757  EGPCEVWCGNVRTFQDDNC-----PAHYTMVPAVLPFDREACMGATTLTFYWMAMHSE--  1284915

Query  184      RYSWQVFKNCINL  196
                  SWQV+ NC  L
Sbjct  1284916  --SWQVYVNCAPL  1284948

 Score = 38.9 bits (89),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 49/116 (42%), Gaps = 18/116 (16%)
 Frame = +2

Query  89       MDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF--------ITSGYTLDGPCEIWIDN  140
                M +D    V+++    CG + P   +     +  +        +  G+   GPCE W DN
Sbjct  1160306  MINDNQVLVSDDATATCGFSSPEKTSHGALNDTIYWGRNDDITMDEGFVHPGPCETWCDN  1160485

Query  141      TLALAGRNCHTEF--PEGHHT----IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                T       C   +  P G       ID + C ++ R++++W+G+       +WQV+
Sbjct  1160486  TRIQQDMTCMETYNTPSGKGAAPIPIDNAKCTDAKRLTFYWIGM----HGSTWQVY  1160641

 Score = 36.6 bits (83),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 35/71 (49%), Gaps = 7/71 (10%)
 Frame = +3

Query  131      DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                +GPCEIW D+     G +C  ++      +  D+  C  S  ++ +W+ +       +WQ
Sbjct  1057350  EGPCEIWCDDVRVFQGNDCAADYTTAPAKLPYDHDACLGSSVLN-YWMAL----HSSTWQ  1057514

Query  189      VFKNCINLSAS  199
                V+ NC  L ++
Sbjct  1057515  VYVNCAPLEST  1057547

>PHKE:scaffold_399 scf_22126_399.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_399.1:1:32365:1 
REF
Length=32365

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 69/131 (53%), Gaps = 13/131 (10%)
 Frame = +3

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
              +G N  +   F     AN F  L+  MDD S+Y  +      CGFTDP   PQPIP DG 
Sbjct  30729  DGNNPQSVTTFDSLKKANNFVDLKTLMDDTSVYGAD------CGFTDPSGTPQPIPSDGK  30890

Query  320    MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACN-GSCT-LYWYWLGVR  376
                 S    H GPCE+WLD T+    DNC ++   +T+ +DYS+CN G C  + +YWL  +
Sbjct  30891  ATFSRAMQHVGPCEIWLDSTKAFSKDNCADM---ETFPVDYSSCNSGGCKEMRYYWLAFQ  31061

Query  377    YLKQVYSWQVY  387
               L     WQ Y
Sbjct  31062  GLDSKTVWQSY  31094

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 68/137 (50%), Gaps = 16/137 (12%)
 Frame = +1

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DG-  318
              +G N  +   F     AN +  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  28081  DGNNAQSVTAFNALKKANNYVDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPSDGK  28242

Query  319    IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD------LDYSACN-GSCT-LYW  370
                 S    H GPCE+WLDD  V   ++C+     +  D      +DYS+C+ G C  + +
Sbjct  28243  ATYSRAIQHVGPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRF  28422

Query  371    YWLGVRYLKQVYSWQVY  387
              YWL  + +     WQ Y
Sbjct  28423  YWLAFQGVDGKTVWQSY  28473

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 15/120 (13%)
 Frame = +1

Query  80     RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWI  138
                Y  L+ LMDD  +Y        DCG T PN   QPIP++G    S      GPCEIW+
Sbjct  28132  NNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEIWL  28293

Query  139    DNTLALAGRNCHTEFPEGH------HTIDYSVC-GESCR-VSWFWLGIKYQGERYSWQVF  190
              D+ +  +  +C+ ++   +        +DYS C G  C+ + ++WL  +    +  WQ +
Sbjct  28294  DDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSY  28473

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 56/116 (48%), Gaps = 16/116 (14%)
 Frame = +3

Query  80     RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWI  138
                +  L+ LMDD  +Y        DCG T P+   QPIP++G +  +      GPCEIW+
Sbjct  30780  NNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWL  30941

Query  139    DNTLALAGRNC--HTEFPEGHHTIDYSVC--GESCRVSWFWLGIKYQGERYSWQVF  190
              D+T A +  NC     FP     +DYS C  G    + ++WL  +    +  WQ +
Sbjct  30942  DSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSY  31094

 Score = 37.0 bits (84),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 25/56 (45%), Gaps = 7/56 (13%)
 Frame = +2

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
              +G N  +   F     AN +  L+  MD   L +        CGFT+P   PQPIP
Sbjct  25403  DGNNEGSVTAFNSLKSANNYVDLKTLMDSSELGA-------ECGFTNPSGTPQPIP  25549

>PLHA:NW_020187210.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_289, whole genome shotgun sequence
Length=778693

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 86/183 (47%), Gaps = 33/183 (18%)
 Frame = -2

Query  233     MAHQLVILPAPTYTVEGKDN-------RWKPLAFLEGQNFSTTDD-----FVGYLDANGF  280
                AH  +  PAP++  + + +       +WK      G + S+ D+     F     AN F
Sbjct  550221  QAHGYIADPAPSWKGKKRSDWVVEIEPQWK-----GGWDQSSGDEGLLSTFKELATANNF  550057

Query  281     DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDG--IMRSTGYTHDGPCEVWLDDT  338
                 +R+ MD + +Y  +      CG+TDP+  P   P       S G  H GPCE+WLDD 
Sbjct  550056  KDVRSLMDGNPVYGED------CGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWLDDK  549895

Query  339     RVLQHDNCHEVISGKTYD-------LDYSACNG-SCTLYWYWLGVRYLKQVYSWQVYKAC  390
                VLQ+D+C       T +       +DYS+C    C L +YWL ++ L     WQ YK C
Sbjct  549894  MVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAYKNC  549715

Query  391     VPI  393
               +P+
Sbjct  549714  IPL  549706

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (48%), Gaps = 31/183 (17%)
 Frame = -1

Query  233     MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDDFVGYLD-------ANGF  280
                +H  +  P P++  +GK+   + +  +E Q     + +T+D   G LD       AN F
Sbjct  557224  QSHGFIANPPPSWK-KGKNENQEWVVQIEPQWKGDWDKATSDQ--GLLDTFKELGAANNF  557054

Query  281     DSLRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDT  338
                S R+ MD + +Y  +      CG+TDP+  P  P  DG    S    H G CE+W++  
Sbjct  557053  KSARSLMDGNPVYGAD------CGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWINKK  556892

Query  339     RVLQHDNCHEVISGKTYD-------LDYSACNG-SCTLYWYWLGVRYLKQVYSWQVYKAC  390
                VLQ+D+C      K          +DYS+C G  C L +YWL ++ +     WQ YK C
Sbjct  556891  MVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAYKNC  556712

Query  391     VPI  393
               + I
Sbjct  556711  ISI  556703

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 64/128 (50%), Gaps = 15/128 (12%)
 Frame = -2

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDN  140
               +  +R+LMD + +Y        DCG T PN      P+NG +  + G    GPCEIW+D+
Sbjct  550059  FKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWLDD  549898

Query  141     TLALAGRNCHTEFPEGHHT-------IDYSVCG-ESCRVSWFWLGIKYQGERYSWQVFKN  192
                + L   +C   + +G          +DYS C  + C + ++WL ++    +  WQ +KN
Sbjct  549897  KMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAYKN  549718

Query  193     CINLSASA  200
               CI L+  A
Sbjct  549717  CIPLNGPA  549694

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 15/132 (11%)
 Frame = -1

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSG-YTLDGPCEI  136
               A   + + R+LMD + +Y        DCG T PN      P++G+   S      G CEI
Sbjct  557068  AANNFKSARSLMDGNPVYGA------DCGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEI  556907

Query  137     WIDNTLALAGRNCHTEFPEGH-------HTIDYSVC-GESCRVSWFWLGIKYQGERYSWQ  188
               WI+  + L   +C + + +           IDYS C G+ C + ++WL ++  G++  WQ
Sbjct  556906  WINKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQ  556727

Query  189     VFKNCINLSASA  200
                +KNCI++  S+
Sbjct  556726  AYKNCISIKGSS  556691

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (45%), Gaps = 26/150 (17%)
 Frame = -2

Query  233     MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDD-----FVGYLDANGFDS  282
                +H  +  P P++  +GK    + +  +E Q     N +  DD     F     AN F +
Sbjct  560763  QSHGFIANPPPSWK-KGKTGNEEWIVQIEPQWKGDWNKARNDDEFLATFKQIAAANNFKN  560587

Query  283     LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
                R+ +D D +Y  +      CG+TDP+  P  P  DG    S G  H G CEVW+D+   
Sbjct  560586  ARSLLDSDPVYGAD------CGYTDPNGTPVDPPSDGTATFSRGIAHVGRCEVWIDEKIA  560425

Query  341     LQHDNCHEVISGKTYD-------LDYSACN  363
               LQ D+C       T +       +DYS C+
Sbjct  560424  LQKDDCQAAFGNGTIEYKSVLKPIDYSLCD  560335

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 43/96 (45%), Gaps = 14/96 (15%)
 Frame = -2

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
               A   +   R+L+D D +Y        DCG T PN      P++G+   S G    G CE+
Sbjct  560607  AANNFKNARSLLDSDPVYGA------DCGYTDPNGTPVDPPSDGTATFSRGIAHVGRCEV  560446

Query  137     WIDNTLALAGRNCHTEFPEGH-------HTIDYSVC  165
               WID  +AL   +C   F  G          IDYS+C
Sbjct  560445  WIDEKIALQKDDCQAAFGNGTIEYKSVLKPIDYSLC  560338

>PHRA:scaffold_418
Length=13567

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 60/108 (56%), Gaps = 18/108 (17%)
 Frame = +1

Query  300    DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
              D +CG+T  D  PQPIP DG ++       G+TH GPCE+++DDT VL  D+C E   G 
Sbjct  12490  DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  12669

Query  353    -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                         +DYS+CNG CTL  YWL  +  +    WQ Y  CVP+
Sbjct  12670  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  12801

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (48%), Gaps = 17/117 (15%)
 Frame = +1

Query  105    CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
              CG T  + + QPIPT+G          G+T  GPCEI+ID+T+ L G +C  E+P G   
Sbjct  12499  CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  12678

Query  157    -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGLQ  208
                      +DYS C   C ++ +WL      +   WQ + NC+ L  S   T    Q
Sbjct  12679  SNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVPLKGSGSATQTQTQ  12837

>PHCA:scaffold_50 PHYCAscaffold_50
Length=475612

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 73/141 (52%), Gaps = 18/141 (13%)
 Frame = +3

Query  262     GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR  321
               G     T +F   + A+ + SL+ FM+D  +  VN      CG+T+P  APQP+P   + 
Sbjct  150954  GSPADNTANFNKGMAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVE  151130

Query  322     -----STGYT--HDGPCEVWLDDTRVLQHDNCHE---VISGKT-YDLDYSACNGSCTLYW  370
                      G+T  H+GPCEVW DDTRV Q DNC +   +I  K  YD D  AC GS  L  
Sbjct  151131  WSHGDGEGFTQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRD--ACLGSSQLTI  151304

Query  371     YWLGVRYLKQVYSWQVYKACV  391
               YW+ +       SWQVY  C 
Sbjct  151305  YWIALHSP----SWQVYINCA  151355

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 71/143 (50%), Gaps = 19/143 (13%)
 Frame = -3

Query  264    NFSTTDDFVGYLDA---NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM  320
              N +  D+   Y  A   + + SL+    D +  +V+  A   CG  DP   PQP+P+ I+
Sbjct  97250  NGAPKDNVAAYTKAFASSKYKSLKDLFTDKAKITVSG-ATLTCGSCDPKEEPQPMPESIV  97074

Query  321    R-----STGYT--HDGPCEVWLDDTRVLQHDNCHE---VISGKTYDLDYSACNGSCTLYW  370
                    S G+T  H+GPCEVW DD R  Q DNC     ++  K    D  AC G+ TL +
Sbjct  97073  EWSHSDSEGFTPSHEGPCEVWCDDVRTFQDDNCATNFPMVPAK-MPFDREACMGASTLTF  96897

Query  371    YWLGVRYLKQVYSWQVYKACVPI  393
              YW+ +       +WQVY  C P+
Sbjct  96896  YWMAMHS----DTWQVYVNCAPL  96840

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 73/139 (53%), Gaps = 22/139 (16%)
 Frame = +2

Query  268     TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIMR----  321
               T  F    +A+ + SL+  ++D  L  V +S DF   CG+T+PD  PQP+P+  +     
Sbjct  149663  TAAFTKGFEASKYKSLKEVIND--LGKVTSS-DFTMECGYTNPDETPQPLPETYVEWAHG  149833

Query  322     -STGYT--HDGPCEVWLDDTRVLQHDNC---HEVISGKT-YDLDYSACNGSCTLYWYWLG  374
                  G+T  H+GPCEVW DD RV Q DNC   +     K  YD D  AC G+  L +YWL 
Sbjct  149834  SGEGFTPSHEGPCEVWCDDVRVFQDDNCAANYPTAPAKVPYDRD--ACLGASRLTFYWLA  150007

Query  375     VRYLKQVYSWQVYKACVPI  393
               +       +WQVY  C  +
Sbjct  150008  L----HSSTWQVYTNCAAL  150052

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -3

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDD----  290
               H  +  PA T+     DN  + +A +E      +  F G    N     +AF        
Sbjct  154259  HGYMTEPAVTFLSSSTDNT-QFIATIESSASKFSGTFSGSPADNTAAFTKAFASSSYTSL  154083

Query  291     -----SLYSVNAS-ADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLDD  337
                    SL +V  + A   CG  +PD   QP+PD  +      + G+T  H+GPCEVW DD
Sbjct  154082  KDLITSLATVTVTDATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEGPCEVWCDD  153903

Query  338     TRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                RV Q D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  153902  VRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYVNCAPL  153741

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 14/132 (11%)
 Frame = -1

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGY  325
               F    +++ + SL+  ++D +  +V   A   CG  DPD   Q +P   +      S G+
Sbjct  152731  FTTAFESSSYSSLKELINDKATITVT-DATLTCGACDPDETAQALPATYVEWAHSDSEGF  152555

Query  326     T--HDGPCEVWLDDTRVLQHDNCHE--VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
               T  H+GPCEVW DD RV Q D+C      +      D+ AC GS  L +YWL +      
Sbjct  152554  TASHEGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLAL----HS  152387

Query  382     YSWQVYKACVPI  393
                +WQVY  C P+
Sbjct  152386  STWQVYVNCAPL  152351

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  266     STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MR  321
               + T+ F    +++ + S++ F+ D      N  A   CG TDP+  PQ +P  +      
Sbjct  147088  ANTEAFWAAFNSSKYSSIKDFVTDKGQIVANG-ATIECGLTDPNETPQSLPAELEWTHSD  147264

Query  322     STGYT--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRY  377
               + G+T  H+GPCE W DDT+V Q  NC  H   +      D + C+GS  L +YWL +  
Sbjct  147265  TEGFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALHS  147444

Query  378     LKQVYSWQVYKACVPI  393
                    +WQ+Y  C  +
Sbjct  147445  ----STWQIYVNCAAL  147480

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 62/125 (50%), Gaps = 13/125 (10%)
 Frame = -2

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT  326
               F     A+ + SL+A +DD +  +V   A   CG  DP+   QP+P  +      S G+T
Sbjct  100182  FTKAFKASSYKSLKALIDDKAKVTVTG-ATLTCGSADPNGPAQPLPATLEWSHSDSEGFT  100006

Query  327     --HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
                 H+GPCE W DDT V   +NC         ++ Y  S C+G+  L +YW+ +       
Sbjct  100005  PSHEGPCEAWCDDTMVFNDENCAANFKTAPAEMPYEKSKCSGASKLTFYWMAMHGP----  99838

Query  383     SWQVY  387
               +WQVY
Sbjct  99837   TWQVY  99823

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 81/180 (45%), Gaps = 28/180 (16%)
 Frame = -1

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
               H  +  PA T+     DN  + +A +E           G     T  F     ++ + SL
Sbjct  143044  HGYMTDPAVTFLSSSTDNT-QFIATIESSASGFSGTFSGSPADNTAAFTTAFASSSYTSL  142868

Query  284     RAFMDDDSLYSVNAS-ADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWL  335
               +  +   SL +V  + A   CG  DP    Q +P   +      S G+T  H+GPCEVW 
Sbjct  142867  KDLIT--SLATVTVTDATLTCGSCDPGETAQALPATYVEWSHSSSEGFTSSHEGPCEVWC  142694

Query  336     DDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               DDTRV Q D+C    +    +L Y   AC GS TL +YWL +       +WQVY  C P+
Sbjct  142693  DDTRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH----SSTWQVYVNCAPL  142526

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 80/171 (47%), Gaps = 21/171 (12%)
 Frame = +1

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               +GL +GQ  L  P     DGM Y G+P    E     TA  A      + Y++L+ L D 
Sbjct  139228  AGLIDGQDYLPVP-----DGMSYGGTPEGNTE--AYWTAFNAS-----KKYSSLKDLADK  139371

Query  92      DG-LYSVTEEG--LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRN  148
                  L S++  G    +CG + PN   + +P    +   GY+  GPCE+W D+ LA +  N
Sbjct  139372  TMVLQSLSPFGKATKECGFSLPNGTARALPAKVQWKDFGYSHQGPCEVWCDDKLAFSDTN  139551

Query  149     CHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
               C   +PE    + Y   VC  +  +  +W+ +        WQ++ NC+ LS
Sbjct  139552  CALHYPEVPANLPYDVDVCTGAKMMQSYWIAL----HGLPWQLYLNCVRLS  139692

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 78/181 (43%), Gaps = 28/181 (15%)
 Frame = +3

Query  234     AHQLVILPAPTY-----------TVEGKDNRWKPLAF-LEGQNFSTTDDFVGYLDANGFD  281
               AH  + LP PT+           T++G      P     EG   S T  +    +A+ + 
Sbjct  114471  AHSKMSLPKPTWVYEDGTNSPAGTIDGASVLPAPTGMGYEGDPLSNTKAYWTAFNASKYT  114650

Query  282     SLRAFM------DDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT-HDGPCEVW  334
               SL+  +      + DSLY    +A   CG++  +   + +PD +      T HDGPCE+W
Sbjct  114651  SLKELVWKNEVVNTDSLY---GTATIECGYSWTNGTARDLPDEVQWDKLTTGHDGPCEIW  114821

Query  335     LDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
                DDT V    NC  +   S  ++  D +AC G   L   WL +        WQV+  C P
Sbjct  114822  CDDTLVFSDQNCAVNYPDSPASFPYDKAACEGKSMLTTIWLALHSPP----WQVFTNCAP  114989

Query  393     I  393
               +
Sbjct  114990  L  114992

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 76/160 (48%), Gaps = 22/160 (14%)
 Frame = -2

Query  48     VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDG-LYSVTEEGL--FD  104
              V DGM Y  +P   L  +   TA        E  Y +L+ L+D  G L +++  G    +
Sbjct  95367  VPDGMSYSTAP--ELNTEAYWTAFN------ESSYTSLKDLVDKTGELQTLSPFGTATLE  95212

Query  105    CGLTFPNTETQPIPTN---GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--  159
              CG +  N   + +P+     + +T G+  DGPCE+W D+ LA    NC   +PE      
Sbjct  95211  CGFSLANGTARDLPSEYVEWNQLTEGH--DGPCEVWCDDVLAFEDDNCAVNYPENPSQWP  95038

Query  160    IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
               D S C  + R++ +W+ +        WQV+ NC+ L+ S
Sbjct  95037  YDVSKCQGASRLTAYWIALH----GLPWQVYINCVPLTGS  94930

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 79/181 (44%), Gaps = 27/181 (15%)
 Frame = -2

Query  234    AHQLVILPAPTYTVEGKDNRWKP-------LAFLEGQNFST-----TDDFVGYLDANGFD  281
              AH  +I P PT+ V    N +         L   +G ++ST     T+ +    + + + 
Sbjct  95463  AHSYMIDPMPTWPVSWATNNFAATIAGQTYLPVPDGMSYSTAPELNTEAYWTAFNESSYT  95284

Query  282    SLRAFMDDD---SLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT--HDGPCEVWLD  336
              SL+  +D        S   +A   CGF+  +   + +P   +     T  HDGPCEVW D
Sbjct  95283  SLKDLVDKTGELQTLSPFGTATLECGFSLANGTARDLPSEYVEWNQLTEGHDGPCEVWCD  95104

Query  337    DTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
              D    + DNC     E  S   YD+  S C G+  L  YW+ +  L     WQVY  CVP
Sbjct  95103  DVLAFEDDNCAVNYPENPSQWPYDV--SKCQGASRLTAYWIALHGLP----WQVYINCVP  94942

Query  393    I  393
              +
Sbjct  94941  L  94939

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 76/169 (45%), Gaps = 20/169 (12%)
 Frame = +3

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               +G  +G  VL  P      GM Y G P++    +   TA  A  + + +       +++ 
Sbjct  114534  AGTIDGASVLPAP-----TGMGYEGDPLS--NTKAYWTAFNASKYTSLKELVWKNEVVNT  114692

Query  92      DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF--ITSGYTLDGPCEIWIDNTLALAGRNC  149
               D LY        +CG ++ N   + +P    +  +T+G+  DGPCEIW D+TL  + +NC
Sbjct  114693  DSLYGT---ATIECGYSWTNGTARDLPDEVQWDKLTTGH--DGPCEIWCDDTLVFSDQNC  114857

Query  150     HTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                  +P+   +  Y  + C     ++  WL +        WQVF NC  L
Sbjct  114858  AVNYPDSPASFPYDKAACEGKSMLTTIWLAL----HSPPWQVFTNCAPL  114992

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 76/181 (42%), Gaps = 31/181 (17%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY---------------LDAN  278
               AH  +  P PT++V      +  L  ++GQ++    D + Y                 + 
Sbjct  139165  AHSYMTDPMPTWSVGYPTTNYAGL--IDGQDYLPVPDGMSYGGTPEGNTEAYWTAFNASK  139338

Query  279     GFDSLRAFMDDDSLY---SVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVW  334
                + SL+   D   +    S    A   CGF+ P+   + +P  +  +  GY+H GPCEVW
Sbjct  139339  KYSSLKDLADKTMVLQSLSPFGKATKECGFSLPNGTARALPAKVQWKDFGYSHQGPCEVW  139518

Query  335     LDDTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
                DD       NC     EV +   YD+D   C G+  +  YW+ +  L     WQ+Y  C
Sbjct  139519  CDDKLAFSDTNCALHYPEVPANLPYDVD--VCTGAKMMQSYWIALHGLP----WQLYLNC  139680

Query  391     V  391
               V
Sbjct  139681  V  139683

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 58/130 (45%), Gaps = 17/130 (13%)
 Frame = +3

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------NGSFITSGY  128
               +A   Y +L+  M+D  +  V +E   +CG T P    QP+P         +G   T  +
Sbjct  150993  MAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSH  151169

Query  129     TLDGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
                 +GPCE+W D+T      NC   FP        D   C  S +++ +W+ +       S
Sbjct  151170  --EGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIAL----HSPS  151331

Query  187     WQVFKNCINL  196
               WQV+ NC  L
Sbjct  151332  WQVYINCAAL  151361

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 60/131 (46%), Gaps = 9/131 (7%)
 Frame = +3

Query  266     STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRST-G  324
               S T  +    +A+ + SL+    D    ++  SA   CGF+  D   + +PD +      
Sbjct  112890  SNTKAYWTAFNASKYTSLKELSWD--AQTLEGSATNECGFSIVDGTARELPDEVQWDFFT  113063

Query  325     YTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
                +H GPCEVW DDT V +  NC         +L Y  + C+G+  L  YW+ +       
Sbjct  113064  ASHQGPCEVWCDDTLVFEDWNCAVTYPETPANLPYDKAKCSGASMLTSYWIALH----TT  113231

Query  383     SWQVYKACVPI  393
                WQVY  C P+
Sbjct  113232  PWQVYTNCAPL  113264

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 57/132 (43%), Gaps = 20/132 (15%)
 Frame = -2

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPI---------PDGIMR  321
               F+ +   + + +L+  + D  +  V+      CGFT PD                D I +
Sbjct  141222  FLEHFKKSKYKTLKDMIVDKQVL-VSGGPTASCGFTVPDQTSYGALNDTVYWGRSDDITK  141046

Query  322     STGYTHDGPCEVWLDDTRVLQHDNCHEV------ISGKTYDLDYSACNGSCTLYWYWLGV  375
                 G+ H GPCEVW DD R  Q +NC E       +      +D S C  +  L +YW+G+
Sbjct  141045  DQGFVHPGPCEVWCDDNRAQQDNNCMETYNNAGNVGAAPVPIDKSVCTDAKRLTFYWIGM  140866

Query  376     RYLKQVYSWQVY  387
                      +WQVY
Sbjct  140865  HGP----TWQVY  140842

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 58/118 (49%), Gaps = 12/118 (10%)
 Frame = -2

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--DGPCEI  136
               Y +L+AL+DD    +VT   L  CG   PN   QP+P    +  S   G+T   +GPCE 
Sbjct  100155  YKSLKALIDDKAKVTVTGATL-TCGSADPNGPAQPLPATLEWSHSDSEGFTPSHEGPCEA  99979

Query  137     WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
               W D+T+     NC   F      + Y  S C  + +++++W+ +       +WQV+ N
Sbjct  99978   WCDDTMVFNDENCAANFKTAPAEMPYEKSKCSGASKLTFYWMAM----HGPTWQVYVN  99817

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 58/125 (46%), Gaps = 12/125 (10%)
 Frame = +1

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEI  136
               Y++++  + D G   V      +CGLT PN   Q +P    +    T G+T   +GPCE 
Sbjct  147130  YSSIKDFVTDKGQI-VANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEA  147306

Query  137     WIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
               W D+T      NC   F      +  D + C  S R++++WL +       +WQ++ NC 
Sbjct  147307  WCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH----SSTWQIYVNCA  147474

Query  195     NLSAS  199
                L  S
Sbjct  147475  ALEGS  147489

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 60/123 (49%), Gaps = 13/123 (11%)
 Frame = +2

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP------TNGSFITSGYTLDGPCE  135
               Y +L+ +++D G  + ++  + +CG T P+   QP+P       +GS      + +GPCE
Sbjct  149699  YKSLKEVINDLGKVTSSDFTM-ECGYTNPDETPQPLPETYVEWAHGSGEGFTPSHEGPCE  149875

Query  136     IWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               +W D+       NC   +P     + Y    C  + R++++WL +       +WQV+ NC
Sbjct  149876  VWCDDVRVFQDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLAL----HSSTWQVYTNC  150043

Query  194     INL  196
                 L
Sbjct  150044  AAL  150052

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 56/128 (44%), Gaps = 13/128 (10%)
 Frame = -3

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--  130
               A   Y +L+ L  D    +V+   L  CG   P  E QP+P +        + G+T   
Sbjct  97208  FASSKYKSLKDLFTDKAKITVSGATLT-CGSCDPKEEPQPMPESIVEWSHSDSEGFTPSH  97032

Query  131    DGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
              +GPCE+W D+       NC T FP        D   C  +  ++++W+ +       +WQ
Sbjct  97031  EGPCEVWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMHSD----TWQ  96864

Query  189    VFKNCINL  196
              V+ NC  L
Sbjct  96863  VYVNCAPL  96840

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 62/133 (47%), Gaps = 13/133 (10%)
 Frame = -1

Query  75      TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
               T      Y++L+ L++D    +VT+  L  CG   P+   Q +P          + G+T 
Sbjct  152725  TAFESSSYSSLKELINDKATITVTDATL-TCGACDPDETAQALPATYVEWAHSDSEGFTA  152549

Query  131     --DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYS  186
                 +GPCE+W D+     G +C  ++      +  D+  C  S  ++++WL +       +
Sbjct  152548  SHEGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLAL----HSST  152381

Query  187     WQVFKNCINLSAS  199
               WQV+ NC  L ++
Sbjct  152380  WQVYVNCAPLEST  152342

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 46/99 (46%), Gaps = 7/99 (7%)
 Frame = +2

Query  298     SADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD  356
               +A   CGF+  +   + +P  +       +H+GPCEVW DDT V +  NC    +     
Sbjct  136187  TATAECGFSLANGTARALPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAK  136366

Query  357     LDYSA--CNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               L Y A  C G+  L   WL +      + WQVY  C P+
Sbjct  136367  LPYDASKCEGASMLTSIWLAL----HAHPWQVYTNCAPL  136471

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 43/93 (46%), Gaps = 7/93 (8%)
 Frame = +2

Query  304     GFTDPDAAPQPIPDGIMRST-GYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--S  360
               GF+  D   Q +P  +       +H GPCEVW DDT V ++ NC          L Y  S
Sbjct  108659  GFSTVDGKAQALPAQVEWDFFTASHQGPCEVWCDDTLVFENYNCAVDYPDTPAKLPYDKS  108838

Query  361     ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                C+G+  L  YW+ +        WQVY  C P+
Sbjct  108839  KCSGASMLTSYWIALHSTP----WQVYTNCAPL  108925

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 58/131 (44%), Gaps = 13/131 (10%)
 Frame = -3

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--  130
                A   Y +L+ L+      +VT+  L  CG   P+   QP+P          T G+T   
Sbjct  154109  FASSSYTSLKDLITSLATVTVTDATL-TCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSH  153933

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQ  188
               +GPCE+W D+       +C  ++      + Y    C  +  ++++WL +       +WQ
Sbjct  153932  EGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQ  153765

Query  189     VFKNCINLSAS  199
               V+ NC  L ++
Sbjct  153764  VYVNCAPLEST  153732

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +2

Query  106     GLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--S  163
               G +  + + Q +P    +     +  GPCE+W D+TL     NC  ++P+    + Y  S
Sbjct  108659  GFSTVDGKAQALPAQVEWDFFTASHQGPCEVWCDDTLVFENYNCAVDYPDTPAKLPYDKS  108838

Query  164     VCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
                C  +  ++ +W+ +        WQV+ NC  LS  +  T
Sbjct  108839  KCSGASMLTSYWIAL----HSTPWQVYTNCAPLSGGSSTT  108946

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 63/153 (41%), Gaps = 20/153 (13%)
 Frame = +3

Query  48      VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGL  107
               V  GM Y   P +    +   TA  A        Y +L+ L  D    ++      +CG 
Sbjct  112854  VPSGMSYNTDPAS--NTKAYWTAFNA------SKYTSLKELSWD--AQTLEGSATNECGF  113003

Query  108     TFPNTETQPIP--TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--S  163
               +  +   + +P      F T+ +   GPCE+W D+TL     NC   +PE    + Y  +
Sbjct  113004  SIVDGTARELPDEVQWDFFTASH--QGPCEVWCDDTLVFEDWNCAVTYPETPANLPYDKA  113177

Query  164     VCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                C  +  ++ +W+ +        WQV+ NC  L
Sbjct  113178  KCSGASMLTSYWIAL----HTTPWQVYTNCAPL  113264

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (46%), Gaps = 6/96 (6%)
 Frame = +2

Query  104     DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY-  162
               +CG +  N   + +P    +     + +GPCE+W D+TL     NC  ++      + Y 
Sbjct  136199  ECGFSLANGTARALPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAKLPYD  136378

Query  163     -SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                S C  +  ++  WL +      + WQV+ NC  L+
Sbjct  136379  ASKCEGASMLTSIWLALH----AHPWQVYTNCAPLT  136474

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 13/130 (10%)
 Frame = -1

Query  75      TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
               T  A   Y +L+ L+      +VT+  L  CG   P    Q +P          + G+T 
Sbjct  142900  TAFASSSYTSLKDLITSLATVTVTDATL-TCGSCDPGETAQALPATYVEWSHSSSEGFTS  142724

Query  131     --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
                 +GPCE+W D+T      +C  ++      + Y    C  S  ++++WL +       +
Sbjct  142723  SHEGPCEVWCDDTRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLAL----HSST  142556

Query  187     WQVFKNCINL  196
               WQV+ NC  L
Sbjct  142555  WQVYVNCAPL  142526

 Score = 45.1 bits (105),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/142 (25%), Positives = 64/142 (45%), Gaps = 22/142 (15%)
 Frame = -2

Query  70      AIEAQTWL---AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF---  123
               AI  +++L    +  Y TL+ ++ D  +  V+      CG T P+  +     +  +   
Sbjct  141240  AINIKSFLEHFKKSKYKTLKDMIVDKQVL-VSGGPTASCGFTVPDQTSYGALNDTVYWGR  141064

Query  124     ---ITS--GYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT------IDYSVCGESCRVS  172
                  IT   G+   GPCE+W D+  A    NC   +    +       ID SVC ++ R++
Sbjct  141063  SDDITKDQGFVHPGPCEVWCDDNRAQQDNNCMETYNNAGNVGAAPVPIDKSVCTDAKRLT  140884

Query  173     WFWLGIKYQGERYSWQVFKNCI  194
               ++W+G+       +WQV+   +
Sbjct  140883  FYWIGM----HGPTWQVYSKLL  140830

>PHPA:scaffold_4 NW_008648990.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.4, whole genome shotgun 
sequence
Length=2787191

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 88/179 (49%), Gaps = 25/179 (14%)
 Frame = +3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQ--------NFSTTDDFVGYLDA---NGFDS  282
               AH  +  PA T++ E  D + + +A +E          N +  D+   +  A   + + S
Sbjct  552477  AHGWLSKPAATFSNEAGD-KSQFIATIEASSSGFKGTFNTAPADNVASFTKAFATSTYKS  552653

Query  283     LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT--HDGPCEVWLD  336
               L+AF+DD +  +V   A   CG  +PDA  QP+PD +      S G+T  H+GPCE W D
Sbjct  552654  LKAFIDDKAKITVTG-ATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEAWCD  552830

Query  337     DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 RV   +NC         ++ Y  S C+G+ TL +YW+ +       +WQVY  C P+
Sbjct  552831  SERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMHGP----TWQVYVNCAPL  552995

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 87/181 (48%), Gaps = 31/181 (17%)
 Frame = -3

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLEGQ------NF--STTDDFVGY---LDANGFDSL  283
               H  + +P   +T  G   ++  +A +E        NF  S TD+   +     A+ + SL
Sbjct  493827  HGYMSVPKVEFTFNGDTTQY--MATIEASSSGFSGNFGQSPTDNTANFNKGFAASKYSSL  493654

Query  284     RAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVW  334
               + FM D  +     S DF   CG+T+PD  PQP+P+  +        G+T  H+GPCEVW
Sbjct  493653  KEFMTDKMVL---VSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCEVW  493483

Query  335     LDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
                DDTRV Q DNC +        L  D+ AC GS  L  YW+ +       SWQVY  C  
Sbjct  493482  CDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALHSP----SWQVYINCAA  493315

Query  393     I  393
               +
Sbjct  493314  L  493312

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 13/131 (10%)
 Frame = +1

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT  326
               F    +++ + SL+A +DD +   V   A   CG  DP A PQP+P  +      S G+T
Sbjct  539191  FTKAFESSKYKSLKAVIDDKAKIIVPG-ATLTCGIADPKATPQPLPAKVEWYHSESEGFT  539367

Query  327     --HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
                 H+GPCEVW D  RV   DNC    +    +L Y  S C G+  L  YW+ +       
Sbjct  539368  ATHEGPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMHGP----  539535

Query  383     SWQVYKACVPI  393
               SWQVY  C P+
Sbjct  539536  SWQVYVNCAPL  539568

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 71/143 (50%), Gaps = 14/143 (10%)
 Frame = +2

Query  260     LEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI  319
                 G     T  F    +++ F SL+  +++ +  +V+  A   CG  DPD   QP+PD  
Sbjct  491888  FNGAPADNTAAFTKAFESSSFSSLKELINEKATLTVS-DATLTCGSCDPDETAQPLPDTY  492064

Query  320     MR-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYW  370
               +      S G+T  H+GPCE+W DD RV Q D+C    +     L  D+ AC GS  L +
Sbjct  492065  VEWAHSDSEGFTASHEGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTF  492244

Query  371     YWLGVRYLKQVYSWQVYKACVPI  393
               YWL +       +WQVY  C P+
Sbjct  492245  YWLAL----HSSTWQVYVNCAPL  492301

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 14/132 (11%)
 Frame = +2

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGY  325
               F     ++ + SL+ ++ D +   V+  A   CG  DP   PQP+P   +      S G+
Sbjct  566579  FTKAFTSSKYKSLKEYVTDKAKIIVSG-ATLTCGSCDPKQEPQPMPKSTVEWSHSDSEGF  566755

Query  326     T--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
               T  H+GPCEVW DD R  Q D+C  H  +       D  AC G+ TL +YW+ +      
Sbjct  566756  TPSHEGPCEVWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAM----HS  566923

Query  382     YSWQVYKACVPI  393
                SWQVY  C P+
Sbjct  566924  SSWQVYVNCAPL  566959

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 81/179 (45%), Gaps = 26/179 (15%)
 Frame = +3

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
               H  +  PA T+     DN  + +A +E           G     T  F    + + + SL
Sbjct  502485  HGYLTDPAVTFLSSSTDNT-QFIATIESSASGFSGTFSGSPADNTAAFTTAFEVSSYTSL  502661

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
               +  ++  +  +V   A   CG  DPD   QP+P+  +      S G+T  H+GPCEVW D
Sbjct  502662  KELINALATITVT-DATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCEVWCD  502838

Query  337     DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D R  Q D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  502839  DVRAFQDDDCAAHYTSTPAELPYDRDACLGTSTLTFYWLALH----SSTWQVYINCAPL  503003

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 13/136 (10%)
 Frame = -3

Query  266     STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MR  321
               + T+ F     ++ F S++ F+ D     V   A+ +CG T+PD   QP+PD I      
Sbjct  498246  ANTEAFWTAFKSSKFTSIKEFVTDLGQV-VAIGANLQCGLTNPDETAQPLPDEIEWTHSD  498070

Query  322     STGYT--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRY  377
               + G+T  H+GPCE W D T+V Q  NC  H   +      D + C+G+  L +YWL +  
Sbjct  498069  TEGFTSSHEGPCEAWCDGTQVFQDTNCAAHFTTAPAKMPYDKAGCSGANRLTFYWLALHS  497890

Query  378     LKQVYSWQVYKACVPI  393
                    +WQVY  C  +
Sbjct  497889  ----STWQVYVNCAAL  497854

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 83/182 (46%), Gaps = 30/182 (16%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANG  279
               AH  +  P PT++V      +  L  ++GQ++    D + Y               +A+ 
Sbjct  506712  AHSYMSDPMPTWSVGYPTTNYAGL--IDGQDYLPVPDGMSYGGTPEGNTEAYWTAFNASK  506539

Query  280     FDSLRAFMDDDS-LYSVN--ASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
               + SL+   D    L S+N    A   CGF+ P+ + + +P  +  +  GY+H GPCEVW 
Sbjct  506538  YTSLKDLADKTMVLQSLNPFGKATKECGFSIPNGSKRNLPAQVQWKDFGYSHQGPCEVWC  506359

Query  336     DDTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               DD       NC     EV +   YD+D   C G+  +  YW+ +  L     WQ+Y  CV
Sbjct  506358  DDKLAFMDTNCALHYPEVPAFLPYDID--VCIGAKMIQSYWIALHGLP----WQLYLNCV  506197

Query  392     PI  393
               P+
Sbjct  506196  PL  506191

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 80/179 (45%), Gaps = 23/179 (13%)
 Frame = +3

Query  234     AHQLVILPAPTYTVEGKDNRWKP-------LAFLEGQNFST-----TDDFVGYLDANGFD  281
               AH  +I P PT+ V    N +         L   +G ++ST     T+ +    + + + 
Sbjct  568509  AHSYMIDPMPTWPVSWATNNFAATIAGQTYLPVPDGMSYSTAPELNTEAYWTAFNESSYT  568688

Query  282     SLRAFMD---DDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT--HDGPCEVWLD  336
               SL+  +D   +    S   +A   CGF+  +   + +P   +     T  HDGPCEVW D
Sbjct  568689  SLKDLVDKTGEVQTLSPFGTATLECGFSLANGTARDLPSEYVEWNQLTEGHDGPCEVWCD  568868

Query  337     DTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D    + DNC  +   S   +  D S C+G+  L  YW+ +  L     WQVY  CVP+
Sbjct  568869  DVLAFEDDNCAVNYPESPSKWPYDVSKCSGASRLTAYWIALHGLP----WQVYINCVPL  569033

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 75/180 (42%), Gaps = 26/180 (14%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANG  279
               AH  +ILP PT+ V    N   P   +EG  +    D + Y               +A+ 
Sbjct  509631  AHSYMILPLPTWPVSWGTN--SPSGLIEGDTYLPVPDGMSYSTDPYDNTEAYWAAFNASS  509458

Query  280     FDSLRAFMDDDSLYSVNAS---ADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
               + SL  F  +  +    A+   A   CGF+  +   + +P  +       +H+GPCEV  
Sbjct  509457  YTSLLEFAKETQVLQTMATFGTATAECGFSLANGTARALPAEVEWNQLTSSHEGPCEV*C  509278

Query  336     DDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               DDTRV +  NC    +     L  D S C G+  L   WL +  L     WQVY  C P+
Sbjct  509277  DDTRVFEDWNCALDYTSDPAKLPYDVSKCEGASMLTSIWLALHALP----WQVYTNCAPL  509110

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 71/153 (46%), Gaps = 15/153 (10%)
 Frame = -1

Query  48      VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGL  107
               V DGM Y G P++  E     TA  A  + + +       +++ D LY        +CG 
Sbjct  511106  VPDGMGYEGDPLSNTE--AYWTAFNASKYTSLKELVWENEVVNTDSLYGT---ATIECGY  510942

Query  108     TFPNTETQPIPTNGSF--ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--S  163
               ++ N   + +P    +  +T+G+  DGPCEIW D+TL  + +NC   +P+   +  Y  +
Sbjct  510941  SWTNGTARDLPDEVQWDKLTTGH--DGPCEIWCDDTLVFSDQNCAVNYPDSPASFPYDKA  510768

Query  164     VCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                C     ++  WL +        WQVF NC  L
Sbjct  510767  ACEGKSMLTAIWLAL----HSPPWQVFTNCAPL  510681

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 77/182 (42%), Gaps = 32/182 (18%)
 Frame = -1

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANGF  280
               H  + LP PT+  E   N   P   ++  N     D +GY               +A+ +
Sbjct  511199  HSKMSLPKPTWVYEEGTNS--PAGTVDSSNVLPVPDGMGYEGDPLSNTEAYWTAFNASKY  511026

Query  281     DSLRAFM------DDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT-HDGPCEV  333
                SL+  +      + DSLY    +A   CG++  +   + +PD +      T HDGPCE+
Sbjct  511025  TSLKELVWENEVVNTDSLY---GTATIECGYSWTNGTARDLPDEVQWDKLTTGHDGPCEI  510855

Query  334     WLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               W DDT V    NC  +   S  ++  D +AC G   L   WL +        WQV+  C 
Sbjct  510854  WCDDTLVFSDQNCAVNYPDSPASFPYDKAACEGKSMLTAIWLALHSPP----WQVFTNCA  510687

Query  392     PI  393
               P+
Sbjct  510686  PL  510681

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 13/128 (10%)
 Frame = -3

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP------TNGSFITSGYTL  130
                A   Y++L+  M D  +  V+++   +CG T P+   QP+P      ++GS      + 
Sbjct  493680  FAASKYSSLKEFMTDK-MVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASH  493504

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               +GPCE+W D+T      NC   FP     +  D+  C  S R+S +W+ +       SWQ
Sbjct  493503  EGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL----HSPSWQ  493336

Query  189     VFKNCINL  196
               V+ NC  L
Sbjct  493335  VYINCAAL  493312

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 78/176 (44%), Gaps = 22/176 (13%)
 Frame = -2

Query  234     AHQLVILPAPTY--------TVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDANGF  280
               AH  + LP PT+        +  G  +    L    G +++T     T+ +    +A+ +
Sbjct  512905  AHNKMTLPLPTWADGFYSQNSPSGTIDPSDVLPVPSGMSYNTDPASNTNAYWTAFNASKY  512726

Query  281     DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRST-GYTHDGPCEVWLDDTR  339
                SL+    D    ++  +A   CGF+  D  P+ +PD +       +H GPCEVW DDT 
Sbjct  512725  KSLKELAWD--AQTLEGTASNECGFSLVDGTPRDLPDEVQWDFFTASHQGPCEVWCDDTL  512552

Query  340     VLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               V ++ NC         +L Y  + C GS  L  YW+ +        WQVY  C P+
Sbjct  512551  VFENWNCAVDYPETPANLPYDKAKCKGSSVLTSYWIALH----TTPWQVYTNCAPL  512396

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 71/160 (44%), Gaps = 22/160 (14%)
 Frame = +3

Query  48      VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE---EGLFD  104
               V DGM Y  +P   L  +   TA        E  Y +L+ L+D  G             +
Sbjct  568605  VPDGMSYSTAP--ELNTEAYWTAFN------ESSYTSLKDLVDKTGEVQTLSPFGTATLE  568760

Query  105     CGLTFPNTETQPIPTN---GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--  159
               CG +  N   + +P+     + +T G+  DGPCE+W D+ LA    NC   +PE      
Sbjct  568761  CGFSLANGTARDLPSEYVEWNQLTEGH--DGPCEVWCDDVLAFEDDNCAVNYPESPSKWP  568934

Query  160     IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                D S C  + R++ +W+ +        WQV+ NC+ L+ S
Sbjct  568935  YDVSKCSGASRLTAYWIALH----GLPWQVYINCVPLTGS  569042

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 73/168 (43%), Gaps = 16/168 (10%)
 Frame = -3

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               +GL +GQ  L  P     DGM Y G+P    E     TA  A  + + +  A    ++  
Sbjct  506649  AGLIDGQDYLPVP-----DGMSYGGTPEGNTE--AYWTAFNASKYTSLKDLADKTMVLQS  506491

Query  92      DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
                  +    +   +CG + PN   + +P    +   GY+  GPCE+W D+ LA    NC  
Sbjct  506490  LNPFG---KATKECGFSIPNGSKRNLPAQVQWKDFGYSHQGPCEVWCDDKLAFMDTNCAL  506320

Query  152     EFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                +PE       D  VC  +  +  +W+ +        WQ++ NC+ L+
Sbjct  506319  HYPEVPAFLPYDIDVCIGAKMIQSYWIAL----HGLPWQLYLNCVPLT  506188

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 62/136 (46%), Gaps = 21/136 (15%)
 Frame = +3

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPI---------PDGIMR  321
               FV + + + + S+R  ++D  +  V+  A   CGF+ P+                D I +
Sbjct  504222  FVEHFEKSKYKSIRTMIEDKQVL-VSDDATATCGFSSPEKTSYGALNDTVYWGRNDDITQ  504398

Query  322     STGYTHDGPCEVWLDDTRVLQHDNCHEV---ISGK---TYDLDYSACNGSCTLYWYWLGV  375
                 G  H GPCEVW DD R  Q  NC +     SGK      +D S C  +  L ++W+G+
Sbjct  504399  DEGLVHPGPCEVWCDDNRAQQDMNCMKTYTPASGKGAAPIPIDKSVCTDAKRLTFFWIGM  504578

Query  376     RYLKQVYSWQVY-KAC  390
                      +WQVY K C
Sbjct  504579  HGA----TWQVYSKLC  504614

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (45%), Gaps = 12/127 (9%)
 Frame = +3

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--D  131
                A   Y +L+A +DD    +VT   L  CG   P+   QP+P    +  S   G+T   +
Sbjct  552630  FATSTYKSLKAFIDDKAKITVTGATL-TCGNAEPDATAQPLPDKLEWYHSESEGFTASHE  552806

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQV  189
               GPCE W D+       NC   F      + Y  S C  +  ++++W+ +       +WQV
Sbjct  552807  GPCEAWCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAM----HGPTWQV  552974

Query  190     FKNCINL  196
               + NC  L
Sbjct  552975  YVNCAPL  552995

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 47/101 (47%), Gaps = 11/101 (11%)
 Frame = -3

Query  103     FDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEIWIDNTLALAGRNCHTEFPEGH  157
                 CGLT P+   QP+P    +    T G+T   +GPCE W D T      NC   F    
Sbjct  498144  LQCGLTNPDETAQPLPDEIEWTHSDTEGFTSSHEGPCEAWCDGTQVFQDTNCAAHFTTAP  497965

Query  158     HTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                 +  D + C  + R++++WL +       +WQV+ NC  L
Sbjct  497964  AKMPYDKAGCSGANRLTFYWLALH----SSTWQVYVNCAAL  497854

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 62/128 (48%), Gaps = 13/128 (10%)
 Frame = +2

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGP  133
                 +++L+ L+++    +V++  L  CG   P+   QP+P          + G+T   +GP
Sbjct  491942  SSFSSLKELINEKATLTVSDATL-TCGSCDPDETAQPLPDTYVEWAHSDSEGFTASHEGP  492118

Query  134     CEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFK  191
               CEIW D+     G +C  ++      +  D+  C  S  ++++WL +       +WQV+ 
Sbjct  492119  CEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLAL----HSSTWQVYV  492286

Query  192     NCINLSAS  199
               NC  L ++
Sbjct  492287  NCAPLEST  492310

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 12/122 (10%)
 Frame = +1

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--DGPCEI  136
               Y +L+A++DD     +       CG+  P    QP+P    +  S   G+T   +GPCE+
Sbjct  539218  YKSLKAVIDDKAKI-IVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHEGPCEV  539394

Query  137     WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
               W D        NC   +      + Y  S C  +  ++ +W+ +       SWQV+ NC 
Sbjct  539395  WCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAM----HGPSWQVYVNCA  539562

Query  195     NL  196
                L
Sbjct  539563  PL  539568

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 64/156 (41%), Gaps = 20/156 (13%)
 Frame = -2

Query  48      VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGL  107
               V  GM Y   P +        TA  A        Y +L+ L  D      T     +CG 
Sbjct  512806  VPSGMSYNTDPAS--NTNAYWTAFNA------SKYKSLKELAWDAQTLEGTASN--ECGF  512657

Query  108     TFPNTETQPIP--TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--S  163
               +  +   + +P      F T+ +   GPCE+W D+TL     NC  ++PE    + Y  +
Sbjct  512656  SLVDGTPRDLPDEVQWDFFTASH--QGPCEVWCDDTLVFENWNCAVDYPETPANLPYDKA  512483

Query  164     VCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                C  S  ++ +W+ +        WQV+ NC  L+ +
Sbjct  512482  KCKGSSVLTSYWIAL----HTTPWQVYTNCAPLTGA  512387

 Score = 46.6 bits (109),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 53/124 (43%), Gaps = 13/124 (10%)
 Frame = +2

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
               Y +L+  + D     V+   L  CG   P  E QP+P +        + G+T   +GPCE
Sbjct  566606  YKSLKEYVTDKAKIIVSGATLT-CGSCDPKQEPQPMPKSTVEWSHSDSEGFTPSHEGPCE  566782

Query  136     IWIDNTLALAGRNC--HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               +W D+       +C  H          D   C  +  ++++W+ +       SWQV+ NC
Sbjct  566783  VWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAM----HSSSWQVYVNC  566950

Query  194     INLS  197
                 L+
Sbjct  566951  APLA  566962

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 13/128 (10%)
 Frame = +3

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGP  133
                 Y +L+ L++     +VT+  L  CG   P+   QP+P          + G+T   +GP
Sbjct  502644  SSYTSLKELINALATITVTDATL-TCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGP  502820

Query  134     CEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFK  191
               CE+W D+  A    +C   +      + Y    C  +  ++++WL +       +WQV+ 
Sbjct  502821  CEVWCDDVRAFQDDDCAAHYTSTPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYI  502988

Query  192     NCINLSAS  199
               NC  L ++
Sbjct  502989  NCAPLEST  503012

 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 65/168 (39%), Gaps = 16/168 (10%)
 Frame = -3

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               SGL EG   L  P     DGM Y   P  Y   +    A  A ++ +   +A    ++  
Sbjct  509568  SGLIEGDTYLPVP-----DGMSYSTDP--YDNTEAYWAAFNASSYTSLLEFAKETQVLQT  509410

Query  92      DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
                  +        +CG +  N   + +P    +     + +GPCE+  D+T      NC  
Sbjct  509409  MATFGT---ATAECGFSLANGTARALPAEVEWNQLTSSHEGPCEV*CDDTRVFEDWNCAL  509239

Query  152     EFPEGHHTIDYSV--CGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
               ++      + Y V  C  +  ++  WL +        WQV+ NC  L+
Sbjct  509238  DYTSDPAKLPYDVSKCEGASMLTSIWLALH----ALPWQVYTNCAPLT  509107

 Score = 45.4 bits (106),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 56/123 (46%), Gaps = 19/123 (15%)
 Frame = +3

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF------ITS--GYTLDGP  133
               Y ++R +++D  +  V+++    CG + P   +     +  +      IT   G    GP
Sbjct  504249  YKSIRTMIEDKQVL-VSDDATATCGFSSPEKTSYGALNDTVYWGRNDDITQDEGLVHPGP  504425

Query  134     CEIWIDNTLALAGRNCHTEFPEGHHT------IDYSVCGESCRVSWFWLGIKYQGERYSW  187
               CE+W D+  A    NC   +            ID SVC ++ R+++FW+G+       +W
Sbjct  504426  CEVWCDDNRAQQDMNCMKTYTPASGKGAAPIPIDKSVCTDAKRLTFFWIGM----HGATW  504593

Query  188     QVF  190
               QV+
Sbjct  504594  QVY  504602

>PHRA:scaffold_1234
Length=7828

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 59/108 (55%), Gaps = 18/108 (17%)
 Frame = -2

Query  300   DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
             D +CG+T  D  PQPIP DG ++       G+TH GPCE+++DDT VL  D+C E   G 
Sbjct  4851  DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  4672

Query  353   -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                        +DYS+CNG CTL  YWL      Q   WQ Y  CVP+
Sbjct  4671  PDGSNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVPL  4540

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 60/111 (54%), Gaps = 18/111 (16%)
 Frame = -3

Query  295   VNASADFRCGFTDPDAAPQPI-PDGIM-----RSTGYTHDGPCEVWLDDTRVLQHDNCHE  348
             ++ + ++ CG+T  D  P+ I  DG+         G+TH GPCE++LDDT +L  DNC +
Sbjct  2762  MSLALEYPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCED  2583

Query  349   VISGKTYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               SG   D        +DYS+CNG+CTL  YWLG     Q   WQ Y   V
Sbjct  2582  EYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF----QNEQWQAYSEWV  2442

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (48%), Gaps = 17/117 (15%)
 Frame = -2

Query  105   CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
             CG T  + + QPIPT+G          G+T  GPCEI+ID+T+ L G +C  E+P G   
Sbjct  4842  CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  4663

Query  157   -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGLQ  208
                     +DYS C   C ++ +WL      +   WQ + NC+ L  S   T    Q
Sbjct  4662  SNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVPLKGSGSATQTQTQ  4504

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 17/112 (15%)
 Frame = -3

Query  103   FDCGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG-  156
             + CG T  + + + I T+G  I       G+T  GPCEI++D+T+ L G NC  E+  G 
Sbjct  2744  YPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGGA  2565

Query  157   -------HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASAL  201
                       IDYS C  +C ++ +WLG  +Q E   WQ +   +     A+
Sbjct  2564  DDSGIMSDMPIDYSSCNGACTLAIYWLG--FQNE--QWQAYSEWVEQQLPAV  2421

>PHCA:scaffold_22 PHYCAscaffold_22
Length=843021

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 70/137 (51%), Gaps = 16/137 (12%)
 Frame = +3

Query  261     EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
               +G N  + + F     AN F  L+  MDD S+Y  +      CGFT+P    QPIP DG 
Sbjct  399243  DGNNAGSVETFKSLKSANNFKDLKTLMDDTSVYGAD------CGFTNPSGTAQPIPTDGK  399404

Query  320     MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
                  S    H GPCE+WLDDT+VL  D+C+     +  D+      DYS+C NG C  + +
Sbjct  399405  ATFSRALVHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRF  399584

Query  371     YWLGVRYLKQVYSWQVY  387
               YWL  + +     WQ Y
Sbjct  399585  YWLAFQGVDGKTVWQSY  399635

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 70/137 (51%), Gaps = 16/137 (12%)
 Frame = +1

Query  261     EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
               +G    + D F     AN F  L+  MDD S+Y  +      CGFTDP+   QPIP DG 
Sbjct  396574  DGNKPGSVDAFKALKTANNFKDLKTLMDDTSVYGAD------CGFTDPNGKAQPIPSDGK  396735

Query  320     MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
                  S    H GPCE+WLDDT+VL  D+C+     +  D+      DYS+C NG C  + +
Sbjct  396736  ATFSRAIVHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRF  396915

Query  371     YWLGVRYLKQVYSWQVY  387
               YWL  + +     WQ Y
Sbjct  396916  YWLAFQGVDGKTVWQSY  396966

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 15/120 (13%)
 Frame = +1

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
                 +  L+ LMDD  +Y        DCG T PN + QPIP++G    S   +  GPCEIW+
Sbjct  396625  NNFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWL  396786

Query  139     DNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVF  190
               D+T  L   +C++++   +  I      DYS C  G    + ++WL  +    +  WQ +
Sbjct  396787  DDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  396966

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 15/128 (12%)
 Frame = +3

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEI  136
               +   +  L+ LMDD  +Y        DCG T P+   QPIPT+G    S   +  GPCEI
Sbjct  399288  SANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVGPCEI  399449

Query  137     WIDNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQ  188
               W+D+T  L   +C++++   +  I      DYS C  G    + ++WL  +    +  WQ
Sbjct  399450  WLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQ  399629

Query  189     VFKNCINL  196
                +   + L
Sbjct  399630  SYSKFLVL  399653

>PHSO:scaffold_10
Length=2388181

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 69/131 (53%), Gaps = 13/131 (10%)
 Frame = +3

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT  326
               F    +A+ + SL+ F+DD +  +V   A   CG  +PDAA QP+P  +      S G+T
Sbjct  493002  FTKAFEASKYKSLKEFIDDKAKITVTG-ATLTCGIAEPDAAAQPVPAKLEWSHSDSEGFT  493178

Query  327     --HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
                 H+GPCE W DDTRV   +NC         ++ Y  S C+G+  L +YW+ +       
Sbjct  493179  SSHEGPCEAWCDDTRVFNDENCAANFKTAPAEMPYESSKCSGAKMLTFYWMAMHGP----  493346

Query  383     SWQVYKACVPI  393
               +WQVY  C P+
Sbjct  493347  TWQVYVNCAPL  493379

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 71/143 (50%), Gaps = 14/143 (10%)
 Frame = +3

Query  260     LEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI  319
                 G     T  F    +++ + SL+  ++D +  +V   A   CG  DPD   QP+PD  
Sbjct  453507  FNGAPADNTAAFTTAFESSSYSSLKELINDKATITVT-DATLTCGMCDPDETAQPLPDTY  453683

Query  320     MR-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYW  370
               +      S G+T  H+GPCEVW DD RV Q D+C    +    +L Y   AC GS TL +
Sbjct  453684  VEWAHSDSEGFTASHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTF  453863

Query  371     YWLGVRYLKQVYSWQVYKACVPI  393
               YWL +       +WQVY  C P+
Sbjct  453864  YWLAL----HSSTWQVYVNCAPL  453920

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 72/142 (51%), Gaps = 21/142 (15%)
 Frame = -3

Query  266     STTDDFVGY---LDANGFDSLRAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIM  320
               S +D+ V +     A+ + SL+ FM+D        SADF   CG+T PD A QP+P+  +
Sbjct  455402  SPSDNTVAFNKGFSASMYSSLKEFMNDKMEL---VSADFTKECGYTKPDEAAQPLPETYV  455232

Query  321     R-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWY  371
                       G+T  H+GPCEVW D+TRV Q DNC +        L Y   AC GS  L  Y
Sbjct  455231  EWSHGSGEGFTSSHEGPCEVWCDETRVFQDDNCPKNFPAAPAKLPYDRDACMGSSRLTIY  455052

Query  372     WLGVRYLKQVYSWQVYKACVPI  393
               W+ +       SWQVY  C  +
Sbjct  455051  WIAL----HSPSWQVYINCAAL  454998

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 26/179 (15%)
 Frame = +3

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLE--GQNFS---------TTDDFVGYLDANGFDSL  283
               H  +  PA T+     DN  + +A +E    +FS          T  F    +A+ + SL
Sbjct  451977  HGYMTEPAVTFLSSSTDNT-QFIATIESSASDFSGTFSGSPADNTAAFTKAFEASSYTSL  452153

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
               +  ++D +  +V   A   CG  DPD   QP+PD  +      + G++  H GPCEVW D
Sbjct  452154  KELINDKATITVT-DATLTCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCEVWCD  452330

Query  337     DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D RV Q D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  452331  DVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINCAPL  452495

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 84/179 (47%), Gaps = 26/179 (15%)
 Frame = +3

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLE--GQNFS---------TTDDFVGYLDANGFDSL  283
               H  +  PA T+     DN  + +A +E    +FS          T  F    +A+ + SL
Sbjct  465351  HGYLTEPAVTFLSSSTDNT-QFIATIESSASDFSGTFSGSPADNTAAFTKAFEASSYTSL  465527

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
               +  ++D +  +V   A   CG   PD   QP+PD  +      + G++  H GPCEVW D
Sbjct  465528  KELINDKATITVT-DATLTCGSCYPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCEVWCD  465704

Query  337     DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D RV Q D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  465705  DVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINCAPL  465869

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 13/127 (10%)
 Frame = -1

Query  275     LDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT--HD  328
                +++ + S++ F+ D      N  A+  CG TDPD  PQP+PD +      + G+T  H+
Sbjct  460558  FNSSQYSSIKEFVTDLGQIVANG-ANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHE  460382

Query  329     GPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
               GPCE W D+TRV Q  +C  H   +      D + C+G+  L +YWL +       +WQV
Sbjct  460381  GPCEAWCDNTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALHS----STWQV  460214

Query  387     YKACVPI  393
               Y  C  +
Sbjct  460213  YVDCAAL  460193

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 80/181 (44%), Gaps = 27/181 (15%)
 Frame = +2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANG  279
               AH  +I P PT+ V    N +   A + GQ +    D + Y               + + 
Sbjct  572900  AHSHMIDPMPTWPVSWATNNFA--ATIAGQTYLPCPDGMSYSTAPELNTEAYWTAFNESS  573073

Query  280     FDSLRAFMDDDS---LYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT--HDGPCEVW  334
               + SL+  +D  +     S   +A   CGF+  + + + IP   +     T  HDGPCEV+
Sbjct  573074  YTSLKDLVDKTAEVQTLSPFGTATLECGFSLANGSARDIPSEYVEWNQLTEGHDGPCEVY  573253

Query  335     LDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
                DD    ++DNC E + G    +  D S C G+  L  YW+ +  L     WQVY  CVP
Sbjct  573254  CDDVLAFENDNCAENLPGSPSQWPYDVSKCEGASRLTAYWIALHGLP----WQVYINCVP  573421

Query  393     I  393
               +
Sbjct  573422  L  573424

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 30/182 (16%)
 Frame = -2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANG  279
               AH  +  P PT++V      +     ++GQ++    D + Y               +A+ 
Sbjct  469308  AHSYMTDPMPTWSVGYPTTNYA--GLIDGQDYLPVPDGMSYGGTPEGNTEAYWTAFNASK  469135

Query  280     FDSLRAFMDDDSLY---SVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
               + SL+   D   +    S    A   CGF+  +   + +P  +  +  GY+H GPCEVW 
Sbjct  469134  YTSLKDLADKTMVLQSLSPFGKATAECGFSLANGTARDLPAQVEWKDFGYSHQGPCEVWC  468955

Query  336     DDTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               DD    + DNC     EV +   YD+D   C G+  +  YW+ +  L     WQ+Y  CV
Sbjct  468954  DDKLAFEDDNCALHYPEVPAKLPYDVD--VCAGASMIQSYWIALHGLP----WQLYLNCV  468793

Query  392     PI  393
               P+
Sbjct  468792  PL  468787

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 20/132 (15%)
 Frame = -1

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIMR-----ST  323
               F    +A+ + SL+  + D  L  V +S DF   CG+T     PQP+P+  +        
Sbjct  456805  FTKGFEASKYTSLKELITD--LGKVTSS-DFTMECGYT----TPQPLPET*VEWAHGSGE  456647

Query  324     GYTHDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
               G+T   PCEVW DDTRV + D+C  H   +      D  AC G+  L +YWL +      
Sbjct  456646  GFTSSRPCEVWCDDTRVFRDDDCAAHFTTAPAKVPYDRDACLGASRLTFYWLAL----HS  456479

Query  382     YSWQVYKACVPI  393
                +WQVY  C  +
Sbjct  456478  STWQVYTNCAAL  456443

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 76/171 (44%), Gaps = 22/171 (13%)
 Frame = -2

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               +GL +GQ  L      V DGM Y G+P    E     TA  A        Y +L+ L D 
Sbjct  469245  AGLIDGQDYL-----PVPDGMSYGGTPEGNTE--AYWTAFNASK------YTSLKDLADK  469105

Query  92      DG-LYSVTEEG--LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRN  148
                  L S++  G    +CG +  N   + +P    +   GY+  GPCE+W D+ LA    N
Sbjct  469104  TMVLQSLSPFGKATAECGFSLANGTARDLPAQVEWKDFGYSHQGPCEVWCDDKLAFEDDN  468925

Query  149     CHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
               C   +PE    + Y   VC  +  +  +W+ +        WQ++ NC+ L+
Sbjct  468924  CALHYPEVPAKLPYDVDVCAGASMIQSYWIAL----HGLPWQLYLNCVPLT  468784

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 17/125 (14%)
 Frame = -3

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------NGSFITSGYTLDGP  133
               Y++L+  M+D  +  V+ +   +CG T P+   QP+P         +G   TS +  +GP
Sbjct  455351  YSSLKEFMNDK-MELVSADFTKECGYTKPDEAAQPLPETYVEWSHGSGEGFTSSH--EGP  455181

Query  134     CEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFK  191
               CE+W D T      NC   FP     + Y    C  S R++ +W+ +       SWQV+ 
Sbjct  455180  CEVWCDETRVFQDDNCPKNFPAAPAKLPYDRDACMGSSRLTIYWIAL----HSPSWQVYI  455013

Query  192     NCINL  196
               NC  L
Sbjct  455012  NCAAL  454998

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 12/130 (9%)
 Frame = +3

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--DGPCEI  136
               Y +L+  +DD    +VT   L  CG+  P+   QP+P    +  S   G+T   +GPCE 
Sbjct  493029  YKSLKEFIDDKAKITVTGATLT-CGIAEPDAAAQPVPAKLEWSHSDSEGFTSSHEGPCEA  493205

Query  137     WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
               W D+T      NC   F      + Y  S C  +  ++++W+ +       +WQV+ NC 
Sbjct  493206  WCDDTRVFNDENCAANFKTAPAEMPYESSKCSGAKMLTFYWMAM----HGPTWQVYVNCA  493373

Query  195     NLSASALVTM  204
                LS     T 
Sbjct  493374  PLSGGGATTQ  493403

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 60/137 (44%), Gaps = 20/137 (15%)
 Frame = +1

Query  269     DDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDP---------DAAPQPIPDGI  319
               + FV     + + S++A ++D+ +  V+  A   CGF+DP         D       D +
Sbjct  467155  ESFVENFKKSKYKSVKAMIEDNQVL-VSKDATASCGFSDPAQTSYGALNDTIYWGRNDDL  467331

Query  320     MRSTGYTHDGPCEVWLDDTRVLQHDNCHEV---ISGK---TYDLDYSACNGSCTLYWYWL  373
                   G+ H GPCE W DD R  Q  NC       SGK      +D S C  +  L +YW+
Sbjct  467332  TLDEGFVHMGPCETWCDDNRSQQDMNCQVTYTPASGKGAAPVPIDNSVCKNAKRLTFYWV  467511

Query  374     GVRYLKQVYSWQVYKAC  390
                +       +WQVY  C
Sbjct  467512  AMHGA----TWQVYSKC  467550

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 62/133 (47%), Gaps = 13/133 (10%)
 Frame = +3

Query  75      TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
               T      Y++L+ L++D    +VT+  L  CG+  P+   QP+P          + G+T 
Sbjct  453546  TAFESSSYSSLKELINDKATITVTDATL-TCGMCDPDETAQPLPDTYVEWAHSDSEGFTA  453722

Query  131     --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
                 +GPCE+W D+       +C  ++      + Y    C  S  ++++WL +       +
Sbjct  453723  SHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLAL----HSST  453890

Query  187     WQVFKNCINLSAS  199
               WQV+ NC  L A+
Sbjct  453891  WQVYVNCAPLEAT  453929

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 67/151 (44%), Gaps = 15/151 (10%)
 Frame = -1

Query  50      DGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTF  109
               +GM Y G P++  E     TA  A ++ + +       +++ D LY        + G ++
Sbjct  474979  EGMGYEGDPLSNTE--AYWTAFNASSYTSLKDLVWKNEVVNTDSLYGT---ATIESGFSW  474815

Query  110     PNTETQPIPTNGSF--ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVC  165
                N   + +P    +  +T G+  DGP EIW D+ LA + +N    +P    T  Y  + C
Sbjct  474814  TNGTARDLPDQVEWDKLTEGH--DGPLEIWCDDVLAFSDQNAAVNYPGSPATFPYDKAAC  474641

Query  166     GESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                   R++  W+ +        WQVF NC  L
Sbjct  474640  EGKSRLTTIWMAL----HSPPWQVFTNCAPL  474560

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 68/158 (43%), Gaps = 22/158 (14%)
 Frame = +2

Query  50      DGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDG---LYSVTEEGLFDCG  106
               DGM Y  +P   L  +   TA        E  Y +L+ L+D        S       +CG
Sbjct  573002  DGMSYSTAP--ELNTEAYWTAFN------ESSYTSLKDLVDKTAEVQTLSPFGTATLECG  573157

Query  107     LTFPNTETQPIPTNG---SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP--EGHHTID  161
                +  N   + IP+     + +T G+  DGPCE++ D+ LA    NC    P        D
Sbjct  573158  FSLANGSARDIPSEYVEWNQLTEGH--DGPCEVYCDDVLAFENDNCAENLPGSPSQWPYD  573331

Query  162     YSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                S C  + R++ +W+ +        WQV+ NC+ L+ S
Sbjct  573332  VSKCEGASRLTAYWIALH----GLPWQVYINCVPLTRS  573433

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 58/122 (48%), Gaps = 12/122 (10%)
 Frame = -1

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEI  136
               Y++++  + D G   V      +CGLT P+   QP+P    +    T G+T   +GPCE 
Sbjct  460543  YSSIKEFVTDLGQI-VANGANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHEGPCEA  460367

Query  137     WIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
               W DNT      +C   +      +  D + C  + R++++WL +       +WQV+ +C 
Sbjct  460366  WCDNTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQVYVDCA  460199

Query  195     NL  196
                L
Sbjct  460198  AL  460193

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 13/123 (11%)
 Frame = +3

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLD--GPCE  135
               Y +L+ L++D    +VT+  L  CG  +P+   QP+P          T G++    GPCE
Sbjct  465516  YTSLKELINDKATITVTDATL-TCGSCYPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCE  465692

Query  136     IWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               +W D+       +C  ++      + Y    C  +  ++++WL +       +WQV+ NC
Sbjct  465693  VWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINC  465860

Query  194     INL  196
                 L
Sbjct  465861  APL  465869

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 58/123 (47%), Gaps = 19/123 (15%)
 Frame = -1

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP------TNGSFITSGYTLDGPCE  135
               Y +L+ L+ D G  + ++  + +CG T P    QP+P       +GS    G+T   PCE
Sbjct  456778  YTSLKELITDLGKVTSSDFTM-ECGYTTP----QPLPET*VEWAHGS--GEGFTSSRPCE  456620

Query  136     IWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               +W D+T      +C   F      + Y    C  + R++++WL +       +WQV+ NC
Sbjct  456619  VWCDDTRVFRDDDCAAHFTTAPAKVPYDRDACLGASRLTFYWLALHSS----TWQVYTNC  456452

Query  194     INL  196
                 L
Sbjct  456451  AAL  456443

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 70/182 (38%), Gaps = 32/182 (18%)
 Frame = -1

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFL--------------EGQNFSTTDDFVGYLDANGF  280
               H  + LP PT+  E   N   P   +              EG   S T+ +    +A+ +
Sbjct  475078  HSKMSLPKPTWVFEEGTN--SPAGTVDSSNVLPAPEGMGYEGDPLSNTEAYWTAFNASSY  474905

Query  281     DSLRAFM------DDDSLYSVNASADFRCGFTDPDAAPQPIPDGI-MRSTGYTHDGPCEV  333
                SL+  +      + DSLY    +A    GF+  +   + +PD +        HDGP E+
Sbjct  474904  TSLKDLVWKNEVVNTDSLY---GTATIESGFSWTNGTARDLPDQVEWDKLTEGHDGPLEI  474734

Query  334     WLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               W DD       N      G   T+  D +AC G   L   W+ +        WQV+  C 
Sbjct  474733  WCDDVLAFSDQNAAVNYPGSPATFPYDKAACEGKSRLTTIWMALHSPP----WQVFTNCA  474566

Query  392     PI  393
               P+
Sbjct  474565  PL  474560

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/162 (27%), Positives = 66/162 (41%), Gaps = 22/162 (14%)
 Frame = -3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANG  279
               AH  +ILP PT+ V    N   P   +EG  +    D + Y               +A+ 
Sbjct  472343  AHSNMILPLPTWPVSWSTN--SPSGLIEGDTYLPVPDGMSYSTDPYDNTEAYWTAFNASN  472170

Query  280     FDSLRAFMDDDSLYSVNAS---ADFRCGFTDPDAAPQPIPDGI-MRSTGYTHDGPCEVWL  335
               + SL  F  +  +    A+   A   CGF+  +   + +P+ +       +H+GP EVW 
Sbjct  472169  YTSLLEFAKETQVLQTMATFGTATAECGFSLANGTARDLPEQVEWNQLTSSHEGPIEVWC  471990

Query  336     DDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGV  375
               DDT V +        +G    L Y  S C G+  L   WL +
Sbjct  471989  DDTLVFKDWYAALDYTGFPAKLPYDVSKCKGASMLTSVWLAL  471864

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 13/128 (10%)
 Frame = +3

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLD--GP  133
                 Y +L+ L++D    +VT+  L  CG   P+   QP+P          T G++    GP
Sbjct  452136  SSYTSLKELINDKATITVTDATL-TCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSHAGP  452312

Query  134     CEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFK  191
               CE+W D+       +C  ++      + Y    C  +  ++++WL +       +WQV+ 
Sbjct  452313  CEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYI  452480

Query  192     NCINLSAS  199
               NC  L ++
Sbjct  452481  NCAPLEST  452504

 Score = 45.4 bits (106),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 59/135 (44%), Gaps = 21/135 (16%)
 Frame = +1

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF---------ITSG  127
                 +  Y +++A+++D+ +  V+++    CG + P  +T     N +          +  G
Sbjct  467173  FKKSKYKSVKAMIEDNQVL-VSKDATASCGFSDP-AQTSYGALNDTIYWGRNDDLTLDEG  467346

Query  128     YTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT------IDYSVCGESCRVSWFWLGIKYQ  181
               +   GPCE W D+  +    NC   +            ID SVC  + R++++W+ +   
Sbjct  467347  FVHMGPCETWCDDNRSQQDMNCQVTYTPASGKGAAPVPIDNSVCKNAKRLTFYWVAM---  467517

Query  182     GERYSWQVFKNCINL  196
                   +WQV+  C + 
Sbjct  467518  -HGATWQVYSKCCSF  467559

 Score = 36.2 bits (82),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 57/150 (38%), Gaps = 14/150 (9%)
 Frame = -3

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               SGL EG   L  P     DGM Y   P  Y   +   TA  A  + +   +A    ++  
Sbjct  472280  SGLIEGDTYLPVP-----DGMSYSTDP--YDNTEAYWTAFNASNYTSLLEFAKETQVLQT  472122

Query  92      DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC--  149
                  +        +CG +  N   + +P    +     + +GP E+W D+TL         
Sbjct  472121  MATFGTATA---ECGFSLANGTARDLPEQVEWNQLTSSHEGPIEVWCDDTLVFKDWYAAL  471951

Query  150     -HTEFPEGHHTIDYSVCGESCRVSWFWLGI  178
                +T FP      D S C  +  ++  WL +
Sbjct  471950  DYTGFP-AKLPYDVSKCKGASMLTSVWLAL  471864

>PYIW:scaffold_360 piw_scaffold_360 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_360:1:20022:1 
REF
Length=20022

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 80/171 (47%), Gaps = 15/171 (9%)
 Frame = +2

Query  234   AHQLVILPAPTY--TVEGKDNRWK-PLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDD  290
             AH  + LPAPT+  + + K N W   +   +    +T   F      NGF SLRAF+ D+
Sbjct  2585  AHGRLALPAPTFIASAKSKPNYWAYGVDNTKNPPRATAATFAANYKKNGFKSLRAFIMDN  2764

Query  291   SL---YSVNASADF-RCGFTDPDAAPQPIPDGI-MRSTGYTHDGPCEVWLDDTRVLQHD-  344
                  Y    S     CGFTDP+  PQP+PD +      + H+GPCE W DD  V+    
Sbjct  2765  QTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEAWCDDVLVMPFTA  2944

Query  345   NCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             +C     G    + Y  + C G   L++YWL       V  +Q Y  CVPI
Sbjct  2945  SCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATF----VSPFQAYTNCVPI  3085

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (43%), Gaps = 11/135 (8%)
 Frame = +2

Query  79    ERGYATLRALMDDD---GLYSVTEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPC  134
             + G+ +LRA + D+   G Y     G   +CG T PN   QP+P    +    +  +GPC
Sbjct  2723  KNGFKSLRAFIMDNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPC  2902

Query  135   EIWIDNTLAL---AGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFK  191
             E W D+ L +   A    +    +     D + C     + ++WL          +Q + 
Sbjct  2903  EAWCDDVLVMPFTASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATFVS----PFQAYT  3070

Query  192   NCINLSASALVTMIG  206
             NC+ + + A  ++ G
Sbjct  3071  NCVPIKSGAARSLDG  3115

 Score = 37.7 bits (86),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 61/160 (38%), Gaps = 39/160 (24%)
 Frame = +2

Query  244   TYTVEGKDNRWKPLAFLEGQNFSTTD-------DFVGYLDANGFDSLRAFMDDDSLYSVN  296
             TY V+G +N           N++ +D       +F       GF +LR            
Sbjct  869   TYCVDGDEN----------TNYANSDGAPVRIANFEKNFAKYGFTALRP-----------  985

Query  297   ASADFRCGFTDPDAAPQPIPDGIMRSTGYTHD-GPCEVWLDDTRV--LQHDNCHEVISGK  353
             +    +C F DP+  PQP+   + R     H  GPCE   D   +  ++H    E  + K
Sbjct  986   SGGTPQCSFADPNDTPQPLIGNLARPRRSFHQSGPCEA*CDVHVMPCIKHGKA*EAFT-K  1162

Query  354   TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D+  S   G   L  +W  + +       QVY +C PI
Sbjct  1163  QDDVR*SQGRGKTLLSLFWFAMHF-------QVYVSCAPI  1261

>PYAP:scaffold_1129 pag1_scaffold_1129 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_1129:1:6613:1 
REF
Length=6613

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 69/119 (58%), Gaps = 14/119 (12%)
 Frame = +1

Query  278   NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWL  335
             +G  +LRAF++         S    CG T+P+A  +PIP DG+++  +   H GPCE+W 
Sbjct  3682  HGVKTLRAFLE---------SKGPVCGSTNPNAKRKPIPRDGLIKFGSSMEHPGPCEIWF  3834

Query  336   DDTRVLQHDNCHEVISGKT-YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             D+TRV    +C++     T + +DYS C G C L +YWLG++   +   WQ YK CVP+
Sbjct  3835  DNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQDGGK--RWQSYKNCVPL  4005

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 67/133 (50%), Gaps = 15/133 (11%)
 Frame = +1

Query  67    VHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS  126
             + T  +      + G  TLRA ++  G           CG T PN + +PIP +G  I  
Sbjct  3643  IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDG-LIKF  3792

Query  127   GYTLD--GPCEIWIDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGE  183
             G +++  GPCEIW DNT      +C+  F       IDYS C   C + ++WLG++  G+
Sbjct  3793  GSSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQDGGK  3972

Query  184   RYSWQVFKNCINL  196
             R  WQ +KNC+ L
Sbjct  3973  R--WQSYKNCVPL  4005

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 4/79 (5%)
 Frame = -2

Query  317  DGIMR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT-YDLDYSACNGSCTLYWYWLG  374
            DG+++  +   H GPCE+W D+TRV    +C +     T + +DYS C G+C L +YWLG
Sbjct  651  DGLIKFGSSMEHPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLG  472

Query  375  VRYLKQVYSWQVYKACVPI  393
            ++   +   WQ YK CVPI
Sbjct  471  LQDGGK--RWQSYKNCVPI  421

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 48/92 (52%), Gaps = 6/92 (7%)
 Frame = -2

Query  118  PTNGSFITSGYTLD--GPCEIWIDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWF  174
            P +G  I  G +++  GPCEIW DNT      +C   F       IDYS C  +C + ++
Sbjct  657  PKDG-LIKFGSSMEHPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFY  481

Query  175  WLGIKYQGERYSWQVFKNCINLSASALVTMIG  206
            WLG++  G+R  WQ +KNC+ +     +   G
Sbjct  480  WLGLQDGGKR--WQSYKNCVPIGNGKRMLAEG  391

>PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 
genomic scaffold, whole genome shotgun sequence
Length=4595942

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 70/141 (50%), Gaps = 16/141 (11%)
 Frame = -1

Query  261      EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
                +G    + + F     AN F  L+  MDD S+Y  +      CGFTDP+   QPIP DG 
Sbjct  2065331  DGNKPGSVNAFKALKTANKFKDLKTLMDDTSVYGAD------CGFTDPNGKAQPIPKDGK  2065170

Query  320      MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
                   S    H GPCE+WLDDT+VL  D+C      +  D+      DYS+C NG C  + +
Sbjct  2065169  ATFSRALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRF  2064990

Query  371      YWLGVRYLKQVYSWQVYKACV  391
                YWL  + +     WQ Y   V
Sbjct  2064989  YWLAFQGVDGKTVWQSYSKLV  2064927

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = -1

Query  261      EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
                +G N  + + F     AN F  L+  MDD S+Y  +      CGFTDP+   QPIP DG 
Sbjct  2062559  DGNNAGSVETFKSLKTANNFKDLKTLMDDTSVYGTD------CGFTDPNGKAQPIPKDGK  2062398

Query  320      MR-STGYTHDGPCEVWLDDTRVLQHDNC  346
                   S    H GPCE+WLDDT+VL  D+C
Sbjct  2062397  ATFSRALVHVGPCEIWLDDTKVLYEDDC  2062314

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 15/124 (12%)
 Frame = -1

Query  82       YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWIDN  140
                +  L+ LMDD  +Y        DCG T PN + QPIP +G    S   +  GPCEIW+D+
Sbjct  2065274  FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  2065113

Query  141      TLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVFKN  192
                T  L   +C +++   +  I      DYS C  G    + ++WL  +    +  WQ +  
Sbjct  2065112  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYSK  2064933

Query  193      CINL  196
                 + L
Sbjct  2064932  LVVL  2064921

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 7/73 (10%)
 Frame = -1

Query  82       YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWIDN  140
                +  L+ LMDD  +Y        DCG T PN + QPIP +G    S   +  GPCEIW+D+
Sbjct  2062502  FKDLKTLMDDTSVYGT------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  2062341

Query  141      TLALAGRNCHTEF  153
                T  L   +C +++
Sbjct  2062340  TKVLYEDDCFSKY  2062302

>PHRA:scaffold_29
Length=529199

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 14/132 (11%)
 Frame = -2

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGY  325
               F    +++ + SL+ F+DD +  +V   A   CG  DPD   QP+P+  +      S G+
Sbjct  474376  FTTAFESSSYSSLKEFIDDKATITVT-DATLTCGACDPDETAQPLPETYVEWAHSDSEGF  474200

Query  326     T--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQV  381
               T  H+GPCEVW DD RV Q D+C    +     L  D+ AC GS  L +YWL +      
Sbjct  474199  TASHEGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALH----S  474032

Query  382     YSWQVYKACVPI  393
                +WQVY  C P+
Sbjct  474031  STWQVYVNCAPL  473996

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 67/135 (50%), Gaps = 14/135 (10%)
 Frame = +3

Query  268     TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----S  322
               T +F     A+ + SL+ FM D  L  VN      CG+T+PD A QP+P   +       
Sbjct  472497  TANFNKGFAASKYSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDG  472673

Query  323     TGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYL  378
                G+T  H+GPCEVW DDTRV Q DNC +        L Y   AC GS  L  YW+ +   
Sbjct  472674  EGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALHSA  472853

Query  379     KQVYSWQVYKACVPI  393
                   SWQVY  C  +
Sbjct  472854  ----SWQVYINCAAL  472886

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 72/143 (50%), Gaps = 19/143 (13%)
 Frame = -3

Query  264     NFSTTDDFVGYLDANG---FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM  320
               N + +D+   +  A G   + SL+ F++D +  +V   A   CG  DP    QP+P   M
Sbjct  437649  NGAPSDNVAAFTKAFGSSKYSSLKEFINDKATVTVTG-ATLTCGSCDPKEEAQPMPKSTM  437473

Query  321     R-----STGYT--HDGPCEVWLDDTRVLQHDNC---HEVISGKTYDLDYSACNGSCTLYW  370
                     S G+T  H+GPCEVW DD R  Q D+C   + ++  +    D  AC GS TL +
Sbjct  437472  EWSHSDSEGFTASHEGPCEVWCDDVRTFQDDDCPANYPMVPAQ-LPFDRDACMGSSTLTF  437296

Query  371     YWLGVRYLKQVYSWQVYKACVPI  393
               YW+ +       +WQVY  C P+
Sbjct  437295  YWMAMHS----STWQVYVNCAPL  437239

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 83/181 (46%), Gaps = 31/181 (17%)
 Frame = +2

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFS-----------TTDDFVGYLDANGFDSL  283
               H  + +P   YT EG   ++  +A +E                 T  F    +A+ + SL
Sbjct  471077  HGYMSVPKCEYTFEGDTTQF--MATIEASASGFSGSFSGSPADNTAAFAKGFEASKYTSL  471250

Query  284     RAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVW  334
               +  + D  L  V  SADF   CG+T+PD   QP+P   +        G+T  H+GPCEVW
Sbjct  471251  KEMVSD--LGKVT-SADFTMECGYTNPDETAQPLPKTYVEWAHGSGEGFTSSHEGPCEVW  471421

Query  335     LDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
                DD RV Q D+C  H   +      D+ AC G+  L +YWL +       +WQVY  C  
Sbjct  471422  CDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLAL----HSSTWQVYTNCAA  471589

Query  393     I  393
               +
Sbjct  471590  L  471592

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 68/136 (50%), Gaps = 13/136 (10%)
 Frame = +2

Query  266     STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MR  321
               + T+ F    +++ + S++ F+ D     V   A+  CG TDP+  PQPIPD +      
Sbjct  466697  ANTEAFWTAFNSSKYSSIKEFVTDLGQI-VADGANIECGLTDPNETPQPIPDELEWTHSD  466873

Query  322     STGYT--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRY  377
               + G+T  H+GPCE W D T+V    +C  H   +      D + C+G+  L +YWL +  
Sbjct  466874  TEGFTSSHEGPCEAWCDGTQVFHDTDCAAHFTTAPAKMPYDQAGCSGASRLTFYWLALHS  467053

Query  378     LKQVYSWQVYKACVPI  393
                    +WQVY  C  +
Sbjct  467054  ----STWQVYVNCAAL  467089

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 82/177 (46%), Gaps = 23/177 (13%)
 Frame = -2

Query  235     HQLVILPAPTYTVEGKDNRW------KPLAFLEGQ-NFSTTDDFVGYLDA---NGFDSLR  284
               H  +  PA T++ E  D            + L+G  N +  D+   +  A   + + SL+
Sbjct  442423  HGYMTKPAATFSAEAGDKTQFIATIDSSTSGLKGTFNTAPADNVASFTKAFASSKYKSLK  442244

Query  285     AFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT--HDGPCEVWLDDT  338
               A +DD +  +V   A   CG  DP AA Q +P  +      S G+T  H+GPCEVW DD 
Sbjct  442243  ALIDDKAKVTVTG-ATLTCGTADPAAAAQALPKTVEWSHSESEGFTASHEGPCEVWCDDV  442067

Query  339     RVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               R  Q +NC    +    +L Y  S C G+  L +YW+ +       SWQVY  C  +
Sbjct  442066  RAFQDENCSAHFTSAPAELPYESSKCQGASKLTFYWMAMHGP----SWQVYVNCANL  441908

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 78/179 (44%), Gaps = 26/179 (15%)
 Frame = -1

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
               H  +  PA T+     DN  + +A +E           G     T  F     ++ + SL
Sbjct  462599  HGYLTDPAVTFLSSSTDNT-QFIATIESSASGFSGTFSGSPADNTAAFTTAFASSSYTSL  462423

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
               +  +   +  +V   A   CG  DPD   Q +P   +      + G+T  H+GPCEVW D
Sbjct  462422  KDLITGLATVTVT-DATLTCGSCDPDETAQALPAEYVEWSHSSTEGFTSSHEGPCEVWCD  462246

Query  337     DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D RV   D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  462245  DVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYVNCAPL  462081

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 78/183 (43%), Gaps = 32/183 (17%)
 Frame = +3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANG  279
               AH  + LP PT+  EG  N   P   ++  N     D +GY               +A+ 
Sbjct  453144  AHSKMSLPKPTWIYEGGTNS--PAGTIDSSNVLPAPDGMGYEGDPLSNNEAYWTAFNASK  453317

Query  280     FDSLRAFM------DDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT-HDGPCE  332
               + SL+  +      + DS+Y    +A   CGF+  +   + +PD +      T HDGPCE
Sbjct  453318  YTSLKELVWKNEVVNTDSIY---GTATIECGFSWTNGTARDLPDEVQWDKLTTGHDGPCE  453488

Query  333     VWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               +W DDT      NC  +   +  ++  D +AC G   L   WL V        WQV+  C
Sbjct  453489  IWCDDTLAFSDQNCAVNYPDTPASFPYDKAACEGKSMLTAIWLAVHSPP----WQVFTNC  453656

Query  391     VPI  393
                P+
Sbjct  453657  APL  453665

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 78/179 (44%), Gaps = 26/179 (15%)
 Frame = -3

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
               H  +  PA T+     DN  + +A +E           G     T  F     ++ + SL
Sbjct  475986  HGYMTEPAVTFLSSSTDNT-QFIATIESSASGFSGTFSGSPADNTAAFTTAFASSSYTSL  475810

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
               +  +   +  +V   A   CG  DPD   Q +P   +      + G+T  H+GPCEVW D
Sbjct  475809  KDLITGLATVTVT-DATLTCGSCDPDETAQALPAEYVEWSHSSTEGFTSSHEGPCEVWCD  475633

Query  337     DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D RV   D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  475632  DVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYVNCAPL  475468

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 72/152 (47%), Gaps = 15/152 (10%)
 Frame = +3

Query  50      DGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTF  109
               DGM Y G P++    +   TA  A  + + +       +++ D +Y        +CG ++
Sbjct  453246  DGMGYEGDPLS--NNEAYWTAFNASKYTSLKELVWKNEVVNTDSIYGT---ATIECGFSW  453410

Query  110     PNTETQPIPTNGSF--ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVC  165
                N   + +P    +  +T+G+  DGPCEIW D+TLA + +NC   +P+   +  Y  + C
Sbjct  453411  TNGTARDLPDEVQWDKLTTGH--DGPCEIWCDDTLAFSDQNCAVNYPDTPASFPYDKAAC  453584

Query  166     GESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                    ++  WL +        WQVF NC  LS
Sbjct  453585  EGKSMLTAIWLAV----HSPPWQVFTNCAPLS  453668

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 80/182 (44%), Gaps = 30/182 (16%)
 Frame = +3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNF--------------STTDDFVGYLDANG  279
               AH  +  P PT++V      +  L  ++GQ++                TD +    +A+ 
Sbjct  457998  AHSYMTDPMPTWSVGYPTTNYAGL--IDGQDYLPCPDGMSYGGTPEGNTDAYWTAFNASK  458171

Query  280     FDSLRAFMDDDS-LYSVN--ASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
               + SL+   D    L S+N    A   CGF+ P+   + +P  +     G +H GPCEVW 
Sbjct  458172  YTSLKNLADKTMVLQSLNPFGKATAECGFSLPNGTARNLPAEVQWHDFGLSHQGPCEVWC  458351

Query  336     DDTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               DD       NC     EV +   YD+D   C G+  +  YW+ +  L     WQ+Y  CV
Sbjct  458352  DDKLAFMDQNCALNYPEVPASLPYDVD--VCAGASMMQSYWIALHGLP----WQLYLNCV  458513

Query  392     PI  393
               P+
Sbjct  458514  PL  458519

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 74/180 (41%), Gaps = 26/180 (14%)
 Frame = +3

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANG  279
               AH  +ILP PT+ V    N   P   +EG  +    D + Y               +++ 
Sbjct  455025  AHSNMILPLPTWPVSWSTN--SPSGLIEGDTYLPVPDGLSYTTDPYDNTEVYWTAFNSSN  455198

Query  280     FDSLRAFMDDDSL---YSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
               + SL     +  +    S   +A   CGF+  +   + +P  +       +H+GPCEVW 
Sbjct  455199  YTSLLELAKETQVLQTMSTFGTATAECGFSLANGTARDLPAEVEWNQLTSSHEGPCEVWC  455378

Query  336     DDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               DDT V +  NC    +     L  D S C G+  L   WL +  L     WQVY  C P+
Sbjct  455379  DDTLVFEDWNCALDYTSDPAKLPYDVSKCKGASMLTSIWLALHALP----WQVYTNCAPL  455546

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 74/168 (44%), Gaps = 16/168 (10%)
 Frame = +3

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               +GL +GQ  L  P     DGM Y G+P          TA  A  + + +  A    ++  
Sbjct  458061  AGLIDGQDYLPCP-----DGMSYGGTPEG--NTDAYWTAFNASKYTSLKNLADKTMVLQS  458219

Query  92      DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
                  +    +   +CG + PN   + +P    +   G +  GPCE+W D+ LA   +NC  
Sbjct  458220  LNPFG---KATAECGFSLPNGTARNLPAEVQWHDFGLSHQGPCEVWCDDKLAFMDQNCAL  458390

Query  152     EFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                +PE   ++ Y   VC  +  +  +W+ +        WQ++ NC+ L+
Sbjct  458391  NYPEVPASLPYDVDVCAGASMMQSYWIAL----HGLPWQLYLNCVPLT  458522

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 59/130 (45%), Gaps = 17/130 (13%)
 Frame = +3

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------NGSFITSGY  128
                A   Y++L+  M D  L  V +E   +CG T P+   QP+P         +G   T+ +
Sbjct  472518  FAASKYSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASH  472694

Query  129     TLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
                 +GPCE+W D+T      NC   FP     + Y    C  S  +S +W+ +       S
Sbjct  472695  --EGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIAL----HSAS  472856

Query  187     WQVFKNCINL  196
               WQV+ NC  L
Sbjct  472857  WQVYINCAAL  472886

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (47%), Gaps = 12/135 (9%)
 Frame = -2

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--D  131
                A   Y +L+AL+DD    +VT   L  CG   P    Q +P    +  S   G+T   +
Sbjct  442273  FASSKYKSLKALIDDKAKVTVTGATL-TCGTADPAAAAQALPKTVEWSHSESEGFTASHE  442097

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQV  189
               GPCE+W D+  A    NC   F      + Y  S C  + +++++W+ +       SWQV
Sbjct  442096  GPCEVWCDDVRAFQDENCSAHFTSAPAELPYESSKCQGASKLTFYWMAM----HGPSWQV  441929

Query  190     FKNCINLSASALVTM  204
               + NC NLS  +  T 
Sbjct  441928  YVNCANLSGGSGATQ  441884

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 73/176 (41%), Gaps = 22/176 (13%)
 Frame = +2

Query  234     AHQLVILPAPT-----YTVEGKDNRWKPLAFL---EGQNFST-----TDDFVGYLDANGF  280
               AH  + LP PT     Y          P   L    G +++T     T+ +    +A+ +
Sbjct  451340  AHNKMTLPLPTWPDGFYAQNSPSGTIDPATVLPVPSGMSYNTDSASNTEAYWTAFNASTY  451519

Query  281     DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRST-GYTHDGPCEVWLDDTR  339
                SL+    D    +  AS +  CGF+  D   Q +P  +       +H GPCEVW DDT 
Sbjct  451520  KSLKELAWDSQTLADGASNE--CGFSVVDGTAQDLPAEVQWDFFTASHQGPCEVWCDDTL  451693

Query  340     VLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               V ++ NC         +L Y  + C  S  L  YW+ +        WQVY  C P+
Sbjct  451694  VFENWNCAVDYPETPANLPYDKAKCASSSVLTSYWIALH----TTPWQVYTNCAPL  451849

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (46%), Gaps = 13/133 (10%)
 Frame = -2

Query  75      TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
               T      Y++L+  +DD    +VT+  L  CG   P+   QP+P          + G+T 
Sbjct  474370  TAFESSSYSSLKEFIDDKATITVTDATL-TCGACDPDETAQPLPETYVEWAHSDSEGFTA  474194

Query  131     --DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYS  186
                 +GPCE+W D+       +C  +F      +  D+  C  S  ++++WL +       +
Sbjct  474193  SHEGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLAL----HSST  474026

Query  187     WQVFKNCINLSAS  199
               WQV+ NC  L +S
Sbjct  474025  WQVYVNCAPLESS  473987

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (48%), Gaps = 12/122 (10%)
 Frame = +2

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEI  136
               Y++++  + D G   V +    +CGLT PN   QPIP    +    T G+T   +GPCE 
Sbjct  466739  YSSIKEFVTDLGQI-VADGANIECGLTDPNETPQPIPDELEWTHSDTEGFTSSHEGPCEA  466915

Query  137     WIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
               W D T      +C   F      +  D + C  + R++++WL +       +WQV+ NC 
Sbjct  466916  WCDGTQVFHDTDCAAHFTTAPAKMPYDQAGCSGASRLTFYWLALH----SSTWQVYVNCA  467083

Query  195     NL  196
                L
Sbjct  467084  AL  467089

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 67/139 (48%), Gaps = 18/139 (13%)
 Frame = +2

Query  68      HTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------  119
               +TA  A+ + A + Y +L+ ++ D G  + + +   +CG T P+   QP+P         
Sbjct  471200  NTAAFAKGFEASK-YTSLKEMVSDLGKVT-SADFTMECGYTNPDETAQPLPKTYVEWAHG  471373

Query  120     NGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLG  177
               +G   TS +  +GPCE+W D+       +C   +      +  D+  C  + R++++WL 
Sbjct  471374  SGEGFTSSH--EGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLA  471547

Query  178     IKYQGERYSWQVFKNCINL  196
               +       +WQV+ NC  L
Sbjct  471548  L----HSSTWQVYTNCAAL  471592

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (47%), Gaps = 13/126 (10%)
 Frame = -3

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
               Y++L+  ++D    +VT   L  CG   P  E QP+P +        + G+T   +GPCE
Sbjct  437592  YSSLKEFINDKATVTVTGATLT-CGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCE  437416

Query  136     IWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               +W D+       +C   +P        D   C  S  ++++W+ +       +WQV+ NC
Sbjct  437415  VWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAM----HSSTWQVYVNC  437248

Query  194     INLSAS  199
                 L+++
Sbjct  437247  APLAST  437230

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 57/132 (43%), Gaps = 20/132 (15%)
 Frame = -3

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDP---------DAAPQPIPDGIMR  321
               FV  L  + + S++A ++D+ +  V   A   CGF+DP         D       D +  
Sbjct  460701  FVENLKKSSYKSVKAMIEDNQVL-VADDATASCGFSDPAQTSYGALNDTIYWGRNDDLTL  460525

Query  322     STGYTHDGPCEVWLDDTRVLQHDNCHEV---ISGK---TYDLDYSACNGSCTLYWYWLGV  375
                 G+ H GPCE W D  +  Q  NC       SGK      +D S C  +  L +YW+ +
Sbjct  460524  DEGFVHMGPCETWCDGNQAQQDMNCQVTYTPASGKGAAPVPIDSSVCKNAKRLTFYWVAM  460345

Query  376     RYLKQVYSWQVY  387
                      +WQVY
Sbjct  460344  HGA----TWQVY  460321

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 64/152 (42%), Gaps = 16/152 (11%)
 Frame = +2

Query  48      VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGL  107
               V  GM Y     +  E     TA  A T      Y +L+ L  D    ++ +    +CG 
Sbjct  451439  VPSGMSYNTDSASNTE--AYWTAFNAST------YKSLKELAWDS--QTLADGASNECGF  451588

Query  108     TFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVC  165
               +  +   Q +P    +     +  GPCE+W D+TL     NC  ++PE    + Y  + C
Sbjct  451589  SVVDGTAQDLPAEVQWDFFTASHQGPCEVWCDDTLVFENWNCAVDYPETPANLPYDKAKC  451768

Query  166     GESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                 S  ++ +W+ +        WQV+ NC  L+
Sbjct  451769  ASSSVLTSYWIALH----TTPWQVYTNCAPLT  451852

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 66/168 (39%), Gaps = 16/168 (10%)
 Frame = +3

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               SGL EG   L  P     DG+ Y   P  Y   +   TA  +  + +    A    ++  
Sbjct  455088  SGLIEGDTYLPVP-----DGLSYTTDP--YDNTEVYWTAFNSSNYTSLLELAKETQVLQT  455246

Query  92      DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
                  +        +CG +  N   + +P    +     + +GPCE+W D+TL     NC  
Sbjct  455247  MSTFGT---ATAECGFSLANGTARDLPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCAL  455417

Query  152     EFPEGHHTIDYSV--CGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
               ++      + Y V  C  +  ++  WL +        WQV+ NC  L+
Sbjct  455418  DYTSDPAKLPYDVSKCKGASMLTSIWLAL----HALPWQVYTNCAPLT  455549

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 13/130 (10%)
 Frame = -1

Query  75      TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
               T  A   Y +L+ L+      +VT+  L  CG   P+   Q +P          T G+T 
Sbjct  462455  TAFASSSYTSLKDLITGLATVTVTDATL-TCGSCDPDETAQALPAEYVEWSHSSTEGFTS  462279

Query  131     --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
                 +GPCE+W D+       +C  ++      + Y    C  +  ++++WL +       +
Sbjct  462278  SHEGPCEVWCDDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSST  462111

Query  187     WQVFKNCINL  196
               WQV+ NC  L
Sbjct  462110  WQVYVNCAPL  462081

 Score = 45.8 bits (107),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 13/130 (10%)
 Frame = -3

Query  75      TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
               T  A   Y +L+ L+      +VT+  L  CG   P+   Q +P          T G+T 
Sbjct  475842  TAFASSSYTSLKDLITGLATVTVTDATL-TCGSCDPDETAQALPAEYVEWSHSSTEGFTS  475666

Query  131     --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
                 +GPCE+W D+       +C  ++      + Y    C  +  ++++WL +       +
Sbjct  475665  SHEGPCEVWCDDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALHSS----T  475498

Query  187     WQVFKNCINL  196
               WQV+ NC  L
Sbjct  475497  WQVYVNCAPL  475468

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 21/129 (16%)
 Frame = -3

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF---------ITSG  127
               L +  Y +++A+++D+ +  V ++    CG + P  +T     N +          +  G
Sbjct  460689  LKKSSYKSVKAMIEDNQVL-VADDATASCGFSDP-AQTSYGALNDTIYWGRNDDLTLDEG  460516

Query  128     YTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT------IDYSVCGESCRVSWFWLGIKYQ  181
               +   GPCE W D   A    NC   +            ID SVC  + R++++W+ +   
Sbjct  460515  FVHMGPCETWCDGNQAQQDMNCQVTYTPASGKGAAPVPIDSSVCKNAKRLTFYWVAM---  460345

Query  182     GERYSWQVF  190
                   +WQV+
Sbjct  460344  -HGATWQVY  460321

>PHCA:scaffold_2 PHYCAscaffold_2
Length=1925921

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 18/108 (17%)
 Frame = +1

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG+T  D  PQPIP DGI++       G+TH GPCE+++DD  VL  D+C +   G 
Sbjct  382504  DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGG  382683

Query  353     -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                          +D+S+CNG CTL  YWL      Q   WQ Y  CVP+
Sbjct  382684  AKGSDKMSEMSVDFSSCNGKCTLTIYWLAF----QNEQWQSYVNCVPL  382815

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (59%), Gaps = 13/97 (13%)
 Frame = -3

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG+T  DA PQPIP DG+++       G+TH GPCE+++DD  VL  DNC E   G 
Sbjct  351297  DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGG  351118

Query  353     --KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                     +DYS+CNG+C L  YWLG     Q   WQ Y
Sbjct  351117  DTSDMKIDYSSCNGNCMLTIYWLGF----QNAQWQAY  351019

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 18/108 (17%)
 Frame = +1

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG+T  D  PQPIP DGI++       G+TH GPCE+++DD  VL  D+C +   G 
Sbjct  353641  DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGG  353820

Query  353     -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                          +D+S+CNG CTL  YWL      Q   WQ Y  CVP+
Sbjct  353821  PDGSDKMSEMSVDFSSCNGKCTLTIYWLAF----QNEQWQSYVNCVPL  353952

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (59%), Gaps = 18/102 (18%)
 Frame = -1

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG+T  DA PQPIP DG+++       G+TH GPCE+++DD  VL  D+C E   G 
Sbjct  363527  DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHRGPCEIYIDDKMVLHGDDCEEEFPGG  363348

Query  353     -----KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                    KT D+  D+S+CNG+C L  YWLG     Q   WQ Y
Sbjct  363347  SDGSDKTSDMPVDFSSCNGNCMLTIYWLGF----QNEQWQSY  363234

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 54/99 (55%), Gaps = 18/99 (18%)
 Frame = +3

Query  303     CGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG----  352
               CG T  D A QPIP DG ++       G+TH GPCEV+LDD  V+  DNC E   G    
Sbjct  347799  CGNTLADGAAQPIPSDGKVKWLGNGGGGFTHVGPCEVYLDDKMVVHGDNCEEEFKGGDVG  347978

Query  353     --KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                 +T D+  DYSACNG CTL  YWL      Q   WQ Y
Sbjct  347979  STETSDMTVDYSACNGKCTLTIYWLAF----QNAQWQAY  348083

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 56/104 (54%), Gaps = 18/104 (17%)
 Frame = -2

Query  302     RCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------EV  349
                CG T  D + QP+P DG+ +       G+TH GPCE+++DDT VL  DNC       +V
Sbjct  427768  ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  427589

Query  350     ISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                S  T D+  DYS+C G CTL  YWLG     Q   WQ Y   +
Sbjct  427588  GSTVTSDMPVDYSSCKGDCTLTIYWLGF----QNAQWQAYSTLI  427469

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 57/112 (51%), Gaps = 17/112 (15%)
 Frame = +1

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  + + QPIP++G          G+T  GPCEI+ID+ + L G +C  EFP G   
Sbjct  382513  CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKG  382692

Query  157     -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
                      ++D+S C   C ++ +WL   +Q E+  WQ + NC+ L      T
Sbjct  382693  SDKMSEMSVDFSSCNGKCTLTIYWLA--FQNEQ--WQSYVNCVPLQGDGSAT  382836

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 57/112 (51%), Gaps = 17/112 (15%)
 Frame = +1

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  + + QPIP++G          G+T  GPCEI+ID+ + L G +C  EFP G   
Sbjct  353650  CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDG  353829

Query  157     -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
                      ++D+S C   C ++ +WL   +Q E+  WQ + NC+ L      T
Sbjct  353830  SDKMSEMSVDFSSCNGKCTLTIYWLA--FQNEQ--WQSYVNCVPLQGDGSAT  353973

 Score = 58.2 bits (139),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 6/54 (11%)
 Frame = +3

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH  347
               D +CG+T  DA PQPIP DG+++       G+TH GPCE+ +DD  VL  DNC 
Sbjct  355431  DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHSGPCEICIDDKMVLHGDNCE  355592

 Score = 31.6 bits (70),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 19/31 (61%), Gaps = 4/31 (13%)
 Frame = +2

Query  357     LDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               +DYS+CNG+C L  YWLG     Q   WQ Y
Sbjct  355643  IDYSSCNGNCMLTIYWLGF----QNAQWQAY  355723

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 62/125 (50%), Gaps = 20/125 (16%)
 Frame = -3

Query  74      QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI-----TSGY  128
               +T  AERG +    ++D      V ++    CG T  +   QPIP++G          G+
Sbjct  351357  KTMAAERGMSVKDVILD-----MVKDK---KCGYTVADAPPQPIPSDGMVKWAGNGGGGF  351202

Query  129     TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKYQGERY  185
               T  GPCEI+ID+ + L G NC  EF  G  +   IDYS C  +C ++ +WLG     +  
Sbjct  351201  THQGPCEIYIDDKMVLHGDNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGF----QNA  351034

Query  186     SWQVF  190
                WQ +
Sbjct  351033  QWQAY  351019

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 54/102 (53%), Gaps = 18/102 (18%)
 Frame = -3

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------  347
               D +CG T  D   QPIP DG ++       G+TH GPCE++LDD  VL  D+C       
Sbjct  391614  DQKCGNTLADGPAQPIPSDGKVKWLGNNGGGFTHTGPCEIYLDDKMVLHGDDCEDEFQGG  391435

Query  348     EVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               +V S KT D+  D+S+C G C L  YWL      Q   WQ Y
Sbjct  391434  DVGSKKTSDMTVDFSSCIGKCLLTIYWLAF----QNAQWQTY  391321

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 51/104 (49%), Gaps = 17/104 (16%)
 Frame = -2

Query  104     DCGLTFPNTETQPIPTNG-----SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG--  156
               +CG T  +   QP+PT+G          G+T  GPCEI+ID+T+ L G NC  E+P G  
Sbjct  427768  ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  427589

Query  157     ------HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                        +DYS C   C ++ +WLG     +   WQ +   I
Sbjct  427588  GSTVTSDMPVDYSSCKGDCTLTIYWLGF----QNAQWQAYSTLI  427469

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (53%), Gaps = 17/99 (17%)
 Frame = -1

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHH-  158
               CG T  +   QPIP++G          G+T  GPCEI+ID+ + L G +C  EFP G   
Sbjct  363518  CGYTVADAPPQPIPSDGMVKWAGNGGGGFTHRGPCEIYIDDKMVLHGDDCEEEFPGGSDG  363339

Query  159     -------TIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                       +D+S C  +C ++ +WLG  +Q E+  WQ +
Sbjct  363338  SDKTSDMPVDFSSCNGNCMLTIYWLG--FQNEQ--WQSY  363234

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 17/99 (17%)
 Frame = +3

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  +   QPIP++G          G+T  GPCE+++D+ + + G NC  EF  G   
Sbjct  347799  CGNTLADGAAQPIPSDGKVKWLGNGGGGFTHVGPCEVYLDDKMVVHGDNCEEEFKGGDVG  347978

Query  157     -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                      T+DYS C   C ++ +WL      +   WQ +
Sbjct  347979  STETSDMTVDYSACNGKCTLTIYWLAF----QNAQWQAY  348083

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 17/99 (17%)
 Frame = -3

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  +   QPIP++G          G+T  GPCEI++D+ + L G +C  EF  G   
Sbjct  391605  CGNTLADGPAQPIPSDGKVKWLGNNGGGFTHTGPCEIYLDDKMVLHGDDCEDEFQGGDVG  391426

Query  157     -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                      T+D+S C   C ++ +WL      +   WQ +
Sbjct  391425  SKKTSDMTVDFSSCIGKCLLTIYWLAF----QNAQWQTY  391321

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (53%), Gaps = 5/51 (10%)
 Frame = +3

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCH  150
               CG T  +   QPIP++G          G+T  GPCEI ID+ + L G NC 
Sbjct  355440  CGYTVADAPPQPIPSDGMVKWAGNGGGGFTHSGPCEICIDDKMVLHGDNCE  355592

 Score = 25.4 bits (54),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +2

Query  160     IDYSVCGESCRVSWFWLGIK  179
               IDYS C  +C ++ +WLG +
Sbjct  355643  IDYSSCNGNCMLTIYWLGFQ  355702

>PHKE:scaffold_155 scf_22126_155.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_155.1:1:75875:1 
REF
Length=75875

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 77/157 (49%), Gaps = 16/157 (10%)
 Frame = -3

Query  246    TVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGF  305
              T+E  D+         G     T  F    +++ + SL+ F++D +  +V   A   CG 
Sbjct  42984  TIEASDSGLS--GTFNGAPADNTAAFTTAFESSSYSSLKEFINDKATITVT-DATLTCGS  42814

Query  306    TDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL-  357
               DPD A Q +PD  +      S G+T  H+GPCEVW DDTRV Q D+C    +     L 
Sbjct  42813  CDPDEAAQALPDTYVEWAHSDSEGFTASHEGPCEVWCDDTRVFQDDDCAADYTTAPAQLP  42634

Query  358    -DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D+ AC GS T+  YWL +       +WQVY  C P+
Sbjct  42633  FDHDACLGSSTVTLYWLALH----SSTWQVYVNCAPL  42535

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 84/179 (47%), Gaps = 26/179 (15%)
 Frame = -3

Query  235    HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
              H  +  PA T+     DN  + +A +E           G     T  F    D++ + SL
Sbjct  44445  HGYMTEPAVTFLSSSTDNT-QFIATIESSASGFSGTFSGSPADNTAAFTTAFDSSKYTSL  44269

Query  284    RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
              +  ++D +  +V   A   CG  DPD   QP+P+  +      S G+T  H+GPCEVW D
Sbjct  44268  KELINDLATITVT-DATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCEVWCD  44092

Query  337    DTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              D RV Q  +C    +    +L  D+ AC G+ TL +YWL +       +WQVY  C P+
Sbjct  44091  DVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH----SSTWQVYVNCAPL  43927

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 72/157 (46%), Gaps = 16/157 (10%)
 Frame = +1

Query  246    TVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGF  305
              T+E     W       G     T  F    +++ + SL+  + D    + + S    CG+
Sbjct  39604  TIEASATGWS--GSFGGSPADNTAAFTTAFESSKYSSLKELVTDLGKLT-STSYTTECGY  39774

Query  306    TDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYD  356
              T+PD   QP+PD  +      S G+T  H+GPCEVW DD RV Q D+C  H   +     
Sbjct  39775  TNPDETAQPLPDTYVEWAHSDSEGFTPSHEGPCEVWCDDVRVFQDDDCAAHYTTAPAKLP  39954

Query  357    LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D+ AC GS  L  YWL +       +WQVY  C  +
Sbjct  39955  YDHDACLGSSRLTLYWLAL----HSSTWQVYTNCAAL  40053

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 67/135 (50%), Gaps = 18/135 (13%)
 Frame = +2

Query  268    TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIMR----  321
              T +F   + A+ + SL+ FM   +  +   S +F   CG+T+P  A QP+P+  +     
Sbjct  41069  TANFNKGMAASKYTSLKEFMAAKAKVT---SPEFTLECGYTNPKGAAQPLPETYVEWSHG  41239

Query  322    -STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVR  376
                 G+T  H+GPCEVW DDTRV Q DNC          L Y   AC GS  L  YW+ + 
Sbjct  41240  SGEGFTSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALH  41419

Query  377    YLKQVYSWQVYKACV  391
                    SWQVY  C 
Sbjct  41420  SP----SWQVYINCA  41452

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 15/132 (11%)
 Frame = +2

Query  271    FVGYLDANGFDSLRAFMDDDSLYSVNAS-ADFRCGFTDPDAAPQPIPDGI----MRSTGY  325
              F    +++ + SL+ F+   SL  + A+ A+  CG TDP+  PQP+PD +      + G+
Sbjct  31097  FTAAFNSSKYSSLKDFVT--SLGQIVATGANIECGLTDPNETPQPLPDHLEWTHSDTEGF  31270

Query  326    T--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
              T  H+GPCE W DDTRV + +NC  H   +      D + C+G+  L +YW+ +      
Sbjct  31271  TSSHEGPCEAWCDDTRVFKDENCAAHFTTAPAKMPYDDAGCDGASRLTFYWVALHSP---  31441

Query  382    YSWQVYKACVPI  393
               +WQVY  C  +
Sbjct  31442  -TWQVYANCAAL  31474

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 81/179 (45%), Gaps = 26/179 (15%)
 Frame = -3

Query  235    HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
              H  +  PA T+     DN  + +A +E           G     T  F    +++ + SL
Sbjct  23982  HGYMTDPAVTFLSSSTDNT-QFIATIESSASGFSGTFSGSPADNTAAFTTAFESSSYTSL  23806

Query  284    RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
              +  +   +  +V   A   CG  DPD   QP+P   +      S G+T  H+GPCEVW D
Sbjct  23805  KELISALATVTVT-DATLTCGSCDPDETAQPLPATYVEWSHSDSEGFTSSHEGPCEVWCD  23629

Query  337    DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              D RV Q D+C    +    +L Y   AC G+ TL ++WL +       +WQVY  C P+
Sbjct  23628  DVRVFQDDDCAVDYTSAPAELPYDRDACLGASTLTFFWLALH----SSTWQVYVNCAPL  23464

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 82/182 (45%), Gaps = 30/182 (16%)
 Frame = +3

Query  234    AHQLVILPAPTY-----------TVEGKDNRWKPLAFLEGQNFSTT--DDFVGY---LDA  277
              AH  +ILP PT+           T+EG+D     L   +G ++ST   D+ V Y    +A
Sbjct  16305  AHSYMILPLPTWPVSWGTNSPSGTIEGEDY----LPVPDGLSYSTDPYDNTVAYWTAFNA  16472

Query  278    NGFDSLRAFMDDDSLYSVNAS---ADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEV  333
              + + SL  F  +  +    A+   A   CGF+  +   + +P  +       +H+GPCEV
Sbjct  16473  SNYTSLLEFAKETQVLQTMATFGAATAECGFSLTNGTARDLPAEVEWNQLTSSHEGPCEV  16652

Query  334    WLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              W DDT V +  NC    +     L  D S C G+  L   WL +  L     WQVY  C 
Sbjct  16653  WCDDTLVFEDWNCALDYTSDPAKLPYDVSKCEGASMLTSVWLALHALP----WQVYTNCA  16820

Query  392    PI  393
              P+
Sbjct  16821  PL  16826

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 79/184 (43%), Gaps = 36/184 (20%)
 Frame = +2

Query  235    HQLVILPAPTYTVEGKDNRWKPLAFL--------------EGQNFSTTDDFVGYLDANGF  280
              H  + LP PT+  EG  N   P   +              EG   S T  +    +A+ +
Sbjct  14585  HSKMSLPKPTWIYEGGSN--SPAGTIDSSKVLPAPDGMGYEGDPLSNTKAYWTAFNASKY  14758

Query  281    DSLR------AFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM---RSTGYTHDGPC  331
               SL+        ++ DSLY    +A   CG++  +   + +PD +     +TG  HDGPC
Sbjct  14759  TSLKDLVWKNEVVNTDSLY---GTATIECGYSWTNGTARDLPDEVQWDKLTTG--HDGPC  14923

Query  332    EVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKA  389
              E+W DDT V    NC  +   S  ++  + +AC G   L   WL V        WQV+  
Sbjct  14924  EIWCDDTLVFADQNCAVNYPDSPASFPYNKAACKGKSMLTAIWLAVHSPP----WQVFTN  15091

Query  390    CVPI  393
              C P+
Sbjct  15092  CAPL  15103

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 81/181 (45%), Gaps = 28/181 (15%)
 Frame = +1

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAF---MDDD  290
              AH  +ILP PT+ V    N +   A +EG  +    D + Y   + +D+  A+    ++ 
Sbjct  17944  AHSNMILPLPTWPVSWSTNSFA--ATIEGDTYLPVPDGMSY-STDPYDNTEAYWTAFNES  18114

Query  291    SLYSVN---------------ASADFRCGFTDPDAAPQPIPDGIMRST-GYTHDGPCEVW  334
              S  S+                 +A   CGF+  +   + +P+ +  S    +H+GPCEVW
Sbjct  18115  SYTSLKDLITKTAEVQTMETFGTATLECGFSLANGTARGLPEEVEWSQLTSSHEGPCEVW  18294

Query  335    LDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
               DDT V +  NC    +     L Y  S C+G+  L  YWL +  L     WQVY  C P
Sbjct  18295  CDDTLVFEDWNCALDYTSDPAKLPYDSSKCSGTSMLTSYWLALHGLP----WQVYINCAP  18462

Query  393    I  393
              +
Sbjct  18463  L  18465

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 70/151 (46%), Gaps = 15/151 (10%)
 Frame = +2

Query  50     DGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTF  109
              DGM Y G P++    +   TA  A  + + +       +++ D LY        +CG ++
Sbjct  14684  DGMGYEGDPLS--NTKAYWTAFNASKYTSLKDLVWKNEVVNTDSLYGT---ATIECGYSW  14848

Query  110    PNTETQPIPTNGSF--ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVC  165
               N   + +P    +  +T+G+  DGPCEIW D+TL  A +NC   +P+   +  Y  + C
Sbjct  14849  TNGTARDLPDEVQWDKLTTGH--DGPCEIWCDDTLVFADQNCAVNYPDSPASFPYNKAAC  15022

Query  166    GESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                   ++  WL +        WQVF NC  L
Sbjct  15023  KGKSMLTAIWLAV----HSPPWQVFTNCAPL  15103

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 76/182 (42%), Gaps = 30/182 (16%)
 Frame = +3

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNF--------------STTDDFVGYLDANG  279
              AH  V  P PT++V      +  L  ++GQ +              S T+ +    +A+ 
Sbjct  19641  AHSYVTNPMPTWSVGYPSTNYAGL--IDGQKYLPCPKGLSYGGTPESNTNAYWKAFNASK  19814

Query  280    FDSLRAFMDDDSLY---SVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
              + SL+   D   +    S    A   CGF+  +   + +P  +     G +H GPCEVW 
Sbjct  19815  YTSLKDLADKTMVLQTLSPFGKATAECGFSIKNGTARALPKEVQWHDFGLSHQGPCEVWC  19994

Query  336    DDTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              D     +  NC     EV +   Y  D S C G+  +  YW+ V  L     WQ+Y  C+
Sbjct  19995  DGKLAFEDKNCALNYPEVPASLPY--DKSVCEGASMMQSYWIAVHGLP----WQLYLNCI  20156

Query  392    PI  393
              P+
Sbjct  20157  PL  20162

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 76/176 (43%), Gaps = 22/176 (13%)
 Frame = +2

Query  234    AHQLVILPAPTY--------TVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDANGF  280
              AH  + +P PT+        +  G  +    L    G +++T     T  +    +++ +
Sbjct  12602  AHNKMTVPVPTWPAGFYAQNSPSGTIDAAAVLPVPSGMSYTTDSTSNTKAYWTAFNSSKY  12781

Query  281    DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRST-GYTHDGPCEVWLDDTR  339
               SL+    D    +  AS +  CGF+  D  P+ +PD +       +H GPCEVW DDT 
Sbjct  12782  KSLKELAWDTQTLADGASNE--CGFSLVDGTPRELPDMVQWDFFTASHQGPCEVWCDDTL  12955

Query  340    VLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                + +NC         +L Y  + C GS  L  YW+ +        WQ+Y  C P+
Sbjct  12956  TFEDENCALNYPDTPANLPYDKAKCAGSAVLTSYWIALH----TTPWQIYTNCAPL  13111

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 22/133 (17%)
 Frame = -1

Query  271    FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPD-----AAPQPI-----PDGIM  320
              F+ +L  + + SL+A ++ + +  V+  A   CGFTDPD     A    I     PD + 
Sbjct  22139  FMEHLKKSPYKSLKAMINANQVL-VSKDATPTCGFTDPDQTHYGALNDTIIFGRSPD-VS  21966

Query  321    RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT------YDLDYSACNGSCTLYWYWLG  374
               + G+ H GPCE W DD +V Q+ +C E  + K+        +  +AC  +  L +YW+G
Sbjct  21965  IAEGFVHPGPCETWCDDNQVQQNMHCDEAYNPKSGGGGAPMPIKKAACANAKRLTFYWIG  21786

Query  375    VRYLKQVYSWQVY  387
              +       +WQVY
Sbjct  21785  MHGP----TWQVY  21759

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 75/170 (44%), Gaps = 22/170 (13%)
 Frame = +3

Query  32     SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
              +GL +GQ  L  P      G+ Y G+P +       +T    + + A + Y +L+ L D 
Sbjct  19704  AGLIDGQKYLPCP-----KGLSYGGTPES-------NTNAYWKAFNASK-YTSLKDLADK  19844

Query  92     DGLYSVTE---EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRN  148
                +        +   +CG +  N   + +P    +   G +  GPCE+W D  LA   +N
Sbjct  19845  TMVLQTLSPFGKATAECGFSIKNGTARALPKEVQWHDFGLSHQGPCEVWCDGKLAFEDKN  20024

Query  149    CHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              C   +PE   ++ Y  SVC  +  +  +W+ +        WQ++ NCI L
Sbjct  20025  CALNYPEVPASLPYDKSVCEGASMMQSYWIAV----HGLPWQLYLNCIPL  20162

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 17/130 (13%)
 Frame = +2

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------NGSFITSGY  128
              +A   Y +L+  M      + + E   +CG T P    QP+P         +G   TS +
Sbjct  41090  MAASKYTSLKEFMAAKAKVT-SPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGFTSSH  41266

Query  129    TLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
                +GPCE+W D+T      NC   FP     + Y    C  S  ++ +W+ +       S
Sbjct  41267  --EGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIAL----HSPS  41428

Query  187    WQVFKNCINL  196
              WQV+ NC  L
Sbjct  41429  WQVYINCAAL  41458

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 59/122 (48%), Gaps = 12/122 (10%)
 Frame = +2

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEI  136
              Y++L+  +   G    T   + +CGLT PN   QP+P +  +    T G+T   +GPCE 
Sbjct  31124  YSSLKDFVTSLGQIVATGANI-ECGLTDPNETPQPLPDHLEWTHSDTEGFTSSHEGPCEA  31300

Query  137    WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              W D+T      NC   F      + Y  + C  + R++++W+ +       +WQV+ NC 
Sbjct  31301  WCDDTRVFKDENCAAHFTTAPAKMPYDDAGCDGASRLTFYWVALH----SPTWQVYANCA  31468

Query  195    NL  196
               L
Sbjct  31469  AL  31474

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 59/126 (47%), Gaps = 13/126 (10%)
 Frame = +1

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYT--LDGPCE  135
              Y++L+ L+ D G  + T     +CG T P+   QP+P          + G+T   +GPCE
Sbjct  39700  YSSLKELVTDLGKLTSTSYTT-ECGYTNPDETAQPLPDTYVEWAHSDSEGFTPSHEGPCE  39876

Query  136    IWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
              +W D+       +C   +      +  D+  C  S R++ +WL +       +WQV+ NC
Sbjct  39877  VWCDDVRVFQDDDCAAHYTTAPAKLPYDHDACLGSSRLTLYWLAL----HSSTWQVYTNC  40044

Query  194    INLSAS  199
                L ++
Sbjct  40045  AALEST  40062

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 62/155 (40%), Gaps = 17/155 (11%)
 Frame = +1

Query  48     VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEE---GLFD  104
              V DGM Y   P  Y   +   TA        E  Y +L+ L+         E       +
Sbjct  18040  VPDGMSYSTDP--YDNTEAYWTAFN------ESSYTSLKDLITKTAEVQTMETFGTATLE  18195

Query  105    CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--  162
              CG +  N   + +P    +     + +GPCE+W D+TL     NC  ++      + Y  
Sbjct  18196  CGFSLANGTARGLPEEVEWSQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAKLPYDS  18375

Query  163    SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
              S C  +  ++ +WL +        WQV+ NC  L+
Sbjct  18376  SKCSGTSMLTSYWLALH----GLPWQVYINCAPLT  18468

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (48%), Gaps = 13/123 (11%)
 Frame = -3

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
              Y +L+ L++D    +VT+  L  CG   P+   QP+P          + G+T   +GPCE
Sbjct  44280  YTSLKELINDLATITVTDATL-TCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCE  44104

Query  136    IWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
              +W D+      ++C  ++      +  D+  C  +  ++++WL +       +WQV+ NC
Sbjct  44103  VWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLAL----HSSTWQVYVNC  43936

Query  194    INL  196
                L
Sbjct  43935  APL  43927

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (45%), Gaps = 13/130 (10%)
 Frame = -3

Query  75     TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
              T      Y++L+  ++D    +VT+  L  CG   P+   Q +P          + G+T 
Sbjct  42909  TAFESSSYSSLKEFINDKATITVTDATL-TCGSCDPDEAAQALPDTYVEWAHSDSEGFTA  42733

Query  131    --DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYS  186
                +GPCE+W D+T      +C  ++      +  D+  C  S  V+ +WL +       +
Sbjct  42732  SHEGPCEVWCDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLAL----HSST  42565

Query  187    WQVFKNCINL  196
              WQV+ NC  L
Sbjct  42564  WQVYVNCAPL  42535

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 61/135 (45%), Gaps = 17/135 (13%)
 Frame = -3

Query  75     TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSGY  128
              T      Y +L+ L+      +VT+  L  CG   P+   QP+P   +++      + G+
Sbjct  23838  TAFESSSYTSLKELISALATVTVTDATL-TCGSCDPDETAQPLP--ATYVEWSHSDSEGF  23668

Query  129    TL--DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGER  184
              T   +GPCE+W D+       +C  ++      + Y    C  +  +++FWL +      
Sbjct  23667  TSSHEGPCEVWCDDVRVFQDDDCAVDYTSAPAELPYDRDACLGASTLTFFWLAL----HS  23500

Query  185    YSWQVFKNCINLSAS  199
               +WQV+ NC  L A+
Sbjct  23499  STWQVYVNCAPLEAT  23455

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 66/168 (39%), Gaps = 16/168 (10%)
 Frame = +3

Query  32     SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
              SG  EG+  L  P     DG+ Y   P  Y       TA  A  + +   +A    ++  
Sbjct  16368  SGTIEGEDYLPVP-----DGLSYSTDP--YDNTVAYWTAFNASNYTSLLEFAKETQVLQT  16526

Query  92     DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
                 +        +CG +  N   + +P    +     + +GPCE+W D+TL     NC  
Sbjct  16527  MATFGA---ATAECGFSLTNGTARDLPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCAL  16697

Query  152    EFPEGHHTIDYSV--CGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
              ++      + Y V  C  +  ++  WL +        WQV+ NC  L+
Sbjct  16698  DYTSDPAKLPYDVSKCEGASMLTSVWLAL----HALPWQVYTNCAPLT  16829

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/97 (26%), Positives = 45/97 (46%), Gaps = 10/97 (10%)
 Frame = +2

Query  104    DCGLTFPNTETQPIP--TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTID  161
              +CG +  +   + +P      F T+ +   GPCE+W D+TL     NC   +P+    + 
Sbjct  12839  ECGFSLVDGTPRELPDMVQWDFFTASH--QGPCEVWCDDTLTFEDENCALNYPDTPANLP  13012

Query  162    Y--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              Y  + C  S  ++ +W+ +        WQ++ NC  L
Sbjct  13013  YDKAKCAGSAVLTSYWIAL----HTTPWQIYTNCAPL  13111

 Score = 38.5 bits (88),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 58/129 (45%), Gaps = 21/129 (16%)
 Frame = -1

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI---------TSG  127
              L +  Y +L+A+++ + +  V+++    CG T P+ +T     N + I           G
Sbjct  22127  LKKSPYKSLKAMINANQVL-VSKDATPTCGFTDPD-QTHYGALNDTIIFGRSPDVSIAEG  21954

Query  128    YTLDGPCEIWIDNTLALAGRNCHTEF-PE-----GHHTIDYSVCGESCRVSWFWLGIKYQ  181
              +   GPCE W D+       +C   + P+         I  + C  + R++++W+G+   
Sbjct  21953  FVHPGPCETWCDDNQVQQNMHCDEAYNPKSGGGGAPMPIKKAACANAKRLTFYWIGM---  21783

Query  182    GERYSWQVF  190
                  +WQV+
Sbjct  21782  -HGPTWQVY  21759

>PHPA:scaffold_12 NW_008648998.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.12, whole genome shotgun 
sequence
Length=1504206

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 18/108 (17%)
 Frame = -3

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG+T  D  P+PIP DG ++       G+TH GPCE+++DD  VL  DNC E   G 
Sbjct  393064  DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGG  392885

Query  353     -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                          +D+S+CNG CTL  YWLG     Q   WQ Y  CVP+
Sbjct  392884  PDGSEKMSEMPVDFSSCNGKCTLTIYWLGF----QNAQWQAYVNCVPL  392753

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 18/108 (17%)
 Frame = +2

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG+T  D  P+PIP DG ++       G+TH GPCE+++DD  VL  DNC E   G 
Sbjct  384662  DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGG  384841

Query  353     -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                          +D+S+CNG CTL  YWLG     Q   WQ Y  CVP+
Sbjct  384842  PDGSEKMSEMPVDFSSCNGKCTLTIYWLGF----QNAQWQAYVNCVPL  384973

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 18/102 (18%)
 Frame = -2

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG T  +  PQPIP DG ++       G+TH GPCE++LDD  VL  D+C +   G 
Sbjct  446573  DQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGG  446394

Query  353     -----KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                    +T D+  D+S+CNG C L  YWL      Q   WQ Y
Sbjct  446393  PNGSKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTY  446280

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 18/102 (18%)
 Frame = -2

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG T  +  PQPIP DG ++       G+TH GPCE++LDD  VL  D+C +   G 
Sbjct  454778  DQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGG  454599

Query  353     -----KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                    +T D+  D+S+CNG C L  YWL      Q   WQ Y
Sbjct  454598  PNGSKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTY  454485

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 54/114 (47%), Gaps = 17/114 (15%)
 Frame = -3

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  + + +PIP +G          G+T  GPCE++ID+ + L G NC  +FP G   
Sbjct  393055  CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDG  392876

Query  157     -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMI  205
                       +D+S C   C ++ +WLG     +   WQ + NC+ L  S   T  
Sbjct  392875  SEKMSEMPVDFSSCNGKCTLTIYWLGF----QNAQWQAYVNCVPLQGSGSATQT  392726

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 54/114 (47%), Gaps = 17/114 (15%)
 Frame = +2

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  + + +PIP +G          G+T  GPCE++ID+ + L G NC  +FP G   
Sbjct  384671  CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDG  384850

Query  157     -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMI  205
                       +D+S C   C ++ +WLG     +   WQ + NC+ L  S   T  
Sbjct  384851  SEKMSEMPVDFSSCNGKCTLTIYWLGF----QNAQWQAYVNCVPLQGSGSATQT  385000

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 53/103 (51%), Gaps = 18/103 (17%)
 Frame = -1

Query  299     ADFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH-----  347
               A   CG T  D   QPIP DG+ +       G+TH GPCE++LDD  VL  DNC      
Sbjct  457830  AGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYPG  457651

Query  348     -EVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                +V S  T D+  DYS+C   CTL  YWL      Q  +WQ Y
Sbjct  457650  GDVGSTVTSDMPVDYSSCTEDCTLTIYWLAF----QNANWQAY  457534

 Score = 54.3 bits (129),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 36/71 (51%), Gaps = 12/71 (17%)
 Frame = +1

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYD--------LDYSACNGSCTLYWYWLGVRYLKQ  380
               GPCE+++DD  VL  D+C     G   D        +DYS+CNG+C    YWLG R  + 
Sbjct  432811  GPCELYIDDKMVLHSDDCESDYPGGPNDSGEMSVMPVDYSSCNGNCIFSIYWLGFRNAQ-  432987

Query  381     VYSWQVYKACV  391
                  WQ Y  C 
Sbjct  432988  ---WQAYSTCA  433011

 Score = 31.6 bits (70),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 0/28 (0%)
 Frame = +2

Query  300     DFRCGFTDPDAAPQPIPDGIMRSTGYTH  327
               D +CGFT  D  PQP+P       G+TH
Sbjct  432662  DKKCGFTTTDVGPQPVPADGKAK*GFTH  432745

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 17/100 (17%)
 Frame = -1

Query  104     DCGLTFPNTETQPIPTNG-----SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG--  156
               +CG T  +   QPIP++G          G+T  GPCEI++D+ + L G NC  E+P G  
Sbjct  457821  ECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYPGGDV  457642

Query  157     ------HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                        +DYS C E C ++ +WL      +  +WQ +
Sbjct  457641  GSTVTSDMPVDYSSCTEDCTLTIYWLAF----QNANWQAY  457534

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 17/99 (17%)
 Frame = -2

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEF---PEG  156
               CG T  N + QPIP +G          G+T  GPCEI++D+ + L G +C  EF   P G
Sbjct  446564  CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  446385

Query  157     HHT-----IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                       +D+S C   C ++ +WL      +   WQ +
Sbjct  446384  SKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTY  446280

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 17/99 (17%)
 Frame = -2

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEF---PEG  156
               CG T  N + QPIP +G          G+T  GPCEI++D+ + L G +C  EF   P G
Sbjct  454769  CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  454590

Query  157     HHT-----IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                       +D+S C   C ++ +WL      +   WQ +
Sbjct  454589  SKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTY  454485

 Score = 47.4 bits (111),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 37/72 (51%), Gaps = 12/72 (17%)
 Frame = +1

Query  130     LDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGESCRVSWFWLGIKYQ  181
               L GPCE++ID+ + L   +C +++P G +         +DYS C  +C  S +WLG +  
Sbjct  432805  L*GPCELYIDDKMVLHSDDCESDYPGGPNDSGEMSVMPVDYSSCNGNCIFSIYWLGFR--  432978

Query  182     GERYSWQVFKNC  193
                    WQ +  C
Sbjct  432979  --NAQWQAYSTC  433008

 Score = 20.8 bits (42),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 7/18 (39%), Positives = 10/18 (56%), Gaps = 0/18 (0%)
 Frame = +2

Query  105     CGLTFPNTETQPIPTNGS  122
               CG T  +   QP+P +G 
Sbjct  432671  CGFTTTDVGPQPVPADGK  432724

>PHCA:scaffold_98 PHYCAscaffold_98
Length=130742

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 68/128 (53%), Gaps = 17/128 (13%)
 Frame = +2

Query  277    ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
              +NG+  +R  +D D SLY  +      CG+T+ DA  +  P       S G  H GPCE+
Sbjct  81218  SNGYSDIRTLLDSDTSLYGAD------CGYTNADATAKDPPSTGDATFSRGMVHVGPCEI  81379

Query  334    WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
              WLDDT VL +D+C       T D       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  81380  WLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVWQ  81559

Query  386    VYKACVPI  393
              VYK CVP+
Sbjct  81560  VYKDCVPL  81583

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 16/133 (12%)
 Frame = +2

Query  78     AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
              +  GY+ +R L+D D  LY        DCG T  +   +  P+ G +  + G    GPCE
Sbjct  81215  SSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVGPCE  81376

Query  136    IWIDNTLALAGRNCHTEFPEG-------HHTIDYSVCGES-CRVSWFWLGIKYQGERYSW  187
              IW+D+T+ L+  +C T + +G          +DYS C  S C + ++WL  +       W
Sbjct  81377  IWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVW  81556

Query  188    QVFKNCINLSASA  200
              QV+K+C+ L+  A
Sbjct  81557  QVYKDCVPLTGPA  81595

>PHKE:scaffold_250 scf_22126_250.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_250.1:1:52150:1 
REF
Length=52150

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 68/132 (52%), Gaps = 13/132 (10%)
 Frame = +3

Query  270    DFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGY  325
              DF     A+ + SL+ +++D +  +V   A   CG  DPD  PQP+P  +      S G+
Sbjct  12789  DFTKAFGASKYKSLKEYVEDKAKITVTG-ATLECGSCDPDQTPQPVPKTVEWSHSDSEGF  12965

Query  326    T--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQV  381
              T  H+GPCEVW D TR  Q DNC    +    +L Y  S C G+  L +YW+ +      
Sbjct  12966  TASHEGPCEVWCDGTRAFQDDNCPAHFTMIPAELPYEQSKCTGASRLTFYWMAMH----S  13133

Query  382    YSWQVYKACVPI  393
               +WQVY  C P+
Sbjct  13134  DTWQVYVNCAPL  13169

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 13/131 (10%)
 Frame = -2

Query  271    FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT  326
              F     A+ + SL+A +DD +  +V + A   CG  DP AA QP+P  +      S G+T
Sbjct  45309  FTKAFKASSYKSLKALIDDKAKITV-SGATLTCGSADPSAAAQPLPSTLEWSHSDSEGFT  45133

Query  327    --HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
                H+GPCE W DD RV Q +NC         ++ Y  S+ +G+  L +YW+ +       
Sbjct  45132  PSHEGPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP----  44965

Query  383    SWQVYKACVPI  393
              SWQVY  C  +
Sbjct  44964  SWQVYVNCAAL  44932

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 66/129 (51%), Gaps = 13/129 (10%)
 Frame = +2

Query  271    FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT  326
              F     A+ + +L+A +DD +  SV   A   CG  DP+AAPQP+P  +      S G++
Sbjct  17273  FTKAFKASKYKTLKALIDDKTKISV-PGATLTCGSADPNAAPQPLPAKLEWAHSDSEGFS  17449

Query  327    --HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
                H+GPCE W D TRV   +NC  H   +      + S C+G+  L ++W+ +       
Sbjct  17450  PSHEGPCEAWCDTTRVFHDENCAAHFKTAPAVMPYEKSKCSGAKKLIFFWIAMHGP----  17617

Query  383    SWQVYKACV  391
              SWQVY  C 
Sbjct  17618  SWQVYVNCA  17644

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 78/178 (44%), Gaps = 23/178 (13%)
 Frame = +1

Query  235    HQLVILPAPTYTVEGKDNRWKP-------LAFLEGQNFST-----TDDFVGYLDANGFDS  282
              H  ++ P PT+ V    N +         L   +G ++ST     T+ +    + + + S
Sbjct  19948  HSYMVDPMPTWPVSWSTNNFAATIAGQTYLPCPDGMSYSTAPELNTEAYWTAFNESSYTS  20127

Query  283    LRAFMD---DDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT--HDGPCEVWLDD  337
              L+  +D   +    S   +A   CGF+  +   + +P   +     T  HDGPCEVW DD
Sbjct  20128  LKDLVDQTGEVQTLSPFGTATLECGFSLANGTARDLPSQYVEWNQLTEGHDGPCEVWCDD  20307

Query  338    TRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  Q DNC  +   S   +  D S C+ +  L  YW+ +  L     WQVY  CVP+
Sbjct  20308  VLAFQDDNCAVNYPESPSQWPYDVSKCSSASQLTAYWIALHGLP----WQVYINCVPL  20469

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 70/158 (44%), Gaps = 22/158 (14%)
 Frame = +1

Query  50     DGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE---EGLFDCG  106
              DGM Y  +P   L  +   TA        E  Y +L+ L+D  G             +CG
Sbjct  20047  DGMSYSTAP--ELNTEAYWTAFN------ESSYTSLKDLVDQTGEVQTLSPFGTATLECG  20202

Query  107    LTFPNTETQPIPTN---GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--ID  161
               +  N   + +P+     + +T G+  DGPCE+W D+ LA    NC   +PE       D
Sbjct  20203  FSLANGTARDLPSQYVEWNQLTEGH--DGPCEVWCDDVLAFQDDNCAVNYPESPSQWPYD  20376

Query  162    YSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
               S C  + +++ +W+ +        WQV+ NC+ L+ S
Sbjct  20377  VSKCSSASQLTAYWIALH----GLPWQVYINCVPLTGS  20478

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 12/125 (10%)
 Frame = +2

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--DGPCEI  136
              Y TL+AL+DD    SV    L  CG   PN   QP+P    +  S   G++   +GPCE 
Sbjct  17300  YKTLKALIDDKTKISVPGATLT-CGSADPNAAPQPLPAKLEWAHSDSEGFSPSHEGPCEA  17476

Query  137    WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              W D T      NC   F      + Y  S C  + ++ +FW+ +       SWQV+ NC 
Sbjct  17477  WCDTTRVFHDENCAAHFKTAPAVMPYEKSKCSGAKKLIFFWIAM----HGPSWQVYVNCA  17644

Query  195    NLSAS  199
               LS S
Sbjct  17645  TLSGS  17659

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 57/122 (47%), Gaps = 12/122 (10%)
 Frame = -2

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYT--LDGPCEI  136
              Y +L+AL+DD    +V+   L  CG   P+   QP+P+   +  S   G+T   +GPCE 
Sbjct  45282  YKSLKALIDDKAKITVSGATLT-CGSADPSAAAQPLPSTLEWSHSDSEGFTPSHEGPCEA  45106

Query  137    WIDNTLALAGRNCHTEFPEGHHTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCI  194
              W D+       NC   FP     + Y     S   R+ ++W+ +       SWQV+ NC 
Sbjct  45105  WCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAM----HGPSWQVYVNCA  44938

Query  195    NL  196
               L
Sbjct  44937  AL  44932

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 12/122 (10%)
 Frame = +3

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--DGPCEI  136
              Y +L+  ++D    +VT   L +CG   P+   QP+P    +  S   G+T   +GPCE+
Sbjct  12819  YKSLKEYVEDKAKITVTGATL-ECGSCDPDQTPQPVPKTVEWSHSDSEGFTASHEGPCEV  12995

Query  137    WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              W D T A    NC   F      + Y  S C  + R++++W+ +       +WQV+ NC 
Sbjct  12996  WCDGTRAFQDDNCPAHFTMIPAELPYEQSKCTGASRLTFYWMAMHSD----TWQVYVNCA  13163

Query  195    NL  196
               L
Sbjct  13164  PL  13169

>SADI:scaffold_134 supercont1.134 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.134:1:99377:1 
REF
Length=99377

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 82/177 (46%), Gaps = 28/177 (16%)
 Frame = -1

Query  234    AHQLVILPAPTYTVEGKDNRWK-------PLAFLEGQNFS-----TTDDFVGYLDANGFD  281
               H  +I P PT+  E   +R K       P+  L G +++      T  F     A+ F 
Sbjct  58913  GHGFLINPTPTFN-ELNGDRTKYCGTIDGPV-VLPGSSYNQDPAWNTRQFTMQFRASKFQ  58740

Query  282    SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----THDGPCEVWLD  336
              +L +F+DD S           CG T+ + APQP+P  +  + G      +H+GPCEVW D
Sbjct  58739  TLASFVDDPSFAPCGT-----CGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVWCD  58575

Query  337    DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               TRV Q+DNC          +D + C G+  L   WL +       SWQVY  CVP+
Sbjct  58574  STRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCVPL  58416

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 77/178 (43%), Gaps = 34/178 (19%)
 Frame = -1

Query  233    MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFST--------------TDDFVGYLDAN  278
              + H  ++ P P +T    D    P  F    N  T              TD F  +  A+
Sbjct  55802  VGHGHLVDPVPAFT----DKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKAS  55635

Query  279    GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----THDGPCEV  333
               F +L+AF+D    Y         CG TD +   QP+P  +  + G      +H GPCE+
Sbjct  55634  SFKTLKAFLD---AYPTGGD----CGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCEL  55476

Query  334    WLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              W D+TRV Q DNC   +      +D S C+G+  L   WL +   +    WQVYK CV
Sbjct  55475  WCDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCV  55314

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 62/126 (49%), Gaps = 21/126 (17%)
 Frame = -1

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-----NG--SFITSGYTLDGPC  134
              + TL+A +D    Y        DCG+T  N   QP+P+     NG   FI+S     GPC
Sbjct  55631  FKTLKAFLD---AYPTGG----DCGITDSNGPAQPLPSTVKWANGQEGFISS---HQGPC  55482

Query  135    EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              E+W D T      NC    P+G  +ID S C  + R++  WL +        WQV+KNC+
Sbjct  55481  ELWCDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLAL----HTPEWQVYKNCV  55314

Query  195    NLSASA  200
              NLS  A
Sbjct  55313  NLSGVA  55296

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 19/127 (15%)
 Frame = -1

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-----NGS--FITSGYTLDGPC  134
              + TL + +DD             CG+T  N   QP+P+     NG   F+ S    +GPC
Sbjct  58745  FQTLASFVDDPSFAPCGT-----CGITNANGAPQPLPSVLKWANGQEGFVAS---HEGPC  58590

Query  135    EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              E+W D+T      NC      G  +ID + C  + ++   WL +       SWQV+ NC+
Sbjct  58589  EVWCDSTRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCV  58422

Query  195    NLSASAL  201
               LS S +
Sbjct  58421  PLSGSTI  58401

 Score = 35.0 bits (79),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +2

Query  329    GPCEVWLDDTRVLQHDNCHEVISGKTYDLD  358
              GPCE+W D+TRV  ++NC + I+  +  +D
Sbjct  69329  GPCELWCDNTRVYDNENCAKNIADGSMPID  69418

>PHRA:scaffold_89
Length=200592

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 58/108 (54%), Gaps = 18/108 (17%)
 Frame = -2

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
               D +CG+T  D  PQPIP DG ++       G+TH GPCE+++DDT VL  D+C E   G 
Sbjct  124517  DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  124338

Query  353     -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                          +DYS+CNG CTL  YWL      Q   WQ Y  CV +
Sbjct  124337  PDGSNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVSL  124206

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 58/100 (58%), Gaps = 18/100 (18%)
 Frame = -1

Query  302     RCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------EV  349
               +CG TD  A+PQPIP DG  +       G+TH GPCE++LDDT VL  DNC       +V
Sbjct  129432  KCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  129253

Query  350     ISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                S +T D+  DYS+CNG CTL  YWL      Q   WQ Y
Sbjct  129252  GSTQTSDMPVDYSSCNGKCTLTIYWLAF----QNAQWQAY  129145

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 60/111 (54%), Gaps = 18/111 (16%)
 Frame = -1

Query  295     VNASADFRCGFTDPDAAPQPI-PDGIM-----RSTGYTHDGPCEVWLDDTRVLQHDNCHE  348
               ++ + ++ CG+T  D  P+ I  DG+         G+TH GPCE++LDDT +L  DNC +
Sbjct  123213  MSLALEYPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCED  123034

Query  349     VISGKTYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                 SG   D        +DYS+CNG+CTL  YWLG     Q   WQ Y   V
Sbjct  123033  EYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF----QNEQWQAYSEWV  122893

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 57/117 (49%), Gaps = 17/117 (15%)
 Frame = -2

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  + + QPIPT+G          G+T  GPCEI+ID+T+ L G +C  E+P G   
Sbjct  124508  CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  124329

Query  157     -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGLQ  208
                       +DYS C   C ++ +WL      +   WQ + NC++L  S   T    Q
Sbjct  124328  SNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVSLKGSGSATQTQTQ  124170

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 55/102 (54%), Gaps = 18/102 (18%)
 Frame = +2

Query  300     DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------  347
               D +CG TD  AAPQ +P DG  +       G+TH GPCE+++DD  VL  DNC       
Sbjct  112355  DKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGG  112534

Query  348     EVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               +V S  T D+  DYS+CNG CT   YWL      Q   WQ Y
Sbjct  112535  DVGSTVTSDMPVDYSSCNGDCTFTIYWLAF----QNAQWQAY  112648

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 17/112 (15%)
 Frame = -1

Query  103     FDCGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG-  156
               + CG T  + + + I T+G  I       G+T  GPCEI++D+T+ L G NC  E+  G 
Sbjct  123195  YPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGGA  123016

Query  157     -------HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASAL  201
                         IDYS C  +C ++ +WLG  +Q E   WQ +   +     A+
Sbjct  123015  DDSGIMSDMPIDYSSCNGACTLAIYWLG--FQNE--QWQAYSEWVEQQLPAV  122872

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 54/114 (47%), Gaps = 22/114 (19%)
 Frame = -1

Query  105     CGLTFPNTETQPIPTNGSF-----ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  +   QPIP++G          G+T  GPCEI++D+T+ L   NC  ++P G   
Sbjct  129429  CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  129250

Query  157     -----HHTIDYSVCGESCRVSWFWLGIK-YQGERYS--------WQVFKNCINL  196
                       +DYS C   C ++ +WL  +  Q + Y         W +F  C+++
Sbjct  129249  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQWQAYGKSATFAVLWSLFLTCVSV  129088

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 17/99 (17%)
 Frame = +2

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  +   Q +PT+G          G+T  GPCEI+ID+ + L G NC  ++P G   
Sbjct  112364  CGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDVG  112543

Query  157     -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                       +DYS C   C  + +WL      +   WQ +
Sbjct  112544  STVTSDMPVDYSSCNGDCTFTIYWLAF----QNAQWQAY  112648

 Score = 38.1 bits (87),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 4/35 (11%)
 Frame = -2

Query  357     LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               +DYS+CNG+CTL  YWLG     Q   WQ Y   V
Sbjct  194978  IDYSSCNGACTLAIYWLGF----QNEQWQAYSEWV  194886

>PYUU:scaffold_2036 scf1117875582036 dna:supercontig supercontig:pug:scf1117875582036:1:1090657:1 
REF
Length=1090657

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 67/127 (53%), Gaps = 14/127 (11%)
 Frame = -3

Query  264     NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-  321
                F T   +       G+  L++F++D             CG + PDA  +PIP DG+++ 
Sbjct  713540  TFRTGAQYAAVAPGKGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKL  713388

Query  322     STGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQ  380
               ++   H GPCEVW DD R    D+C +   S  ++ +D+SAC GSC L +YWLG++   +
Sbjct  713387  ASTIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQDGGK  713208

Query  381     VYSWQVY  387
                  WQ Y
Sbjct  713207  --RWQSY  713193

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 68/129 (53%), Gaps = 14/129 (11%)
 Frame = +2

Query  265     FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
               F T   +       G+  L++F+D         S    CG T  +A  + IP DG+++ +
Sbjct  704531  FRTGAQYAAVAPKKGYKDLKSFLD---------SKGPTCGNTLSNAKAKAIPKDGMLKFA  704683

Query  323     TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
               +   H GPCE+WL +TR   +D+C +   S  ++ +D+SAC G+C L +YWLG++   + 
Sbjct  704684  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  704860

Query  382     YSWQVYKAC  390
                 WQ Y  C
Sbjct  704861  -RWQSYSKC  704884

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 63/115 (55%), Gaps = 12/115 (10%)
 Frame = -2

Query  265     FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
               F T   +       G+  L++F+D         S    CG T  +A  + IP DG+++ +
Sbjct  707613  FRTGAQYAAVAPKKGYKDLKSFLD---------SKGPTCGNTLSNAKAKAIPKDGMLKFA  707461

Query  323     TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVR  376
               +   H GPCE+WL +TR   +D+C +   S  ++ +D+SAC G+C L +YWLG++
Sbjct  707460  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ  707296

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 63/115 (55%), Gaps = 12/115 (10%)
 Frame = -1

Query  265     FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
               F T   +       G+  L++F+D         S    CG T  +A  + IP DG+++ +
Sbjct  702481  FRTGAQYAAVAPKKGYKDLKSFLD---------SKGPTCGNTLSNAKAKAIPKDGMLKFA  702329

Query  323     TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVR  376
               +   H GPCE+WL +TR   +D+C +   S  ++ +D+SAC G+C L +YWLG++
Sbjct  702328  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ  702164

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 67/126 (53%), Gaps = 14/126 (11%)
 Frame = -2

Query  265     FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
               F T   +       G+  L++F+D         S    CG T  +A  + IP DG+++ +
Sbjct  697458  FRTGAQYAAVAPKKGYKDLKSFLD---------SKGPTCGNTLSNAKAKAIPKDGMLKFA  697306

Query  323     TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
               +   H GPCE+WL +TR   +D+C +   S  ++ +D+SAC G+C L +YWLG++   + 
Sbjct  697305  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  697129

Query  382     YSWQVY  387
                 WQ Y
Sbjct  697128  -RWQSY  697114

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 56/117 (48%), Gaps = 13/117 (11%)
 Frame = +2

Query  79      ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
               ++GY  L++ +D  G           CG T  N + + IP +G     S     GPCEIW
Sbjct  704567  KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  704719

Query  138     IDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               + NT A    +C   F       ID+S C  +C + ++WLG++  G+R  WQ +  C
Sbjct  704720  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYSKC  704884

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 13/113 (12%)
 Frame = -3

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIWI  138
               +GY  L++ ++D G           CG + P+ + +PIP++G   + S     GPCE+W 
Sbjct  713498  KGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWF  713346

Query  139     DNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               D+  A    +C   F       +D+S C  SC + ++WLG++  G+R  WQ +
Sbjct  713345  DDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQDGGKR--WQSY  713193

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 55/114 (48%), Gaps = 13/114 (11%)
 Frame = -2

Query  79      ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
               ++GY  L++ +D  G           CG T  N + + IP +G     S     GPCEIW
Sbjct  707577  KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  707425

Query  138     IDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               + NT A    +C   F       ID+S C  +C + ++WLG++  G+R  WQ +
Sbjct  707424  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSY  707269

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 55/114 (48%), Gaps = 13/114 (11%)
 Frame = -1

Query  79      ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
               ++GY  L++ +D  G           CG T  N + + IP +G     S     GPCEIW
Sbjct  702445  KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  702293

Query  138     IDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               + NT A    +C   F       ID+S C  +C + ++WLG++  G+R  WQ +
Sbjct  702292  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSY  702137

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 55/114 (48%), Gaps = 13/114 (11%)
 Frame = -2

Query  79      ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
               ++GY  L++ +D  G           CG T  N + + IP +G     S     GPCEIW
Sbjct  697422  KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  697270

Query  138     IDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               + NT A    +C   F       ID+S C  +C + ++WLG++  G+R  WQ +
Sbjct  697269  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSY  697114

>PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 
genomic scaffold, whole genome shotgun sequence
Length=80461

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = -2

Query  267    TTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGY  325
              T ++F  +   NG+ SL  FMD  + Y V+  AD  CG+TDP   PQ  P DG MR+TGY
Sbjct  80451  TQENFTQFQVDNGYKSLLDFMDR-AKYKVSKGADQACGWTDPKGIPQQFPEDGTMRTTGY  80275

Query  326    THDGPCEVWLDDTRVLQHDNCHEVISGKT  354
              THDGPCE+++ +   L + NCHE I  +T
Sbjct  80274  THDGPCEIYMGEKLALSYLNCHESIPEQT  80188

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  76     WLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCE  135
              +  + GY +L   MD    Y V++     CG T P    Q  P +G+  T+GYT DGPCE
Sbjct  80430  FQVDNGYKSLLDFMDR-AKYKVSKGADQACGWTDPKGIPQQFPEDGTMRTTGYTHDGPCE  80254

Query  136    IWIDNTLALAGRNCHTEFPE  155
              I++   LAL+  NCH   PE
Sbjct  80253  IYMGEKLALSYLNCHESIPE  80194

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = -1

Query  293    YSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWL  335
              Y V   AD  CG++DP+  PQ IP DG MR++ YTHDGPCE+++
Sbjct  40621  YKVTEGADQACGWSDPNGIPQQIPEDGTMRTSNYTHDGPCEIYM  40490

 Score = 43.1 bits (100),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -1

Query  95     YSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWI  138
              Y VTE     CG + PN   Q IP +G+  TS YT DGPCEI++
Sbjct  40621  YKVTEGADQACGWSDPNGIPQQIPEDGTMRTSNYTHDGPCEIYM  40490

>APAS:scaffold_33 supercont1.33 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.33:1:657536:1 
REF
Length=657536

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 83/180 (46%), Gaps = 35/180 (19%)
 Frame = +2

Query  233     MAHQLVILPAPTYTVEGKDNRWKPLAF---------LEGQNFS-----TTDDFVGYLDAN  278
               +AH  ++ P PT+   G D    P  +         L G+N++      T +F   L  +
Sbjct  121355  LAHGYLVDPQPTFVNPGGD----PTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKS  121522

Query  279     GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR----STGY--THDGPC  331
                F SLRAF+D         +    CG T  D  P+ +P D  ++    S G+  +H+GPC
Sbjct  121523  SFASLRAFID------AQGNTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPC  121684

Query  332     EVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               E+W D TRV ++DNC   I      ++ S C GS  L   WL +        WQVYK CV
Sbjct  121685  ELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLAL----HTSQWQVYKNCV  121852

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 82/180 (46%), Gaps = 35/180 (19%)
 Frame = +2

Query  233     MAHQLVILPAPTYTVEGKDNRWKPLAF---------LEGQNFS-----TTDDFVGYLDAN  278
               +AH  ++ P PT+   G D    P  +         L G+N++      T  F   L  +
Sbjct  125312  LAHGYLVDPQPTFVNPGGD----PTGYSGTIDGNVALPGENYNLSPQDNTIAFTRQLKKS  125479

Query  279     GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR----STGY--THDGPC  331
                F SLRAF+D         +    CG T  D  P+ +P D  ++    S G+  +H+GPC
Sbjct  125480  SFASLRAFID------AQGNTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPC  125641

Query  332     EVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               E+W D TRV ++DNC   I      ++ S C GS  L   WL +        WQVYK CV
Sbjct  125642  ELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLAL----HTSQWQVYKNCV  125809

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 79/175 (45%), Gaps = 27/175 (15%)
 Frame = -1

Query  234     AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDD-----FVGYLDANGFDSL  283
               +H  ++ P PT+     D        +  + L G  ++T+       F     A+ F +L
Sbjct  137075  SHGALLDPLPTWNTPYSDTSQFCGTMEGPSVLPGAAYNTSPQDNAAAFTRQFQASSFKTL  136896

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPI-PDGIMR----STGY--THDGPCEVWLD  336
               R       L   N S    CG T+P+  P+ I  DG ++    S G+  +H+GPCEVW D
Sbjct  136895  R------DLVLANPSTCGSCGITNPNGTPRQINADGTVKWAHGSEGFISSHEGPCEVWCD  136734

Query  337     DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                 RV Q+DNC    +     +D + C  +  L  YWL +     V +WQ+Y  CV
Sbjct  136733  TDRVFQNDNCARNAANGIVKIDVAKCKRAIHLVVYWLAL----HVPTWQIYLNCV  136581

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 74/174 (43%), Gaps = 28/174 (16%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKD----------NRWKPLAFLEGQNFSTTDDFVGYLDANGFDSL  283
               AH  ++ PAPT+     D          N+  P           T  F+     + + SL
Sbjct  107884  AHGWILSPAPTFLDPYGDPSKFCGVINGNKLYPADVFNRSPEDNTKAFLARFKVD-YTSL  108060

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR----STGY--THDGPCEVWLDD  337
               + F D +            CG T    A +   DG+++      G+  +H+GPCEVW D+
Sbjct  108061  KQFFDKNDDCG-------ECGITKFGTAQKLPADGVVKWRNGGEGFVSSHEGPCEVWCDN  108219

Query  338     TRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               T V Q+DNC   +      +D + C+G+  +   W+ +  +     WQVYK CV
Sbjct  108220  TVVFQNDNCARNVPSGNMQIDVAKCSGAKKMVVLWIALHAV----DWQVYKNCV  108369

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 77/175 (44%), Gaps = 26/175 (15%)
 Frame = +2

Query  40      VLYPPPFFVVDGMD---YRGSPVAYLEQQGVH-------TAIEAQTWLAERGYATLRALM  89
               ++ P P FV  G D   Y G+    +   G +         IE    L +  +A+LRA +
Sbjct  121370  LVDPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKSSFASLRAFI  121549

Query  90      DDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI----TSGYTL--DGPCEIWIDNTLA  143
               D  G          +CGLT  +   + +P++        + G+ L  +GPCE+W D T  
Sbjct  121550  DAQGNTG------GECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCELWCDATRV  121711

Query  144     LAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                   NC    P+G   I+ S C  S ++   WL +        WQV+KNC+ L++
Sbjct  121712  YENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTS----QWQVYKNCVRLTS  121864

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 61/128 (48%), Gaps = 16/128 (13%)
 Frame = +2

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI----TSGYTL--  130
               L +  +A+LRA +D  G          +CGLT  +   + +P++        + G+ L  
Sbjct  125468  LKKSSFASLRAFIDAQGNTG------GECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSH  125629

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               +GPCE+W D T      NC    P+G   I+ S C  S ++   WL +        WQV+
Sbjct  125630  EGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTS----QWQVY  125797

Query  191     KNCINLSA  198
               KNC+ L++
Sbjct  125798  KNCVRLTS  125821

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (46%), Gaps = 24/124 (19%)
 Frame = +1

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG---------SFITSGYTLDG  132
               Y +L+   D +       +   +CG+T   T  Q +P +G          F++S    +G
Sbjct  108049  YTSLKQFFDKN-------DDCGECGITKFGT-AQKLPADGVVKWRNGGEGFVSS---HEG  108195

Query  133     PCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
               PCE+W DNT+     NC    P G+  ID + C  + ++   W+ +        WQV+KN
Sbjct  108196  PCEVWCDNTVVFQNDNCARNVPSGNMQIDVAKCSGAKKMVVLWIAL----HAVDWQVYKN  108363

Query  193     CINL  196
               C+ L
Sbjct  108364  CVAL  108375

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 60/129 (47%), Gaps = 18/129 (14%)
 Frame = -1

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTD-PDAAPQPI-PDGIMR----STG  324
               F     A+ + SLR F++       N++    CG T    + PQ I P G ++      G
Sbjct  249038  FAKNFKASPYMSLRDFVNK------NSATCGACGLTTMVGSTPQSINPAGTIQWKHDDEG  248877

Query  325     Y--THDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
               +  TH+GPCEVW DD+ V Q DNC          +D   C  + +L  YWL +   +   
Sbjct  248876  FVETHNGPCEVWCDDSIVFQDDNCPLHEPSGLLRVDMDKCRKAKSLVIYWLALHSPQ---  248706

Query  383     SWQVYKACV  391
                WQVY  CV
Sbjct  248705  -WQVYLNCV  248682

 Score = 38.9 bits (89),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 29/59 (49%), Gaps = 4/59 (7%)
 Frame = +2

Query  332     EVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               EV     RV  ++NC   I      ++ + CNGS  L++ WL +       SWQVYK C
Sbjct  140858  EVGTWGRRVYSNENCARNIPDGGMPINVATCNGSKRLFFLWLAM----HTSSWQVYKNC  141022

 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 26/52 (50%), Gaps = 7/52 (13%)
 Frame = +3

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR  321
               F      + + SL+A +D        A+    CG T  D APQP+P DG+++
Sbjct  140724  FTHQFQKSSYSSLKALVDS------QANTCGECGITRSDGAPQPLPADGVVK  140861

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 46/103 (45%), Gaps = 16/103 (16%)
 Frame = -1

Query  104     DCGLTFPNTETQPIPTNGS---------FITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
                CG+T PN   + I  +G+         FI+S    +GPCE+W D        NC     
Sbjct  136859  SCGITNPNGTPRQINADGTVKWAHGSEGFISS---HEGPCEVWCDTDRVFQNDNCARNAA  136689

Query  155     EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                G   ID + C  +  +  +WL +       +WQ++ NC+ L+
Sbjct  136688  NGIVKIDVAKCKRAIHLVVYWLALHVP----TWQIYLNCVRLA  136572

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (49%), Gaps = 4/72 (6%)
 Frame = -1

Query  129     TLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               T +GPCE+W D+++     NC    P G   +D   C ++  +  +WL +        WQ
Sbjct  248867  THNGPCEVWCDDSIVFQDDNCPLHEPSGLLRVDMDKCRKAKSLVIYWLAL----HSPQWQ  248700

Query  189     VFKNCINLSASA  200
               V+ NC+ L  + 
Sbjct  248699  VYLNCVALGGNG  248664

 Score = 36.2 bits (82),  Expect(2) = 0.028, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (52%), Gaps = 4/46 (9%)
 Frame = +2

Query  148     NCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               NC    P+G   I+ + C  S R+ + WL +       SWQV+KNC
Sbjct  140897  NCARNIPDGGMPINVATCNGSKRLFFLWLAMHTS----SWQVYKNC  141022

 Score = 25.0 bits (53),  Expect(2) = 0.028, Method: Compositional matrix adjust.
 Identities = 12/45 (27%), Positives = 22/45 (49%), Gaps = 6/45 (13%)
 Frame = +3

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG  121
                 +  Y++L+AL+D             +CG+T  +   QP+P +G
Sbjct  140736  FQKSSYSSLKALVDSQA------NTCGECGITRSDGAPQPLPADG  140852

 Score = 38.5 bits (88),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 15/95 (16%)
 Frame = -3

Query  304     GFTDPDAAPQPIPDGIMRSTGY--------THDGPCEVWLDDTRV---LQHDNCHEVISG  352
               G T+P   P P      +   +        +++GPCEV +D  ++    Q+DN H V +G
Sbjct  109752  GITNPSGTPPPKQHRRRQKQAHGSEGFVYSSYEGPCEVQIDAIQICCEFQNDNSHHVANG  109573

Query  353     KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                      +    S   Y YWL +R    V +WQ Y
Sbjct  109572  MWPTWPNAKERAS*LSYTYWLALR----VSTWQFY  109480

>PYIR:scaffold_1319 pir_scaffold_1319 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1319:1:8199:1 
REF
Length=8199

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 79/165 (48%), Gaps = 16/165 (10%)
 Frame = -1

Query  234   AHQLVILPAPTYTVEGKDNRW-KPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
             AH  +  P   +      + W    +   G +  +  DF       GF + RAF++    
Sbjct  6072  AHGYIATPKSEFKSGASQSSWVAEFSSPWGGSKWSAADFAKTAPGKGFATTRAFLE----  5905

Query  293   YSVNASADFRCGFTDPDAAPQPIP--DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVI  350
                  S    CG T  +A+P+PIP  + +  S    H GPCE+W+D+TRV  +D+C    
Sbjct  5904  -----SRGPTCGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWIDNTRVYHNDDCEAAF  5740

Query  351   --SGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               S  T+ +D+SAC GSC L +YWLG++     +  Q Y  C+ +
Sbjct  5739  GSSIPTWKIDFSACKGSCMLRFYWLGLQDGGARF--QSYSKCLAL  5611

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 14/120 (12%)
 Frame = -1

Query  80    RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIWI  138
             +G+AT RA ++  G           CG T  N   +PIP++ +   +      GPCE+WI
Sbjct  5937  KGFATTRAFLESRGP---------TCGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWI  5785

Query  139   DNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             DNT      +C   F     T  ID+S C  SC + ++WLG++  G R+  Q +  C+ L
Sbjct  5784  DNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQDGGARF--QSYSKCLAL  5611

>SAPA:scaffold_31 supercont2.31 dna:supercontig supercontig:ASM15154v2:supercont2.31:1:358087:1 
REF
Length=358087

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 78/175 (45%), Gaps = 26/175 (15%)
 Frame = -1

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFS-----------TTDDFVGYLDANGFDSL  283
               H  +I P PT+  E   +R K    ++G                T  F     A+ F +L
Sbjct  135595  HGFLINPTPTFN-ELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTLQFTTQFKASPFRTL  135419

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----THDGPCEVWLDDT  338
                AF+D  ++ S       RCG T+   A QP+P  +  + G      +H+GPCEVW D T
Sbjct  135418  AAFVDSQNVASCG-----RCGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWCDST  135254

Query  339     RVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               RV Q+DNC          +D + C G+  L   WL +       SWQVY  CVP+
Sbjct  135253  RVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVPL  135101

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 62/129 (48%), Gaps = 16/129 (12%)
 Frame = +1

Query  268     TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTG---  324
               TD F  +  A+ F +L+AF+D              CG TDP+   QP+P  +  + G   
Sbjct  132742  TDQFTKHFKASSFKTLKAFLDAHP-------TGGDCGITDPNGPAQPLPSTVKWANGELG  132900

Query  325     --YTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
                  +H GPCE+W D+TRV Q +NC          +D S C+G+  L   WL +       
Sbjct  132901  FISSHQGPCELWCDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLAL----HTP  133068

Query  383     SWQVYKACV  391
                WQVYK CV
Sbjct  133069  EWQVYKNCV  133095

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 21/126 (17%)
 Frame = +1

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-----NG--SFITSGYTLDGPC  134
               + TL+A +D             DCG+T  N   QP+P+     NG   FI+S     GPC
Sbjct  137533  FKTLKAFLD-------AHPSGGDCGITDANGPAQPLPSTVKWANGQEGFISS---HQGPC  137682

Query  135     EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
               E+W DN       NC   +P GH +ID S C  + R++  WL +        WQV+KNC+
Sbjct  137683  ELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLAL----HSPQWQVYKNCV  137850

Query  195     NLSASA  200
               NLS +A
Sbjct  137851  NLSGAA  137868

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 21/126 (17%)
 Frame = +1

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-----NG--SFITSGYTLDGPC  134
               + TL+A +D             DCG+T PN   QP+P+     NG   FI+S     GPC
Sbjct  132778  FKTLKAFLD-------AHPTGGDCGITDPNGPAQPLPSTVKWANGELGFISS---HQGPC  132927

Query  135     EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
               E+W D T      NC   +P+G   ID S C  + R++  WL +        WQV+KNC+
Sbjct  132928  ELWCDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLAL----HTPEWQVYKNCV  133095

Query  195     NLSASA  200
               NLS +A
Sbjct  133096  NLSGAA  133113

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 76/178 (43%), Gaps = 34/178 (19%)
 Frame = +1

Query  233     MAHQLVILPAPTYTVEGKDNRWKPLAF---------LEGQNFS-----TTDDFVGYLDAN  278
               + H  ++ P P +T    D    P  F         L G  +       TD+F  +  A+
Sbjct  137362  VGHGHLVDPVPAFT----DKYGDPTKFAATLDGPTVLPGSTYGQGPDWNTDEFTKHFKAS  137529

Query  279     GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----THDGPCEV  333
                F +L+AF+D          +   CG TD +   QP+P  +  + G      +H GPCE+
Sbjct  137530  SFKTLKAFLDAHP-------SGGDCGITDANGPAQPLPSTVKWANGQEGFISSHQGPCEL  137688

Query  334     WLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               W D+ RV   +NC          +D S C+G+  L   WL +   +    WQVYK CV
Sbjct  137689  WCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALHSPQ----WQVYKNCV  137850

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 66/152 (43%), Gaps = 19/152 (13%)
 Frame = -1

Query  58      PVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPI  117
               P +   Q      ++  T      + TL A +D   + S        CG+T      QP+
Sbjct  135502  PGSSYNQDPAWNTLQFTTQFKASPFRTLAAFVDSQNVASCGR-----CGITNAIGAAQPL  135338

Query  118     PT-----NG--SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCR  170
               P+     NG   F+ S    +GPCE+W D+T      NC      G  +ID ++C  + +
Sbjct  135337  PSVLKWANGQEGFVAS---HEGPCEVWCDSTRVFQNDNCAANQQSGLLSIDTTLCAGAKQ  135167

Query  171     VSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
               +   WL +       SWQV+ NC+ LS S +V
Sbjct  135166  LRLLWLAL----HTPSWQVYINCVPLSGSTVV  135083

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = +2

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               GPCE+W D+TRV  ++NC + I+  +  +D + C G+ TL ++WL +       SWQVY
Sbjct  142742  GPCELWCDNTRVYDNENCAKNIADGSMAIDTTKCAGAKTLRFFWLAL----HSSSWQVY  142906

 Score = 45.1 bits (105),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 29/59 (49%), Gaps = 4/59 (7%)
 Frame = +2

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               GPCE+W DNT      NC     +G   ID + C  +  + +FWL +       SWQV+
Sbjct  142742  GPCELWCDNTRVYDNENCAKNIADGSMAIDTTKCAGAKTLRFFWLAL----HSSSWQVY  142906

 Score = 42.7 bits (99),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 4/59 (7%)
 Frame = -1

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               GPCE+W D+TRV  +D+C + I   +  +D S C G+  L   W+ +        WQ Y
Sbjct  208615  GPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMAL----HTPQWQAY  208451

 Score = 42.7 bits (99),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 4/59 (7%)
 Frame = +2

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               GPCE+W D+TRV  +D+C + I   +  +D S C G+  L   W+ +        WQ Y
Sbjct  210596  GPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMAL----HTPQWQAY  210760

 Score = 41.6 bits (96),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 1/63 (2%)
 Frame = +2

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKY-QGERYSWQVF  190
               GPCE+W D T      +C    P+G   ID S C  + +++  W+ +   Q + YS    
Sbjct  210596  GPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQWQAYSTSSL  210775

Query  191     KNC  193
                 C
Sbjct  210776  PPC  210784

 Score = 41.2 bits (95),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 1/63 (2%)
 Frame = -1

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKY-QGERYSWQVF  190
               GPCE+W D T      +C    P+G   ID S C  + +++  W+ +   Q + YS    
Sbjct  208615  GPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQWQAYSTSSL  208436

Query  191     KNC  193
                 C
Sbjct  208435  PPC  208427

>APIN:scaffold_9 supercont1.9 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.9:1:1715687:1 
REF
Length=1715687

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 84/177 (47%), Gaps = 27/177 (15%)
 Frame = -1

Query  234     AHQLVILPAPTYT--VEGKDNRWKPL---AFLEGQNFS-----TTDDFVGYLDANGFDSL  283
               +H +++ P PT    V  K N    +     L G+ +       T+ FV     + F SL
Sbjct  911279  SHGILVDPKPTIRDGVPDKTNYCGTIDGYKALPGEKYDDSPEYNTNAFVRQFKKSSFTSL  911100

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR----STGY--THDGPCEVWLD  336
               +A +          +    CG T  D  PQP+P DGI++    + GY  +H+GPCEVW D
Sbjct  911099  KALVHSQ------PTTCGECGITRDDGTPQPMPLDGIVKWGHGNEGYVSSHEGPCEVWCD  910938

Query  337     DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                TRV  +DNC   I      ++ +AC G+  L + WL +       SWQVY  CVP+
Sbjct  910937  ATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAM----HTSSWQVYINCVPL  910779

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 83/176 (47%), Gaps = 27/176 (15%)
 Frame = +1

Query  233     MAHQLVILPAPTYTVEGKD-----NRWKPLAFLEGQNFST-----TDDFVGYLDANGFDS  282
               + H  ++ P PT+T    D        +  + L G  ++T     T  F  +  A+ F +
Sbjct  911677  LGHGGLVDPLPTWTSPNSDISQFCGTMEGPSVLPGAPYNTSPQDNTAAFTRHFQASSFKT  911856

Query  283     LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPI-PDGIMR----STGY--THDGPCEVWL  335
               LR     D + +  ++    CG TDP   P+ +   G++     S G+  +H+GPCEVW 
Sbjct  911857  LR-----DVIVAYPSTCG-TCGITDPFGTPRELNATGVIMWAHGSEGFVASHEGPCEVWC  912018

Query  336     DDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               D TRV  +DNC   ++     +D + C G+  L  YWL +     V +WQ+Y  CV
Sbjct  912019  DATRVFYNDNCARNVASGILKIDVAKCQGARQLVMYWLAL----HVPTWQIYVNCV  912174

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 55/124 (44%), Gaps = 24/124 (19%)
 Frame = -1

Query  82      YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG---------SFITSGYTLDG  132
               Y +L+   D +       +   +CG+T    + Q +P NG          F++S    +G
Sbjct  922013  YTSLKQFFDKN-------DNCGECGIT-KFGDAQKLPANGVVQWRNGGEGFVSS---HEG  921867

Query  133     PCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
               PCE+W DNTL     NC    P G   ID + C  S +    W+ +        WQV+KN
Sbjct  921866  PCELWCDNTLVFQNDNCARNLPSGDMQIDVAKCAGSKKFIALWIAL----HSVDWQVYKN  921699

Query  193     CINL  196
               C+ L
Sbjct  921698  CVAL  921687

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 62/138 (45%), Gaps = 19/138 (14%)
 Frame = -1

Query  264     NFSTTDDFVGYLDANGFD--SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-  320
               N S  D+   +L     D  SL+ F D +            CG T    A +   +G++ 
Sbjct  922067  NLSPLDNTKAFLARFKVDYTSLKQFFDKNDNCG-------ECGITKFGDAQKLPANGVVQ  921909

Query  321     -RSTG----YTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGV  375
                R+ G     +H+GPCE+W D+T V Q+DNC   +      +D + C GS      W+ +
Sbjct  921908  WRNGGEGFVSSHEGPCELWCDNTLVFQNDNCARNLPSGDMQIDVAKCAGSKKFIALWIAL  921729

Query  376     RYLKQVYSWQVYKACVPI  393
                 +     WQVYK CV +
Sbjct  921728  HSV----DWQVYKNCVAL  921687

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 10/99 (10%)
 Frame = -1

Query  104     DCGLTFPNTETQPIPTNG----SFITSGY--TLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               +CG+T  +   QP+P +G         GY  + +GPCE+W D T   +  NC    P G 
Sbjct  911063  ECGITRDDGTPQPMPLDGIVKWGHGNEGYVSSHEGPCEVWCDATRVYSNDNCARNIPNGA  910884

Query  158     HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                 I+ + C  + R+ + WL +       SWQV+ NC+ L
Sbjct  910883  MPINVAACKGAKRLLFVWLAMHTS----SWQVYINCVPL  910779

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (49%), Gaps = 4/70 (6%)
 Frame = +1

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               +GPCE+W D T      NC      G   ID + C  + ++  +WL +       +WQ++
Sbjct  911995  EGPCEVWCDATRVFYNDNCARNVASGILKIDVAKCQGARQLVMYWLALHVP----TWQIY  912162

Query  191     KNCINLSASA  200
                NC+ L  +A
Sbjct  912163  VNCVTLGGAA  912192

>PHRA:scaffold_52
Length=349176

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -1

Query  261     EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
               +G N  + D F     AN F  L+  MDD + +  +      CGFTDP   PQPIP DG 
Sbjct  102798  DGNNAGSVDAFKALKTANNFVDLKTLMDDTATFGAD------CGFTDPSGTPQPIPSDGK  102637

Query  320     MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSACN-GSCT-LYW  370
                  S    H GPCE+WLDD +V   D+C      +  D+      DYS C+ G C  + +
Sbjct  102636  ATFSRAIVHVGPCEIWLDDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRF  102457

Query  371     YWLGVRYLKQVYSWQVY  387
               YWL  + +     WQ Y
Sbjct  102456  YWLAFQGVDGKTVWQSY  102406

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 15/120 (13%)
 Frame = -1

Query  80      RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
                 +  L+ LMDD   +        DCG T P+   QPIP++G    S   +  GPCEIW+
Sbjct  102747  NNFVDLKTLMDDTATFGA------DCGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWL  102586

Query  139     DNTLALAGRNCHTEFPEGHHTI------DYSVC-GESCR-VSWFWLGIKYQGERYSWQVF  190
               D+       +C + +   +  I      DYS C G  C+ + ++WL  +    +  WQ +
Sbjct  102585  DDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSY  102406

>PYIR:scaffold_871 pir_scaffold_871 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_871:1:14137:1 
REF
Length=14137

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 85/181 (47%), Gaps = 27/181 (15%)
 Frame = -3

Query  234    AHQLVILPAPTYTVEGKDNRWK-------PLAFLEGQNFST-----TDDFVGYLDANGFD  281
              AH  + +P PT+T+ G   ++         L    G +F+T     T+ F   L A+ +D
Sbjct  12935  AHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKASTYD  12756

Query  282    SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVW  334
              S+RA ++   ++   A+ +  CG T      QP+P   +      S G+T  H GPCEVW
Sbjct  12755  SVRALVEAKGVFISGATKE--CGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVW  12582

Query  335    LDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
               D+ +V   +NC +       +L  D++ C G+  L   WL +       +WQ+Y  C P
Sbjct  12581  CDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLALHS----STWQIYINCAP  12414

Query  393    I  393
              +
Sbjct  12413  L  12411

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 72/179 (40%), Gaps = 26/179 (15%)
 Frame = +1

Query  235   HQLVILPAPTYTVEGKDNRW-------KPLAFLEGQNFST-----TDDFVGYLDANGFDS  282
             H  + LP PT++ +G D            L    G +F+T     T+ F   +  + + S
Sbjct  2476  HGSMSLPKPTFSTQGGDTTQPGLNVDSSALTAPSGMSFTTDPTSNTNAFNAAIKTSAYKS  2655

Query  283   LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY------THDGPCEVWLD  336
             ++  +    +    A+ D  CG T P  A QP+P  +  S G       +H+GPCEVW D
Sbjct  2656  VKDLIAAKGVPIPGANKD--CGLTTPTGAKQPLPAQVEWSHGSGEGFTPSHEGPCEVWCD  2829

Query  337   DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             +       NC +        L Y  S C G   L   WL +       +WQ Y  C  I
Sbjct  2830  NVLAFSDGNCAKNFPSAPAKLPYDKSKCVGKSVLKTIWLALHS----PTWQAYINCAAI  2994

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 47/108 (44%), Gaps = 16/108 (15%)
 Frame = +2

Query  295    VNASADFRCGFTDPDAAPQPIPDGIM--------RSTGYTHDGPCEVWLDDTRVLQHDNC  346
              V A AD +CG+TDP    +P+    +           G+ H GPCE W DD  V Q   C
Sbjct  11012  VQAGADAKCGWTDPSKTSEPLEGSSIIYGRNFEGTGEGFVHPGPCETWCDDKMVQQDMTC  11191

Query  347    HEVISGK----TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
                  + K       +D + C G+  L  YW+ +        WQ+Y+ C
Sbjct  11192  DITYNVKDKAAIIPIDAAKCKGAKQLSTYWIAM----HGNEWQIYRTC  11323

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 11/100 (11%)
 Frame = +1

Query  104   DCGLTFPNTETQPIP-----TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHH  158
             DCGLT P    QP+P     ++GS      + +GPCE+W DN LA +  NC   FP    
Sbjct  2707  DCGLTTPTGAKQPLPAQVEWSHGSGEGFTPSHEGPCEVWCDNVLAFSDGNCAKNFPSAPA  2886

Query  159   TIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              + Y  S C     +   WL +       +WQ + NC  +
Sbjct  2887  KLPYDKSKCVGKSVLKTIWLAL----HSPTWQAYINCAAI  2994

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 34/70 (49%), Gaps = 6/70 (9%)
 Frame = +1

Query  326   THDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYS  383
             +H GPCEVW DD    Q DNC  H   +      D S C G   L  +W+ +     V +
Sbjct  6439  SHMGPCEVWCDDVMAFQDDNCSVHMTTAPAVLKYDKSKCVGKKMLTSFWIAL----HVPT  6606

Query  384   WQVYKACVPI  393
             WQ+Y  C PI
Sbjct  6607  WQIYTNCAPI  6636

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 56/128 (44%), Gaps = 14/128 (11%)
 Frame = -3

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLD-  131
              L    Y ++RAL++  G++        +CG+T      QP+P          + G+T   
Sbjct  12776  LKASTYDSVRALVEAKGVF--ISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSH  12603

Query  132    -GPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               GPCE+W DN    +  NC   +P       ID++ C  +  +   WL +       +WQ
Sbjct  12602  QGPCEVWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQ  12435

Query  189    VFKNCINL  196
              ++ NC  L
Sbjct  12434  IYINCAPL  12411

 Score = 43.5 bits (101),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 34/67 (51%), Gaps = 9/67 (13%)
 Frame = +1

Query  326   THDGPCEVWLDDTRVLQHDNCHEVISGKTYD-----LDYSACNGSCTLYWYWLGVRYLKQ  380
             +H+GPCEVW DD  V Q+ NC      K  +     ++ + C  +  L +YW+ +   + 
Sbjct  8578  SHEGPCEVWCDDNMVQQNMNCVRAYPNKPGNAAEVPIEVAKCANAKKLTFYWVAMHGNE-  8754

Query  381   VYSWQVY  387
                WQVY
Sbjct  8755  ---WQVY  8766

 Score = 38.5 bits (88),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 30/67 (45%), Gaps = 6/67 (9%)
 Frame = +1

Query  132   GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQV  189
             GPCE+W D+ +A    NC          + Y  S C     ++ FW+ +       +WQ+
Sbjct  6448  GPCEVWCDDVMAFQDDNCSVHMTTAPAVLKYDKSKCVGKKMLTSFWIALHVP----TWQI  6615

Query  190   FKNCINL  196
             + NC  +
Sbjct  6616  YTNCAPI  6636

 Score = 38.5 bits (88),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 37/178 (21%), Positives = 72/178 (40%), Gaps = 32/178 (18%)
 Frame = +2

Query  43     PPPFFV--VDGMDYRGSPV--------AYLEQQGVHTAIEAQTWLAERGYATLRALMDDD  92
              P PFF   +D   Y G+ +        A+     ++ A   + +  +  +  L+ L++ +
Sbjct  10823  PKPFFKTGIDITSYTGTMMGDAIYPGFAFNTAPEINVANFIKNFKNDTRHPNLKTLIEKN  11002

Query  93     GLYSVTEEGL-FDCGLTFPNTETQPIPTNGSFIT---------SGYTLDGPCEIWIDNTL  142
                  V + G    CG T P+  ++P+   GS I           G+   GPCE W D+ +
Sbjct  11003  --QKVVQAGADAKCGWTDPSKTSEPL--EGSSIIYGRNFEGTGEGFVHPGPCETWCDDKM  11170

Query  143    ALAGRNCHTEFPEGHHT----IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                    C   +          ID + C  + ++S +W+ +        WQ+++ C ++
Sbjct  11171  VQQDMTCDITYNVKDKAAIIPIDAAKCKGAKQLSTYWIAM----HGNEWQIYRTCFDV  11332

 Score = 37.0 bits (84),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 31/65 (48%), Gaps = 9/65 (14%)
 Frame = +1

Query  131   DGPCEIWIDNTLALAGRNCHTEFPE-----GHHTIDYSVCGESCRVSWFWLGIKYQGERY  185
             +GPCE+W D+ +     NC   +P          I+ + C  + +++++W+ +       
Sbjct  8584  EGPCEVWCDDNMVQQNMNCVRAYPNKPGNAAEVPIEVAKCANAKKLTFYWVAMHGN----  8751

Query  186   SWQVF  190
              WQV+
Sbjct  8752  EWQVY  8766

>PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:pug:scf1117875582032:1:863081:1 
REF
Length=863081

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 76/174 (44%), Gaps = 21/174 (12%)
 Frame = -2

Query  234     AHQLVILPAPTYTVEGK------DNRWKPLAFLEGQNFSTTDD-----FVGYLDANGFDS  282
               AH  + LPAPT+   G       D    P+    G  +S   D     F     A G  S
Sbjct  690940  AHGQLTLPAPTFNGYGGGVASTIDVALLPVP--SGMTYSAGPDTNAAAFDKAFSATG-QS  690770

Query  283     LRAFM--DDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRV  340
               L+ F+  + D   + +      CGF+DP   PQP+PD I   T + H GPCE W DD  V
Sbjct  690769  LKDFILKNQDQSGATSTPLSAACGFSDPKGTPQPLPDKIQWGTSFIHPGPCEAWCDDEIV  690590

Query  341     LQHD-NCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               + +  NC       +   D + C G   L +YWL V        WQVY  CVP+
Sbjct  690589  VPYTANCWTEFKDGSVPYDKAKCQGKKQLTFYWLAVHSPP----WQVYINCVPL  690440

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 46/93 (49%), Gaps = 5/93 (5%)
 Frame = +3

Query  302     RCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHD-NCHEVISGKTYDLDYS  360
                CGF+DPD  PQ +PD +   T + H GPCE W DD  V+ +  NC       T   + +
Sbjct  736449  ECGFSDPDGTPQALPDKLQWGTSFIHPGPCEAWCDDVNVVPYTANCWITYKNGTVPYEKA  736628

Query  361     ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                C G   L +YWL V        WQ Y  CVP+
Sbjct  736629  KCEGKKRLTFYWLAV----HSPPWQPYINCVPL  736715

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 56/114 (49%), Gaps = 7/114 (6%)
 Frame = -2

Query  281     DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRV  340
               D +  + D     +   +AD  CGF+  + A Q +PD +   TG+ H GPCE W D+  V
Sbjct  681127  DFILQYQDTSKGSAGGGTAD--CGFSKSNGAAQALPDSLQWGTGFIHPGPCEAWCDNEIV  680954

Query  341     LQHD-NCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               + +  NC +  SG       + C G   L +YWLGV        WQVY  CVP+
Sbjct  680953  VPYTANCWKTFSGGNVPYAKAKCAGKSRLTFYWLGVHGPP----WQVYINCVPL  680804

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 6/61 (10%)
 Frame = +1

Query  329     GPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
               GPCE+WLDDT VL+ +NC     G      +D+S+C G C + +YWL +    Q  +WQ+
Sbjct  299515  GPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTL----QEPAWQI  299682

Query  387     Y  387
               Y
Sbjct  299683  Y  299685

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (51%), Gaps = 6/93 (6%)
 Frame = -2

Query  105     CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTIDYS  163
               CG + P    QP+P    + TS +   GPCE W D+ + +    NC TEF +G    D +
Sbjct  690703  CGFSDPKGTPQPLPDKIQWGTS-FIHPGPCEAWCDDEIVVPYTANCWTEFKDGSVPYDKA  690527

Query  164     VCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                C    +++++WL +        WQV+ NC+ L
Sbjct  690526  KCQGKKQLTFYWLAV----HSPPWQVYINCVPL  690440

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 47/97 (48%), Gaps = 6/97 (6%)
 Frame = -2

Query  101     GLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHT  159
               G  DCG +  N   Q +P +  + T G+   GPCE W DN + +    NC   F  G+  
Sbjct  681079  GTADCGFSKSNGAAQALPDSLQWGT-GFIHPGPCEAWCDNEIVVPYTANCWKTFSGGNVP  680903

Query  160     IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                  + C    R++++WLG+        WQV+ NC+ L
Sbjct  680902  YAKAKCAGKSRLTFYWLGV----HGPPWQVYINCVPL  680804

 Score = 36.2 bits (82),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  328     DGPCEVWLDDTRVLQHDNC  346
                GPCE+WLDDT VL+ +NC
Sbjct  309225  SGPCEIWLDDTPVLKEENC  309169

 Score = 30.8 bits (68),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 20/31 (65%), Gaps = 4/31 (13%)
 Frame = -2

Query  357     LDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               +D+S+C G C + +YWL +    Q  +WQ+Y
Sbjct  309133  VDFSSCTGKCVMRFYWLTL----QEPAWQIY  309053

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 33/64 (52%), Gaps = 6/64 (9%)
 Frame = +1

Query  129     TLDGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
                  GPCEIW+D+T  L   NC   FP       +D+S C   C + ++WL +    +  +
Sbjct  299506  VFQGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTL----QEPA  299673

Query  187     WQVF  190
               WQ++
Sbjct  299674  WQIY  299685

 Score = 42.0 bits (97),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 25/94 (27%), Positives = 43/94 (46%), Gaps = 6/94 (6%)
 Frame = +3

Query  104     DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTIDY  162
               +CG + P+   Q +P    + TS +   GPCE W D+   +    NC   +  G    + 
Sbjct  736449  ECGFSDPDGTPQALPDKLQWGTS-FIHPGPCEAWCDDVNVVPYTANCWITYKNGTVPYEK  736625

Query  163     SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               + C    R++++WL +        WQ + NC+ L
Sbjct  736626  AKCEGKKRLTFYWLAV----HSPPWQPYINCVPL  736715

>PYIW:scaffold_1535 piw_scaffold_1535 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1535:1:8373:1 
REF
Length=8373

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (49%), Gaps = 15/141 (11%)
 Frame = -2

Query  262   GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR  321
             G   S T  F   L A+ + S+RA +DD +++   A+ +  CG T P  A QP+PD  + 
Sbjct  6953  GDPASNTKAFTAALKASTYKSMRALVDDKAVFIKEANKE--CGVTSPTGAKQPLPDKYVE  6780

Query  322   -----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYW  372
                  S G+T  H GPCEVW DD      +NC    +    +L  D++ C G+  L   W
Sbjct  6779  WSHSSSEGFTPSHQGPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVW  6600

Query  373   LGVRYLKQVYSWQVYKACVPI  393
             L +       +WQ+Y  C P+
Sbjct  6599  LALHS----STWQIYINCAPL  6549

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 71/154 (46%), Gaps = 22/154 (14%)
 Frame = -2

Query  51    GMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFP  110
             GM + G P +    +    A++A T      Y ++RAL+DD  ++   +E   +CG+T P
Sbjct  6968  GMSFTGDPAS--NTKAFTAALKAST------YKSMRALVDDKAVF--IKEANKECGVTSP  6819

Query  111   NTETQPIPTN----GSFITSGYTLD--GPCEIWIDNTLALAGRNCHTEFPE--GHHTIDY  162
                 QP+P          + G+T    GPCE+W D+ LA    NC  ++        ID+
Sbjct  6818  TGAKQPLPDKYVEWSHSSSEGFTPSHQGPCEVWCDDKLAFTDENCAADYTSAPAELPIDH  6639

Query  163   SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             + C  +  +   WL +       +WQ++ NC  L
Sbjct  6638  AKCVGASLLKIVWLAL----HSSTWQIYINCAPL  6549

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 46/105 (44%), Gaps = 16/105 (15%)
 Frame = +2

Query  295   VNASADFRCGFTDPDAAPQPIPDGIM--------RSTGYTHDGPCEVWLDDTRVLQHDNC  346
             +NA AD +CG+TDP    +P+    +           G+ H GPCE W D+  V Q  +C
Sbjct  5042  INAKADAKCGWTDPSKTSEPLEGSSIIYGRNFEGTGEGFVHPGPCETWCDNVMVQQEMHC  5221

Query  347   HE----VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
              E            +D + C G+  L  YW+ +        WQ+Y
Sbjct  5222  DEKYNVANKAAIIPIDAAKCKGAKQLTTYWIAMHG----NEWQIY  5344

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 33/68 (49%), Gaps = 6/68 (9%)
 Frame = +1

Query  328   DGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQ  385
              GPCEVW DD    Q DNC   ++ +   L Y  S C G   L  YW+ +     V  WQ
Sbjct  2935  QGPCEVWCDDVMAFQDDNCSVNLTTQPAVLKYDKSKCAGKKMLTSYWIAL----HVPQWQ  3102

Query  386   VYKACVPI  393
             +Y  C P+
Sbjct  3103  IYTYCAPL  3126

 Score = 35.0 bits (79),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 19/99 (19%)
 Frame = +2

Query  105   CGLTFPNTETQPIPTNGSFIT---------SGYTLDGPCEIWIDNTLALAGRNCHTEFPE  155
             CG T P+  ++P+   GS I           G+   GPCE W DN +     +C  ++  
Sbjct  5066  CGWTDPSKTSEPL--EGSSIIYGRNFEGTGEGFVHPGPCETWCDNVMVQQEMHCDEKYNV  5239

Query  156   GHHT----IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
              +      ID + C  + +++ +W+ +        WQ++
Sbjct  5240  ANKAAIIPIDAAKCKGAKQLTTYWIAM----HGNEWQIY  5344

 Score = 35.0 bits (79),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 28/68 (41%), Gaps = 6/68 (9%)
 Frame = +1

Query  131   DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQ  188
              GPCE+W D+ +A    NC          + Y  S C     ++ +W+ +        WQ
Sbjct  2935  QGPCEVWCDDVMAFQDDNCSVNLTTQPAVLKYDKSKCAGKKMLTSYWIALHVP----QWQ  3102

Query  189   VFKNCINL  196
             ++  C  L
Sbjct  3103  IYTYCAPL  3126

>PHIF:NW_003303506.1 Phytophthora infestans T30-4 supercont1.253 
genomic scaffold, whole genome shotgun sequence
Length=123523

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 76/157 (48%), Gaps = 16/157 (10%)
 Frame = +3

Query  246   TVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGF  305
             T+E   +++       G     T  F    +++ + SL+  ++  +  +V   A   CG 
Sbjct  1914  TIEASASKFS--GTFSGSPADNTAAFTTAFESSSYTSLKELINALATVTVT-DATLTCGS  2084

Query  306   TDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLD  358
              DPD   QP+P+  +      + G+T  H+GPCE+W DD RV Q ++C    +    +L 
Sbjct  2085  CDPDETSQPLPETYVEWSHSSTEGFTSSHEGPCEIWCDDVRVFQDNDCAADYTSAPAELP  2264

Query  359   Y--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             Y   AC GS TL +YWL +       +WQVY  C P+
Sbjct  2265  YDRDACLGSSTLTFYWLAL----HSSTWQVYINCAPL  2363

 Score = 59.3 bits (142),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 37/70 (53%), Gaps = 6/70 (9%)
 Frame = +2

Query  326    THDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYS  383
              TH+GPCEVW D  RV   DNC    +    +L Y  S C+G+  L  YW+ +       S
Sbjct  72047  THEGPCEVWCDKKRVFYDDNCAAHFTAAPAELPYEKSKCSGASVLTMYWMAM----HGPS  72214

Query  384    WQVYKACVPI  393
              WQVY  C P+
Sbjct  72215  WQVYVNCAPL  72244

 Score = 28.9 bits (63),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 13/44 (30%), Positives = 21/44 (48%), Gaps = 1/44 (2%)
 Frame = +1

Query  271    FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQP  314
              F    +A+ + S++  +DD +   V   A   CG  DP+  P P
Sbjct  71863  FTKAFEASKYKSIKEVIDDKAKIIVTG-ATLTCGIADPNTPPPP  71991

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 13/133 (10%)
 Frame = +3

Query  75    TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
             T      Y +L+ L++     +VT+  L  CG   P+  +QP+P          T G+T 
Sbjct  1989  TAFESSSYTSLKELINALATVTVTDATL-TCGSCDPDETSQPLPETYVEWSHSSTEGFTS  2165

Query  131   --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
               +GPCEIW D+       +C  ++      + Y    C  S  ++++WL +       +
Sbjct  2166  SHEGPCEIWCDDVRVFQDNDCAADYTSAPAELPYDRDACLGSSTLTFYWLALHSS----T  2333

Query  187   WQVFKNCINLSAS  199
             WQV+ NC  L ++
Sbjct  2334  WQVYINCAPLEST  2372

 Score = 41.2 bits (95),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 32/71 (45%), Gaps = 6/71 (8%)
 Frame = +2

Query  129    TLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
              T +GPCE+W D        NC   F      + Y  S C  +  ++ +W+ +       S
Sbjct  72047  THEGPCEVWCDKKRVFYDDNCAAHFTAAPAELPYEKSKCSGASVLTMYWMAMHGP----S  72214

Query  187    WQVFKNCINLS  197
              WQV+ NC  LS
Sbjct  72215  WQVYVNCAPLS  72247

>PHRA:scaffold_37
Length=441994

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 58/100 (58%), Gaps = 18/100 (18%)
 Frame = +2

Query  302     RCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------EV  349
               +CG TD  A+PQPIP DG  +       G+TH GPCE++LDDT VL  DNC       +V
Sbjct  285305  KCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  285484

Query  350     ISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                S +T D+  DYS+CNG CTL  YWL      Q   WQ Y
Sbjct  285485  GSTQTSDMPVDYSSCNGKCTLTIYWLAF----QNAQWQAY  285592

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 54/114 (47%), Gaps = 22/114 (19%)
 Frame = +2

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
               CG T  +   QPIP++G          G+T  GPCEI++D+T+ L   NC  ++P G   
Sbjct  285308  CGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  285487

Query  157     -----HHTIDYSVCGESCRVSWFWLGIK-YQGERYS--------WQVFKNCINL  196
                       +DYS C   C ++ +WL  +  Q + Y         W +F  C+++
Sbjct  285488  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQWQAYGKSATFAVLWSLFLTCVSV  285649

>PYAP:scaffold_187 pag1_scaffold_187 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_187:1:47143:1 
REF
Length=47143

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 76/157 (48%), Gaps = 37/157 (24%)
 Frame = +2

Query  257    LAFLEGQNFS-----TTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAA  311
              +A  +G+ F+      T  F      +G  SLR  MD    Y         CG T+P+  
Sbjct  9968   IAAFQGKPFNRSPEQNTQVFTDAFKQSGLKSLRELMDK---YVPG------CGNTNPNTT  10120

Query  312    PQPIPDGIMRSTGY-----------THDGPCEVWLDDTRVLQHDNCHEVISGKTY----D  356
              P+ +    +++  Y           +H GPCEVW+D+TRV Q+++C    + K+Y     
Sbjct  10121  PRDVTK--LKTMTYQNNEYKEGFLNSHHGPCEVWIDNTRVFQNNDC--AANYKSYPAALP  10288

Query  357    LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              +DYS C G+C L +YWL +   K    WQ YK CVPI
Sbjct  10289  VDYSKCKGTCRLTFYWLALHSQK----WQAYKQCVPI  10387

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 71/158 (45%), Gaps = 38/158 (24%)
 Frame = -2

Query  257    LAFLEGQNFS-----TTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAA  311
              +A  +G+ F+      T  F      +G  SLR  MD    Y         CG T+P+  
Sbjct  11610  IAAFQGKIFNWSPEHNTQVFTDAFKQSGLKSLRQLMDK---YVPG------CGNTNPNTT  11458

Query  312    PQPI-------------PDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG--KTYD  356
              P+ +              +G + S    H GPCEVW+D+TRV Q+++C         +  
Sbjct  11457  PRDVTKLKTMNWQNNEYKEGFLAS----HRGPCEVWIDNTRVFQNNDCAGNYKSYPASLP  11290

Query  357    LDYSACNGS-CTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              +DYS C  S C L +YWL +   K    WQ YK CVPI
Sbjct  11289  VDYSKCKSSKCMLRFYWLALHSEK----WQAYKQCVPI  11188

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 69/164 (42%), Gaps = 32/164 (20%)
 Frame = +2

Query  54     YRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTE  113
              ++G P     +Q      +A     + G  +LR LMD         + +  CG T PNT 
Sbjct  9977   FQGKPFNRSPEQNTQVFTDA---FKQSGLKSLRELMD---------KYVPGCGNTNPNTT  10120

Query  114    TQPIPT-----------NGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPE--GHHTI  160
               + +                F+ S +   GPCE+WIDNT      +C   +        +
Sbjct  10121  PRDVTKLKTMTYQNNEYKEGFLNSHH---GPCEVWIDNTRVFQNNDCAANYKSYPAALPV  10291

Query  161    DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
              DYS C  +CR++++WL +  Q     WQ +K C+ +   A  +M
Sbjct  10292  DYSKCKGTCRLTFYWLALHSQ----KWQAYKQCVPIKYGASRSM  10411

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 59/139 (42%), Gaps = 24/139 (17%)
 Frame = -2

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT------NGSFITSGY--  128
                + G  +LR LMD         + +  CG T PNT  + +          +    G+  
Sbjct  11541  FKQSGLKSLRQLMD---------KYVPGCGNTNPNTTPRDVTKLKTMNWQNNEYKEGFLA  11389

Query  129    TLDGPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGES-CRVSWFWLGIKYQGERY  185
              +  GPCE+WIDNT      +C   +        +DYS C  S C + ++WL +  +    
Sbjct  11388  SHRGPCEVWIDNTRVFQNNDCAGNYKSYPASLPVDYSKCKSSKCMLRFYWLALHSE----  11221

Query  186    SWQVFKNCINLSASALVTM  204
               WQ +K C+ +   A  +M
Sbjct  11220  KWQAYKQCVPIKYGASRSM  11164

>PHKE:scaffold_72 scf_22126_72.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_72.1:1:114560:1 
REF
Length=114560

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 67/131 (51%), Gaps = 15/131 (11%)
 Frame = +1

Query  271    FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY---TH  327
              F     ++ + SL+ F+++ +  +V   A   CG  DP+   QP+P+  +  + +   +H
Sbjct  52765  FTQAFGSSSYTSLKEFVNEKATVTVTG-ATLTCGSCDPNEPAQPLPESTVEWSPFFTESH  52941

Query  328    DGPCEVWLDDTRVLQHDNCHEVISGKT-----YDLDYSACNGSCTLYWYWLGVRYLKQVY  382
               GPCEVW D+ RV Q+DNC    S        YD D  AC GS  L +YW+ +       
Sbjct  52942  VGPCEVWCDEMRVFQNDNCAGSFSNNAPAQMPYDRD--ACMGSSVLTFYWMAL----HSS  53103

Query  383    SWQVYKACVPI  393
              +WQVY  C P+
Sbjct  53104  TWQVYVNCAPL  53136

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 53/131 (40%), Gaps = 14/131 (11%)
 Frame = +1

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLDG  132
                   Y +L+  +++    +VT   L  CG   PN   QP+P +      F T  +   G
Sbjct  52777  FGSSSYTSLKEFVNEKATVTVTGATL-TCGSCDPNEPAQPLPESTVEWSPFFTESHV--G  52947

Query  133    PCEIWIDNTLALAGRNCHTEFPE---GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
              PCE+W D        NC   F          D   C  S  ++++W+ +       +WQV
Sbjct  52948  PCEVWCDEMRVFQNDNCAGSFSNNAPAQMPYDRDACMGSSVLTFYWMAL----HSSTWQV  53115

Query  190    FKNCINLSASA  200
              + NC  L  +A
Sbjct  53116  YVNCAPLEKTA  53148

>PYIW:scaffold_3644 piw_scaffold_3644 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3644:1:2839:1 
REF
Length=2839

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 76/174 (44%), Gaps = 21/174 (12%)
 Frame = -3

Query  235   HQLVILPAPTY-------TVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDANGFDS  282
             H  + LP PT+       +  G  +    L    G +FST     T  F   L A+ + S
Sbjct  1889  HSKMSLPKPTWDNGYGTNSPSGTIDGPSALKAPSGMSFSTDPTSNTKAFTAALKASSYGS  1710

Query  283   LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDDTRVL  341
             L+A     +     + A   CGF+    A QP+PD +       +H+GPCEVW D+T   
Sbjct  1709  LKALAF--ATQKTESGASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDNTMAF  1536

Query  342   QHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               DNC +  +     L Y  S C+G+  L   WL +       +WQVY  C PI
Sbjct  1535  HGDNCAKTYTSSPAKLPYDKSKCSGAKMLMSIWLAL----HTPTWQVYTNCAPI  1386

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 69/168 (41%), Gaps = 23/168 (14%)
 Frame = -3

Query  32    SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
             SG  +G   L  P      GM +   P +    +    A++A +      Y +L+AL   
Sbjct  1829  SGTIDGPSALKAP-----SGMSFSTDPTS--NTKAFTAALKASS------YGSLKALAF-  1692

Query  92    DGLYSVTEEGLF-DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCH  150
                   TE G   +CG +      QP+P    +     + +GPCE+W DNT+A  G NC 
Sbjct  1691  --ATQKTESGASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDNTMAFHGDNCA  1518

Query  151   TEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               +      + Y  S C  +  +   WL +       +WQV+ NC  +
Sbjct  1517  KTYTSSPAKLPYDKSKCSGAKMLMSIWLAL----HTPTWQVYTNCAPI  1386

>PYVX:scaffold_894 pve_scaffold_894 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_894:1:10447:1 
REF
Length=10447

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 13/135 (10%)
 Frame = +2

Query  268  TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----S  322
            T  F    +A+ + SL+  + D       +     CG TDPD   Q +PD  +      +
Sbjct  155  TASFTTAFEASDYTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSST  334

Query  323  TGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYL  378
             G+T  H+GPCE+W DDTRV Q D+C    +     L Y   AC G+  L +YWL +   
Sbjct  335  EGFTASHEGPCEIWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALH--  508

Query  379  KQVYSWQVYKACVPI  393
                +WQVY  C  +
Sbjct  509  --SSTWQVYINCAAL  547

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 64/135 (47%), Gaps = 13/135 (10%)
 Frame = +1

Query  268   TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----S  322
             T  F     ++ + SL+  +         +     CG TDPD   Q +PD  +      S
Sbjct  7399  TASFTTAFASSSYSSLKEMVTSLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSDS  7578

Query  323   TGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYL  378
              G+T  H+GPCE+W DDTRV Q D+C    +     L Y  ++C+G+  L +YWL +   
Sbjct  7579  EGFTASHEGPCEIWCDDTRVFQEDDCAATYTTAPAKLPYDSASCSGASRLTFYWLALHSS  7758

Query  379   KQVYSWQVYKACVPI  393
             +    WQVY  C  +
Sbjct  7759  Q----WQVYVNCAAL  7791

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 77/161 (48%), Gaps = 20/161 (12%)
 Frame = -3

Query  233   MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDD---------FVGYLDANGFDSL  283
               H  +  PA ++T+ G   ++          FS + +         F    D++ + SL
Sbjct  1829  QGHGYMSDPAVSFTINGDITQFIGTIEASASGFSGSFNSDPASNAAAFTKAFDSSSYKSL  1650

Query  284   RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
             + F+ +       A+ +  CG +DPDA  QP+PD  +      + G+T  H+GPCE+W D
Sbjct  1649  KEFVTEKMTPISGATKE--CGLSDPDATAQPLPDTYVEWAHSSNEGFTPSHEGPCEIWCD  1476

Query  337   DTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGV  375
             DTRV Q D+C  H   +      D ++C GS  L ++WL +
Sbjct  1475  DTRVFQDDDCAAHYTSAPAQLKYDRASCVGSSRLTFFWLAL  1353

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (52%), Gaps = 15/128 (12%)
 Frame = -3

Query  275   LDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--H  327
             +  +G+ +L+ +++     ++   A   CG   PDA PQP+P   +      + G T  H
Sbjct  3722  VPTSGYSTLKNYVNVK--MTLIPGATEECGLAIPDATPQPLPAKYVEWYHSPTEGLTESH  3549

Query  328   DGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
              GPCE++  +TRV ++D+C  H       +  D ++C G+  L +YWL +      Y WQ
Sbjct  3548  HGPCEIYCGNTRVFKNDDCSTHYKTIPAQFPYDRASCLGASHLTFYWLTLHE----YQWQ  3381

Query  386   VYKACVPI  393
             VY  CVP+
Sbjct  3380  VYINCVPL  3357

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 12/130 (9%)
 Frame = +1

Query  75    TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
             T  A   Y++L+ ++   G    T      CGLT P+   Q +P          + G+T 
Sbjct  7414  TAFASSSYSSLKEMVTSLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSDSEGFTA  7593

Query  131   --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
               +GPCEIW D+T      +C   +      + Y  + C  + R++++WL +        
Sbjct  7594  SHEGPCEIWCDDTRVFQEDDCAATYTTAPAKLPYDSASCSGASRLTFYWLAL----HSSQ  7761

Query  187   WQVFKNCINL  196
             WQV+ NC  L
Sbjct  7762  WQVYVNCAAL  7791

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 55/123 (45%), Gaps = 12/123 (10%)
 Frame = +2

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
            Y +L+ ++ D G    T      CGLT P+   Q +P          T G+T   +GPCE
Sbjct  191  YTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSSTEGFTASHEGPCE  370

Query  136  IWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            IW D+T      +C   +      + Y    C  + +++++WL +       +WQV+ NC
Sbjct  371  IWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALH----SSTWQVYINC  538

Query  194  INL  196
              L
Sbjct  539  AAL  547

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 67/154 (44%), Gaps = 24/154 (16%)
 Frame = -3

Query  57    SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
             SP   ++ + +H  +    +   + Y  ++  +    +   TEE    CGL  P+   QP
Sbjct  3764  SPRPNVQCRPIHEVVPTSGYSTLKNYVNVKMTL----IPGATEE----CGLAIPDATPQP  3609

Query  117   IPTNGSFI------TSGYTLD--GPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCG  166
             +P    ++      T G T    GPCEI+  NT      +C T +         D + C 
Sbjct  3608  LP--AKYVEWYHSPTEGLTESHHGPCEIYCGNTRVFKNDDCSTHYKTIPAQFPYDRASCL  3435

Query  167   ESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              +  ++++WL +      Y WQV+ NC+ L A++
Sbjct  3434  GASHLTFYWLTL----HEYQWQVYINCVPLVATS  3345

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 62/133 (47%), Gaps = 20/133 (15%)
 Frame = +2

Query  82    YATLRALMDDDGLYSVTEEGLFDCGLTFPN-------TETQPIPTNGSFITSGYTLD--G  132
             YA +R ++  + +  V++    DCG + P+        +T     +      G+ +   G
Sbjct  9248  YANVREMIVANQVV-VSDSATADCGFSDPSKTSYGALNDTIYWGKSADLTGEGFVVGHMG  9424

Query  133   PCEIWIDNTLALAGRNCHTEFPEGHHT------IDYSVCGESCRVSWFWLGIKYQGERYS  186
             PCE W D+ LA    NC   +     +      ID S C  + R++++W+ +   G +  
Sbjct  9425  PCETWCDDNLAQQDMNCQVTYNPASGSGAAPVPIDTSKCASAKRLTFYWIAM--HGAQ--  9592

Query  187   WQVFKNCINLSAS  199
             WQV+ NCIN++ +
Sbjct  9593  WQVYINCININGN  9631

 Score = 45.4 bits (106),  Expect(2) = 0.002, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (48%), Gaps = 14/86 (16%)
 Frame = -3

Query  104   DCGLTFPNTETQPIP---------TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
             +CGL+ P+   QP+P         +N  F  S    +GPCEIW D+T      +C   + 
Sbjct  1601  ECGLSDPDATAQPLPDTYVEWAHSSNEGFTPS---HEGPCEIWCDDTRVFQDDDCAAHYT  1431

Query  155   EGHHTIDY--SVCGESCRVSWFWLGI  178
                  + Y  + C  S R+++FWL +
Sbjct  1430  SAPAQLKYDRASCVGSSRLTFFWLAL  1353

 Score = 20.0 bits (40),  Expect(2) = 0.002, Method: Compositional matrix adjust.
 Identities = 7/13 (54%), Positives = 8/13 (62%), Gaps = 0/13 (0%)
 Frame = -1

Query  187   WQVFKNCINLSAS  199
             WQV+ NC  L  S
Sbjct  1342  WQVYINCAPLEGS  1304

 Score = 44.7 bits (104),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 48/115 (42%), Gaps = 20/115 (17%)
 Frame = +2

Query  295   VNASADFRCGFTDPDAAP-QPIPDGI-------MRSTGYT--HDGPCEVWLDDTRVLQHD  344
             V+ SA   CGF+DP       + D I       +   G+   H GPCE W DD    Q  
Sbjct  9290  VSDSATADCGFSDPSKTSYGALNDTIYWGKSADLTGEGFVVGHMGPCETWCDDNLAQQDM  9469

Query  345   NCHEVISGKT------YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             NC    +  +        +D S C  +  L +YW+ +   +    WQVY  C+ I
Sbjct  9470  NCQVTYNPASGSGAAPVPIDTSKCASAKRLTFYWIAMHGAQ----WQVYINCINI  9622

>PYUU:scaffold_2029 scf1117875582029 dna:supercontig supercontig:pug:scf1117875582029:1:1550222:1 
REF
Length=1550222

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 78/175 (45%), Gaps = 21/175 (12%)
 Frame = -2

Query  234     AHQLVILPAPTY-------TVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDANGFD  281
               AH  + LP PT+       +  G  +    L    G +FST     T  +   + ++ + 
Sbjct  478075  AHSKMSLPKPTWDNGYGTNSPSGTIDGPTALKVPSGMSFSTDPTSNTKAYTAAIKSSSYG  477896

Query  282     SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDDTRV  340
               SL+A     +     + A   CGF+  + A QP+PD +       +H+GPCEVW D+T  
Sbjct  477895  SLKALAF--ATQKTESGATKECGFSKTNGAAQPLPDTVQWDELTSSHEGPCEVWCDNTMA  477722

Query  341     LQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  DNC +   G    L Y  S C+G+  L   WL +       +WQVY  C PI
Sbjct  477721  FHDDNCAKNYPGSPAKLPYDKSKCSGAKMLMSIWLAL----HTPTWQVYTNCAPI  477569

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 78/176 (44%), Gaps = 21/176 (12%)
 Frame = +2

Query  234     AHQLVILPAPTY-----------TVEGKDNRWKPLAFLEGQN-FSTTDDFVGYLDAN-GF  280
               AH  + LP PT+           T++G      P     G +  S T+ ++    A   +
Sbjct  490190  AHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKAQTKY  490369

Query  281     DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDDTR  339
                SL+     D+   V + A   CGF+D +  PQP+PD +       +H GPCEVW DD  
Sbjct  490370  KSLKDLAMSDA-QKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDDVM  490546

Query  340     VLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               V Q DNC   I      L Y  + C G   L  +W+ +     V +WQ+Y  C PI
Sbjct  490547  VFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIAL----HVPTWQIYTNCAPI  490702

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 59/123 (48%), Gaps = 15/123 (12%)
 Frame = +1

Query  280     FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCE  332
               + S+RA +D   ++      D +CG T    A QP+P   +      S G+T  H GPCE
Sbjct  503371  YKSMRALVDAKGVF--QPGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPCE  503544

Query  333     VWLDDTRVLQHDNCHE--VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               VW D+TRV Q DNC +    +      D S C G+  L  YWL +       +WQ Y  C
Sbjct  503545  VWCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLALHS----STWQAYINC  503712

Query  391     VPI  393
                P+
Sbjct  503713  APL  503721

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 76/180 (42%), Gaps = 25/180 (14%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRW------KPLAFLEGQNFST-----TDDFVGYLDANGFDS  282
               AH  + +P PT+T+ G   ++        L    G +F+T     T+ F   L  + + S
Sbjct  461947  AHGSMSVPKPTFTINGDTTQFCGTVDSSALTAPAGMSFTTDPLSNTNAFTAALKTSSYKS  462126

Query  283     LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWL  335
               +R   +   +  V   A  +CG+T    A QP+P   +        G+T  H GPCEVW 
Sbjct  462127  VRDLWNAKGVLGVTG-ATKQCGYTSATGAAQPLPAKYVEWSHGSGEGFTPSHQGPCEVWC  462303

Query  336     DDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D+       NC +        L  D++ C G   L  YWL +   +    WQ Y  C P+
Sbjct  462304  DNVLAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWLALHSPQ----WQAYINCAPL  462471

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 64/130 (49%), Gaps = 20/130 (15%)
 Frame = -1

Query  79      ERGYATLRALMDDDGLYSVTEEGL-FDCGLTFPNTETQPIP--------TNGSFITSGYT  129
               +  Y ++RAL+D  G++   + G+  +CG+T P  E QP+P        +N    T  +T
Sbjct  474164  QSTYKSVRALVDAKGVF---QPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT  473994

Query  130     LDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSW  187
                 GPCE+W DN LA +  NC T +P     +  D S C     + ++WL +       +W
Sbjct  473993  --GPCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLAL----HSSTW  473832

Query  188     QVFKNCINLS  197
               Q +  C  L+
Sbjct  473831  QAYIACAPLA  473802

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 74/177 (42%), Gaps = 26/177 (15%)
 Frame = +2

Query  235     HQLVILPAPTYTVEGKDNRW------KPLAFLEGQNFST-----TDDFVGYLDANGFDSL  283
               H  + +P PT+ ++G   ++        L    G +F+T     T  F   L A+ + S+
Sbjct  487547  HGSMSVPKPTFAIQGDTTQFGLTVDSTALTAPSGMSFTTDPESNTKAFTAALKASSYKSV  487726

Query  284     RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
               +  +    +    A A+  CG T      QP+PD  +        G+T  H GPCEVW D
Sbjct  487727  KDLIAAKGV--PIAGANKECGITTSTGTKQPLPDKFVEWSHGSGEGFTPSHQGPCEVWCD  487900

Query  337     DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               +T V   DNC +        L Y  S C G   L   WL +       +WQ Y +C 
Sbjct  487901  NTLVFSDDNCAKNYPAAPAQLPYEKSKCVGKSVLKTVWLALHSP----TWQAYISCA  488059

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 64/130 (49%), Gaps = 20/130 (15%)
 Frame = +2

Query  79      ERGYATLRALMDDDGLYSVTEEGL-FDCGLTFPNTETQPIP--------TNGSFITSGYT  129
               +  Y ++RAL+D  G++   + G+  +CG+T P  E QP+P        +N    T  +T
Sbjct  464879  QSTYKSVRALVDAKGVF---QPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT  465049

Query  130     LDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSW  187
                 GPCE+W DN LA +  NC T +P     +  D S C     + ++WL +       +W
Sbjct  465050  --GPCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLAL----HSSTW  465211

Query  188     QVFKNCINLS  197
               Q +  C  L+
Sbjct  465212  QAYIACAPLA  465241

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 56/123 (46%), Gaps = 15/123 (12%)
 Frame = -1

Query  280     FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCE  332
               + S+RA +D   ++      +  CG T P    QP+P   +      S G+T  H GPCE
Sbjct  474155  YKSVRALVDAKGVF--QPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  473982

Query  333     VWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               VW D+     +DNC  +   +      D S C G   L +YWL +       +WQ Y AC
Sbjct  473981  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQAYIAC  473814

Query  391     VPI  393
                P+
Sbjct  473813  APL  473805

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 56/123 (46%), Gaps = 15/123 (12%)
 Frame = +2

Query  280     FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCE  332
               + S+RA +D   ++      +  CG T P    QP+P   +      S G+T  H GPCE
Sbjct  464888  YKSVRALVDAKGVF--QPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  465061

Query  333     VWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               VW D+     +DNC  +   +      D S C G   L +YWL +       +WQ Y AC
Sbjct  465062  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQAYIAC  465229

Query  391     VPI  393
                P+
Sbjct  465230  APL  465238

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 64/130 (49%), Gaps = 20/130 (15%)
 Frame = +2

Query  82      YATLRALMDDDGLYSVTEEGL-FDCGLTFPNTETQPIP--------TNGSFITSGYTLDG  132
               Y ++RAL+D  G++   + G+  +CG+T P  E QP+P        +N    T  +T  G
Sbjct  467468  YKSVRALVDAKGVF---QPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--G  467632

Query  133     PCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               PCE+W DN LA +  NC T +P     +  D S C     + ++WL +       +WQ +
Sbjct  467633  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLAL----HSSTWQAY  467800

Query  191     KNCINLSASA  200
                 C  L+  +
Sbjct  467801  IACAPLAGGS  467830

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 75/176 (43%), Gaps = 22/176 (13%)
 Frame = +1

Query  234     AHQLVILPAPTY-------TVEGKDNRWKPLAFLEGQNF-----STTDDFVGYLDAN-GF  280
               AH  + LP PT+       +  G  +  K L    G +F     S T  F     A   +
Sbjct  470329  AHSKMALPKPTWNPVWGTNSPSGTIDGPKALTVPGGMSFGTDPTSNTKAFTAAFKAQTKY  470508

Query  281     DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDDTR  339
                SL+  +   +  +V +     CGF+     PQP+PD +       +H+GPCE+W D+  
Sbjct  470509  KSLKDLVF--ATQTVESGTTKECGFSLVSGTPQPLPDVVEWDELTPSHEGPCEIWCDNKL  470682

Query  340     VLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  ++NC +   G    L Y  S C G+  L   WL +       +WQVY  C P+
Sbjct  470683  AFSNENCAKNYPGTPAKLPYDKSKCTGAKMLTSIWLAL----HTPTWQVYTNCAPL  470838

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 73/167 (44%), Gaps = 20/167 (12%)
 Frame = +3

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               SG  +G  VL PP      GM +   P +    +    A +AQT      Y +++ ++D 
Sbjct  472356  SGTIDGPSVLTPP-----SGMSFSTDPAS--NTKAYTAAFKAQT-----KYTSMKQMVD-  472496

Query  92      DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
                    +      +CG +  N   QP+P    +     + +GPCE+W D+ LA +  NC  
Sbjct  472497  -ATQKLESGASKECGFSLVNGAAQPLPDQVEWDQLPASHEGPCEVWCDDKLAFSDENCAI  472673

Query  152     EFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                +P+    + Y  S C  +  ++  WL +       +WQV+ NC  L
Sbjct  472674  NYPDSPAKLPYDKSKCTGAKMLTSVWLALHVP----TWQVYYNCAPL  472802

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 56/123 (46%), Gaps = 15/123 (12%)
 Frame = +2

Query  280     FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCE  332
               + S+RA +D   ++      +  CG T P    QP+P   +      S G+T  H GPCE
Sbjct  467468  YKSVRALVDAKGVF--QPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  467641

Query  333     VWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               VW D+     +DNC  +   +      D S C G   L +YWL +       +WQ Y AC
Sbjct  467642  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQAYIAC  467809

Query  391     VPI  393
                P+
Sbjct  467810  APL  467818

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 76/180 (42%), Gaps = 30/180 (17%)
 Frame = +3

Query  234     AHQLVILPAPTY-----------TVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDA  277
               AH  + LP PT+           T++G      P     G +FST     T  +     A
Sbjct  472293  AHSKMALPKPTWDPAWGTNSPSGTIDGPSVLTPP----SGMSFSTDPASNTKAYTAAFKA  472460

Query  278     N-GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
                  + S++  +D  +   + + A   CGF+  + A QP+PD +       +H+GPCEVW 
Sbjct  472461  QTKYTSMKQMVD--ATQKLESGASKECGFSLVNGAAQPLPDQVEWDQLPASHEGPCEVWC  472634

Query  336     DDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               DD      +NC          L Y  S C G+  L   WL +     V +WQVY  C P+
Sbjct  472635  DDKLAFSDENCAINYPDSPAKLPYDKSKCTGAKMLTSVWLAL----HVPTWQVYYNCAPL  472802

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 76/180 (42%), Gaps = 27/180 (15%)
 Frame = -1

Query  235     HQLVILPAPTYTVEGKDNRW-------KPLAFLEGQNFST-----TDDFVGYLDANGFDS  282
               H  + +P  T+++ G   ++         L    G +F+T     T  F   L  + + S
Sbjct  498908  HGYMSVPKVTFSISGDTTQFCGTIDGPSTLTAPTGMSFTTDPASNTAAFTKALANSSYTS  498729

Query  283     LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWL  335
               +R  ++D  ++   A+    CG T+    PQP+P   +      + G+T  H GPCEVW 
Sbjct  498728  VRELVEDKGVFITGATK--TCGITEETEDPQPLPAKYVEWSHSSTEGFTASHQGPCEVWC  498555

Query  336     DDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               DD      +NC    +     L Y  + C G+  L   WL +       +WQ+Y  C  +
Sbjct  498554  DDNLAFSDENCAADYTTAPAQLPYDRTKCLGTSLLKIVWLAL----HSSTWQIYINCATL  498387

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 62/138 (45%), Gaps = 12/138 (9%)
 Frame = -3

Query  262     GQNFS--TTDDFVGYLDA----NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPI  315
               GQ+++  T  +   Y++A      + +L+  + D  +   N   D  CG TD     QP+
Sbjct  614490  GQSYAMGTDTNIKAYVEAFAKQTKWKTLKDLIMDKYVEDGNI-PDRACGLTDKTYM-QPL  614317

Query  316     PDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGV  375
               PD  +      H GPCEVW DD RV   ++C     G     D S C G   L+  +LG+
Sbjct  614316  PDKYVVWQAGQHPGPCEVWCDDVRVFADNDCATNYPGINLPYDRSKCVGKKVLWSMFLGM  614137

Query  376     RYLKQVYSWQVYKACVPI  393
                    V  WQVY  C  I
Sbjct  614136  ----HVPQWQVYMGCTGI  614095

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 73/177 (41%), Gaps = 29/177 (16%)
 Frame = +3

Query  234     AHQLVILPAP-----------TYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDS  282
               AH  + +PAP           T T+ G D  +   AF    + +  +    + +     +
Sbjct  496806  AHGFLAIPAPFFKTGVDITSYTSTIMG-DATYPGFAFNTAPSINMENFVKNFKNDAKHPN  496982

Query  283     LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR--------STGYTHDGPCEVW  334
               LRA ++ ++   V   AD +CG+TDP      + +  +           G+ H GPCE W
Sbjct  496983  LRALVEKEAKV-VATGADAQCGWTDPSKTSYTLTNSTITYGRNFEGTGEGFVHPGPCETW  497159

Query  335     LDDTRVLQHDNCHEVIS----GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                DD  V Q  +C E  +         +D + C G+  L  YW+ +   +    WQVY
Sbjct  497160  CDDVMVQQDMHCDETYNKPNKAAVIPIDVAKCKGAKQLTTYWIAMHGNE----WQVY  497318

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 14/128 (11%)
 Frame = -1

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLD-  131
               LA   Y ++R L++D G++         CG+T    + QP+P          T G+T   
Sbjct  498752  LANSSYTSVRELVEDKGVFIT--GATKTCGITEETEDPQPLPAKYVEWSHSSTEGFTASH  498579

Query  132     -GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQ  188
                GPCE+W D+ LA +  NC  ++      + Y  + C  +  +   WL +       +WQ
Sbjct  498578  QGPCEVWCDDNLAFSDENCAADYTTAPAQLPYDRTKCLGTSLLKIVWLAL----HSSTWQ  498411

Query  189     VFKNCINL  196
               ++ NC  L
Sbjct  498410  IYINCATL  498387

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 66/156 (42%), Gaps = 15/156 (10%)
 Frame = +1

Query  43      PPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGL  102
               P    V  GM +   P +    +    A +AQT      Y +L+ L+      +V     
Sbjct  470410  PKALTVPGGMSFGTDPTS--NTKAFTAAFKAQT-----KYKSLKDLVF--ATQTVESGTT  470562

Query  103     FDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY  162
                +CG +  +   QP+P    +     + +GPCEIW DN LA +  NC   +P     + Y
Sbjct  470563  KECGFSLVSGTPQPLPDVVEWDELTPSHEGPCEIWCDNKLAFSNENCAKNYPGTPAKLPY  470742

Query  163     --SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                 S C  +  ++  WL +       +WQV+ NC  L
Sbjct  470743  DKSKCTGAKMLTSIWLAL----HTPTWQVYTNCAPL  470838

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 65/154 (42%), Gaps = 18/154 (12%)
 Frame = -2

Query  43      PPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGL  102
               P    V  GM +   P +    +    AI++ +      Y +L+AL         TE G 
Sbjct  477994  PTALKVPSGMSFSTDPTS--NTKAYTAAIKSSS------YGSLKALAFAT---QKTESGA  477848

Query  103     F-DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTID  161
                 +CG +  N   QP+P    +     + +GPCE+W DNT+A    NC   +P     + 
Sbjct  477847  TKECGFSKTNGAAQPLPDTVQWDELTSSHEGPCEVWCDNTMAFHDDNCAKNYPGSPAKLP  477668

Query  162     Y--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               Y  S C  +  +   WL +       +WQV+ NC
Sbjct  477667  YDKSKCSGAKMLMSIWLAL----HTPTWQVYTNC  477578

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 13/128 (10%)
 Frame = +1

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP------TNGSFITSGYTL  130
               L    Y ++R L +  G+  VT      CG T      QP+P      ++GS      + 
Sbjct  462103  LKTSSYKSVRDLWNAKGVLGVTG-ATKQCGYTSATGAAQPLPAKYVEWSHGSGEGFTPSH  462279

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                GPCE+W DN LA    NC   +P     +  D++ C     ++ +WL +        WQ
Sbjct  462280  QGPCEVWCDNVLAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWLAL----HSPQWQ  462447

Query  189     VFKNCINL  196
                + NC  L
Sbjct  462448  AYINCAPL  462471

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 16/124 (13%)
 Frame = +1

Query  82      YATLRALMDDDGLYSVTEEGL-FDCGLTFPNTETQPIPTN----GSFITSGYTLD--GPC  134
               Y ++RAL+D  G++   + G+   CG+T      QP+P          + G+T    GPC
Sbjct  503371  YKSMRALVDAKGVF---QPGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPC  503541

Query  135     EIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
               E+W DNT      NC  ++      +  D S C  +  +  +WL +       +WQ + N
Sbjct  503542  EVWCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLALHSS----TWQAYIN  503709

Query  193     CINL  196
               C  L
Sbjct  503710  CAPL  503721

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/153 (24%), Positives = 62/153 (41%), Gaps = 14/153 (9%)
 Frame = +2

Query  43      PPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGL  102
               P    V  GM +   P++       +T    + + A+  Y +L+ L   D    V     
Sbjct  490271  PSTLTVPAGMSFGTDPLS-------NTNAYLKAFKAQTKYKSLKDLAMSDA-QKVESGAT  490426

Query  103     FDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY  162
                +CG +  N   QP+P    +     +  GPCE+W D+ +     NC    PE    + Y
Sbjct  490427  KECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDDVMVFQDDNCSVNIPEVPAVLKY  490606

Query  163     --SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
                 + C     ++ FW+ +       +WQ++ NC
Sbjct  490607  DKAKCVGKKMLTSFWIALHVP----TWQIYTNC  490693

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 50/108 (46%), Gaps = 18/108 (17%)
 Frame = -1

Query  294     SVNASADFRCGFTDPDAAPQPIPDGI-------MRSTGY--THDGPCEVWLDDTRVLQHD  344
               +V + A   CGF+ P+   Q +   +       +   G+  +H+GPCE W DD  V+Q+ 
Sbjct  442274  TVVSGATASCGFSSPNT-KQTLSSSVWWGKNTDLTGEGFVESHEGPCEAWCDDEMVMQNT  442098

Query  345     NC----HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYK  388
               NC    ++        +D S C+G+    +YW+ +        WQVY 
Sbjct  442097  NCATAYNKAGQAAEVPIDNSKCSGASQFTFYWIAMH----TNEWQVYS  441966

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 44/101 (44%), Gaps = 12/101 (12%)
 Frame = +2

Query  104     DCGLTFPNTETQPIP------TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
               +CG+T      QP+P      ++GS      +  GPCE+W DNTL  +  NC   +P   
Sbjct  487775  ECGITTSTGTKQPLPDKFVEWSHGSGEGFTPSHQGPCEVWCDNTLVFSDDNCAKNYPAAP  487954

Query  158     HTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                 + Y  S C     +   WL +       +WQ + +C  L
Sbjct  487955  AQLPYEKSKCVGKSVLKTVWLAL----HSPTWQAYISCAAL  488065

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 65/158 (41%), Gaps = 17/158 (11%)
 Frame = -3

Query  45      PFFVVDGMDYRGSPVAYLEQQGVHTAIEA--QTWLAERGYATLRALMDDDGLYSVTEEGL  102
               P   +DG      P       G  T I+A  + +  +  + TL+ L+ D       E+G 
Sbjct  614535  PLGTIDGPTVMPPPAGQSYAMGTDTNIKAYVEAFAKQTKWKTLKDLIMD----KYVEDGN  614368

Query  103     FD---CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
                    CGLT   T  QP+P       +G    GPCE+W D+    A  +C T +P  +  
Sbjct  614367  IPDRACGLTD-KTYMQPLPDKYVVWQAGQH-PGPCEVWCDDVRVFADNDCATNYPGINLP  614194

Query  160     IDYSVCGESCRVSW-FWLGIKYQGERYSWQVFKNCINL  196
                D S C    +V W  +LG+        WQV+  C  +
Sbjct  614193  YDRSKCVGK-KVLWSMFLGMHVP----QWQVYMGCTGI  614095

 Score = 43.5 bits (101),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 9/67 (13%)
 Frame = +2

Query  326     THDGPCEVWLDDTRVLQHDNCHEVISGK-----TYDLDYSACNGSCTLYWYWLGVRYLKQ  380
               +H+GPCEVW DD  V  + NC      K        +D + C G+  L +YW+ +   + 
Sbjct  494900  SHEGPCEVWCDDNMVQTNMNCVRAYPNKPGHAAEVPIDVAKCAGAKKLTFYWIAMHGNE-  495076

Query  381     VYSWQVY  387
                  WQVY
Sbjct  495077  ---WQVY  495088

 Score = 40.4 bits (93),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 19/127 (15%)
 Frame = -1

Query  77      LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT------NGSFITSGY--  128
                A+  Y+ ++ ++ +    +V       CG + PNT+ Q + +      N      G+  
Sbjct  442325  FADGQYSDIKTMILEH--QTVVSGATASCGFSSPNTK-QTLSSSVWWGKNTDLTGEGFVE  442155

Query  129     TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT----IDYSVCGESCRVSWFWLGIKYQGER  184
               + +GPCE W D+ + +   NC T + +        ID S C  + + +++W+ +      
Sbjct  442154  SHEGPCEAWCDDEMVMQNTNCATAYNKAGQAAEVPIDNSKCSGASQFTFYWIAMHTN---  441984

Query  185     YSWQVFK  191
                 WQV+ 
Sbjct  441983  -EWQVYS  441966

 Score = 40.4 bits (93),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 35/71 (49%), Gaps = 9/71 (13%)
 Frame = +2

Query  131     DGPCEIWIDNTLALAGRNCHTEFPE--GHHT---IDYSVCGESCRVSWFWLGIKYQGERY  185
               +GPCE+W D+ +     NC   +P   GH     ID + C  + +++++W+ +       
Sbjct  494906  EGPCEVWCDDNMVQTNMNCVRAYPNKPGHAAEVPIDVAKCAGAKKLTFYWIAMHGN----  495073

Query  186     SWQVFKNCINL  196
                WQV+   + L
Sbjct  495074  EWQVYSKYLQL  495106

>PYIR:scaffold_2812 pir_scaffold_2812 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2812:1:2225:1 
REF
Length=2225

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 72/171 (42%), Gaps = 18/171 (11%)
 Frame = +1

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDAN-----------GFDS  282
             AH  ++ P PT++  G          ++         FVG  D N           G  S
Sbjct  889   AHGNLVRPQPTFSGYGXXXXXXXXXIIQTAKLKAGQSFVGAPDTNAASFDAAFKAAGKSS  1068

Query  283   LRAFM--DDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRV  340
             L+ F+  + D+           CGF++P+  PQP+PD +   TG+ H GPCE + D+  V
Sbjct  1069  LKDFILANQDTSQGSAKGLSPACGFSNPNGTPQPLPDTLQWGTGFIHPGPCEAYCDNEIV  1248

Query  341   LQHD-NCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
             + +  NC +  +        + C G   L +YWL V        WQVY  C
Sbjct  1249  VPYTANCWKTFASGAVPYSKAKCAGKKQLTFYWLAV----HGPPWQVYSKC  1389

 Score = 45.1 bits (105),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 41/90 (46%), Gaps = 6/90 (7%)
 Frame = +1

Query  105   CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTIDYS  163
             CG + PN   QP+P    + T G+   GPCE + DN + +    NC   F  G      +
Sbjct  1135  CGFSNPNGTPQPLPDTLQWGT-GFIHPGPCEAYCDNEIVVPYTANCWKTFASGAVPYSKA  1311

Query  164   VCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
              C    +++++WL +        WQV+  C
Sbjct  1312  KCAGKKQLTFYWLAV----HGPPWQVYSKC  1389

>PLHA:NW_020189511.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2604, whole genome shotgun sequence
Length=604050

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 29/181 (16%)
 Frame = -1

Query  233     MAHQLVILPAPTYTVEGKDNRW----KPLAFLEGQNFSTTDD------FVGYLDANGFDS  282
                AH  +  P PT+  + + N+W    KPL   +G    +  D      F      N + +
Sbjct  431478  QAHGYIAKPPPTWKSK-ETNKWVVEIKPL--WDGPWDKSKGDEGLLSTFKELAAKNNYKN  431308

Query  283     LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
               +R  MD +  +  +      CGFTDP   P  P  DG    S G  H GPCE+W +D  +
Sbjct  431307  VRTLMDGNPAFGED------CGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELWCNDKMI  431146

Query  341     LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
               LQ+D+C       T         + YS C +G   L +YWL ++ L+    WQ YK C+P
Sbjct  431145  LQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIP  430966

Query  393     I  393
               +
Sbjct  430965  L  430963

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 61/130 (47%), Gaps = 15/130 (12%)
 Frame = -1

Query  78      AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
               A+  Y  +R LMD +  +        DCG T P  +    P++G+   S G    GPCE+
Sbjct  431328  AKNNYKNVRTLMDGNPAFGE------DCGFTDPKGKPVDPPSDGTATFSRGIVHAGPCEL  431167

Query  137     WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGESCR-VSWFWLGIKYQGERYSWQ  188
               W ++ + L   +C + + +G          + YS+C      + ++WL ++    +  WQ
Sbjct  431166  WCNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQ  430987

Query  189     VFKNCINLSA  198
                +KNCI L+ 
Sbjct  430986  AYKNCIPLTG  430957

>PYUU:scaffold_2038 scf1117875582038 dna:supercontig supercontig:pug:scf1117875582038:1:913258:1 
REF
Length=913258

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 83/190 (44%), Gaps = 56/190 (29%)
 Frame = +1

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
                ++ V++  P +  EGK + WK               F      +G+ +LR+F+D+    
Sbjct  601273  GNEWVVILKPAWPWEGKGS-WK--------GGDQAGQFAKLSKKHGYKTLRSFLDNKGQ-  601422

Query  294     SVNASADFRCGFTDPDAAPQPIP-DGIMR----STGYTHD--------------------  328
                        CG+T+  A P+ IP DG +     + G+TH                     
Sbjct  601423  --------TCGWTNSKATPKAIPADGKVVFQHVNAGFTHQVH*VVCCVSLKNIEVCTHTL  601578

Query  329     ----GPCEVWLDDTRVLQHDNCHEVISGK-----TYDLDYSACNGSCTLYWYWLGVRYLK  379
                   GPCE+WLD+  VL +DNC +  +GK        +D+S+C GSC L +YWLG     
Sbjct  601579  NASQGPCEIWLDNKMVLHNDNCEKAFAGKGITESKMPVDFSSCKGSCMLRFYWLGF----  601746

Query  380     QVYSWQVYKA  389
               Q   WQVY A
Sbjct  601747  QNEQWQVYSA  601776

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 67/160 (42%), Gaps = 53/160 (33%)
 Frame = +1

Query  79      ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI----TSGYT-----  129
               + GY TLR+ +D+ G           CG T      + IP +G  +     +G+T     
Sbjct  601375  KHGYKTLRSFLDNKGQ---------TCGWTNSKATPKAIPADGKVVFQHVNAGFTHQVH*  601527

Query  130     -------------------LDGPCEIWIDNTLALAGRNCHTEFP-----EGHHTIDYSVC  165
                                    GPCEIW+DN + L   NC   F      E    +D+S C
Sbjct  601528  VVCCVSLKNIEVCTHTLNASQGPCEIWLDNKMVLHNDNCEKAFAGKGITESKMPVDFSSC  601707

Query  166     GESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMI  205
                 SC + ++WLG  +Q E+  WQV+       +++LV M+
Sbjct  601708  KGSCMLRFYWLG--FQNEQ--WQVY-------SASLVAML  601794

>PLHA:NW_020186941.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_20, whole genome shotgun sequence
Length=72972

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 17/137 (12%)
 Frame = -2

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
               G    +   F     AN F  L+  MD  +  +       +CGF+DP   PQPIP DG 
Sbjct  30140  NGNTQKSVKTFQKLKAANKFKDLKTLMDTSAFGA-------KCGFSDPKGKPQPIPKDGK  29982

Query  320    MR-STGYTHDGPCEVWLDDTRVLQHDNCH------EVISGKTYDLDYSAC-NGSCT-LYW  370
                 S    H GPCE+WLD+ +VL  D+C+      +V     + +DYS+C NG C  + +
Sbjct  29981  ATFSRAIVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRF  29802

Query  371    YWLGVRYLKQVYSWQVY  387
              YWL  + +     WQ Y
Sbjct  29801  YWLAFQGVNGKTVWQSY  29751

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 62/121 (51%), Gaps = 17/121 (14%)
 Frame = +1

Query  277    ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DG-IMRSTGYTHDGPCEVW  334
              AN F  L+  M+  +L          CGF+DP   PQPIP DG    S    H GPCE+W
Sbjct  55978  ANNFKDLKTLMETHALGP-------ECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMW  56136

Query  335    LDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYWYWLGVRYLKQVYSWQV  386
              LD+ +VL  D+C+     +   +      DYS+C NG C  + +YWL  + +K +  WQ 
Sbjct  56137  LDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQS  56316

Query  387    Y  387
              Y
Sbjct  56317  Y  56319

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 80/170 (47%), Gaps = 23/170 (14%)
 Frame = +1

Query  234    AHQLVILPAPTYTVEGKDN---RWKPL---AFLEGQNFSTTDDFVGYLDANGFDSLRAFM  287
              +H  + +P   +  +G D    + +PL   +   G    +   F     AN F  L+  M
Sbjct  40513  SHGYMYIPRTQFKGQGNDGWIVQIEPLWKSSDWNGNTQKSVKAFQSLKAANNFKDLKTLM  40692

Query  288    DDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQHDN  345
              D+  L          CG++DP+  PQPIP DG    S    H GPCE+WLD+ +VL  D+
Sbjct  40693  DNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSRAMVHTGPCEMWLDNKKVLYEDD  40851

Query  346    CH------EVISGKTYDLDYSAC-NGSCT-LYWYWLGVRYLKQVYSWQVY  387
              C+      +V     + +DYS+C NG C  + +YWL  + +     WQ Y
Sbjct  40852  CYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQGINGKTFWQSY  41001

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 60/126 (48%), Gaps = 16/126 (13%)
 Frame = +1

Query  74     QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDG  132
              Q+  A   +  L+ LMD+  L         DCG + PN + QPIP +G +  +      G
Sbjct  40645  QSLKAANNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSRAMVHTG  40803

Query  133    PCEIWIDNTLALAGRNCHTEFP------EGHHTIDYSVC--GESCRVSWFWLGIKYQGER  184
              PCE+W+DN   L   +C++++       +    +DYS C  G   ++ ++WL  +    +
Sbjct  40804  PCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQGINGK  40983

Query  185    YSWQVF  190
                WQ +
Sbjct  40984  TFWQSY  41001

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 56/126 (44%), Gaps = 16/126 (13%)
 Frame = -2

Query  74     QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDG  132
              Q   A   +  L+ LMD     +        CG + P  + QPIP +G +  +      G
Sbjct  30107  QKLKAANKFKDLKTLMDTSAFGA-------KCGFSDPKGKPQPIPKDGKATFSRAIVHTG  29949

Query  133    PCEIWIDNTLALAGRNCHTEFP------EGHHTIDYSVCGE-SCR-VSWFWLGIKYQGER  184
              PCEIW+DN   L   +C++++       +    +DYS C    C+ + ++WL  +    +
Sbjct  29948  PCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGK  29769

Query  185    YSWQVF  190
                WQ +
Sbjct  29768  TVWQSY  29751

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (47%), Gaps = 11/122 (9%)
 Frame = +1

Query  80     RGYATLRALMDDDGLYSVTEEGLF--DCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
              + Y +L+A  +   L ++ E      +CG + P  + QPIP +G + ++      GPCE+
Sbjct  55954  KAYQSLKAANNFKDLKTLMETHALGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEM  56133

Query  137    WIDNTLALAGRNCHTEFPEGHHTI------DYSVCGE-SCR-VSWFWLGIKYQGERYSWQ  188
              W+DN   L   +C+ ++      I      DYS C    C+ + ++WL  +       WQ
Sbjct  56134  WLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQ  56313

Query  189    VF  190
               +
Sbjct  56314  SY  56319

>PHRA:scaffold_131
Length=101106

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 80/176 (45%), Gaps = 31/176 (18%)
 Frame = +1

Query  235    HQLVILPAPTYTVEGKDNRW----KPLAFLEGQNFSTTDDFVGYLDA-------NGFDSL  283
              H  +ILP P    EG D        P   ++      +  +  Y +A       N   SL
Sbjct  95857  HGNIILPKP----EGNDQHHFYIGGPAGTIDMPEIIGSASYGDYYEAVDSWFTKNNIASL  96024

Query  284    RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRV  340
              + ++   + Y  + S    CG T  + APQP+P DG  +  + G +H GPCE+W DDTRV
Sbjct  96025  KEYI---TTYGTDIS---ECGVTKKNGAPQPVPSDGYAQHDNLGNSHPGPCEIWCDDTRV  96186

Query  341    LQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  NC    SG++     +D S C  S  L +YWL +     +  WQVY  CV +
Sbjct  96187  FHDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALH----IQPWQVYINCVAL  96342

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 78/190 (41%), Gaps = 31/190 (16%)
 Frame = +1

Query  23     LCFAQRRLDSGLGEGQVVLYPPPFFVVDGMD----YRGSPVAYLEQQGVHTAIE------  72
              + F    + S  G G ++L  P     +G D    Y G P   ++   +  +        
Sbjct  95818  IVFQATAISSTTGHGNIILPKP-----EGNDQHHFYIGGPAGTIDMPEIIGSASYGDYYE  95982

Query  73     -AQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYT  129
                 +W  +   A+L+  +   G        + +CG+T  N   QP+P++G       G +
Sbjct  95983  AVDSWFTKNNIASLKEYITTYGT------DISECGVTKKNGAPQPVPSDGYAQHDNLGNS  96144

Query  130    LDGPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
                GPCEIW D+T      NC  +F         ID S C  S  + ++WL +  Q     
Sbjct  96145  HPGPCEIWCDDTRVFHDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALHIQ----P  96312

Query  187    WQVFKNCINL  196
              WQV+ NC+ L
Sbjct  96313  WQVYINCVAL  96342

 Score = 37.7 bits (86),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 6/69 (9%)
 Frame = +1

Query  282    SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVL  341
              SL+ ++   + Y  N S    CG       P+P     M + G +H GPCE+W DD R  
Sbjct  99805  SLKEYI---TTYDTNISE---CGTPSRMTRPRPSYRTDMYTLGRSHLGPCEIWCDDKRAF  99966

Query  342    QHDNCHEVI  350
               ++  H  +
Sbjct  99967  NNNTNHRQV  99993

>HYAP:scaffold_176 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_176:1:128177:1 
REF
Length=128177

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 53/101 (52%), Gaps = 12/101 (12%)
 Frame = -3

Query  299    ADFRCGFTDPDAAPQPIPDGI----MRSTGYT--HDGPCEVWLDDTRVLQHDNC--HEVI  350
              A   CG TDP+  PQPIPD +      + G+T  H+GPCE W DDT+V Q +NC  H   
Sbjct  37089  ATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCEAWCDDTQVFQDENCAAHFTT  36910

Query  351    SGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              +      D + C+G+    +YWL +       +WQVY  C 
Sbjct  36909  APAKMPYDKAKCSGASRFTFYWLALHS----STWQVYVNCA  36799

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 12/129 (9%)
 Frame = -3

Query  75     TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN---GSFITSGYTL-  130
              T      +++++ L    G   V +    +CGLT PN   QPIP         T G+T  
Sbjct  37164  TAFGSSKFSSIKDLATSLGQI-VAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTAS  36988

Query  131    -DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSW  187
               +GPCE W D+T      NC   F      + Y  + C  + R +++WL +       +W
Sbjct  36987  HEGPCEAWCDDTQVFQDENCAAHFTTAPAKMPYDKAKCSGASRFTFYWLAL----HSSTW  36820

Query  188    QVFKNCINL  196
              QV+ NC  L
Sbjct  36819  QVYVNCAAL  36793

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 77/180 (43%), Gaps = 32/180 (18%)
 Frame = -3

Query  235    HQLVILPAPTYTVE--GKDNRWKPLAFLEGQNF--------------STTDDFVGYLDAN  278
              H  ++LP PT+  +   ++N   P AF++                  S T  F    +A+
Sbjct  42678  HNKMLLPLPTWPKDFYAQNN---PCAFVDPAKVLPVPTGLSYTYDPASNTKAFWTAFNAS  42508

Query  279    GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRS-TGYTHDGPCEVWLDD  337
               F S++  +         +SA+  CGF+  D  P+ +PD I       +H+GP EV+ DD
Sbjct  42507  SFKSIKQLIYKGQKLEPGSSAE--CGFSLVDGTPRDLPDQIQWDFFTASHEGPFEVYCDD  42334

Query  338    TRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                V +  N      E  +   Y  D + C G+  L  YWL +  +     WQVY  C P+
Sbjct  42333  KLVFKDWNAAIDFPEHPANTPY--DKAKCKGAKMLTSYWLALHSV----PWQVYTNCAPL  42172

 Score = 37.4 bits (85),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (46%), Gaps = 10/98 (10%)
 Frame = -3

Query  104    DCGLTFPNTETQPIP--TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPE--GHHT  159
              +CG +  +   + +P      F T+ +  +GP E++ D+ L     N   +FPE   +  
Sbjct  42444  ECGFSLVDGTPRDLPDQIQWDFFTASH--EGPFEVYCDDKLVFKDWNAAIDFPEHPANTP  42271

Query  160    IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
               D + C  +  ++ +WL +        WQV+ NC  L+
Sbjct  42270  YDKAKCKGAKMLTSYWLAL----HSVPWQVYTNCAPLT  42169

>PYVX:scaffold_2510 pve_scaffold_2510 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_2510:1:1138:1 
REF
Length=1138

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 64/134 (48%), Gaps = 24/134 (18%)
 Frame = -3

Query  271  FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-------DGIMRST  323
            F     + G+ SLRA +D+    SV+      CG T  D +P  +               
Sbjct  764  FTSTFPSTGYTSLRAMIDE----SVS-----DCGNTRTDVSPVDMTGKKVLHWQNDQEGV  612

Query  324  GY--THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLK  379
            G+  +H GPCEVW+DD  V   D+C  V +      D D+S C+GSCTL +YWL +    
Sbjct  611  GFVSSHHGPCEVWIDDVMVTHQDDCRAVYTSYPANVDADFSKCSGSCTLRFYWLALHEPN  432

Query  380  QVYSWQVYKACVPI  393
                WQ+YK C PI
Sbjct  431  ----WQIYKQCAPI  402

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 67/142 (47%), Gaps = 35/142 (25%)
 Frame = -3

Query  81   GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGS-------------FITSG  127
            GY +LRA++D         E + DCG T   T+  P+   G              F++S 
Sbjct  740  GYTSLRAMID---------ESVSDCGNT--RTDVSPVDMTGKKVLHWQNDQEGVGFVSSH  594

Query  128  YTLDGPCEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGER  184
            +   GPCE+WID+ +     +C   +T +P  +   D+S C  SC + ++WL +      
Sbjct  593  H---GPCEVWIDDVMVTHQDDCRAVYTSYP-ANVDADFSKCSGSCTLRFYWLAL----HE  438

Query  185  YSWQVFKNCINLSASALVTMIG  206
             +WQ++K C  ++ S   T +G
Sbjct  437  PNWQIYKQCAPITNSDYSTTVG  372

>PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:pug:scf1117875582028:1:960197:1 
REF
Length=960197

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 6/135 (4%)
 Frame = -1

Query  261     EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM  320
               +G     T  F     A G+ SL+A +D  +    N+  D         AA +   D   
Sbjct  821696  DGSPQENTQQFTSGFHAAGYSSLKALLDPVAPGCGNSRVDVPPVGVSRLAAMEFRNDEFH  821517

Query  321     RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYL  378
                    +H GPCEVW+D+ R+   D+C    +G   T  +++S C G CTL +YWL +   
Sbjct  821516  EGFVNSHHGPCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLALHEP  821337

Query  379     KQVYSWQVYKACVPI  393
                   +WQVYK CVPI
Sbjct  821336  ----TWQVYKQCVPI  821304

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 70/158 (44%), Gaps = 33/158 (21%)
 Frame = -1

Query  50      DGMDYRGSPVAYLEQ--QGVHTAIEAQTWLAERGYATLRALMD------DDGLYSVTEEG  101
                G  + GSP    +Q   G H A          GY++L+AL+D       +    V   G
Sbjct  821711  QGKKWDGSPQENTQQFTSGFHAA----------GYSSLKALLDPVAPGCGNSRVDVPPVG  821562

Query  102     LFD-CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI  160
               +     + F N E         F+ S +   GPCE+WIDN     G +C  +F     TI
Sbjct  821561  VSRLAAMEFRNDEFHE-----GFVNSHH---GPCEVWIDNKRMFHGDDCRAQFAGYPATI  821406

Query  161     --DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                 ++SVC   C ++++WL +       +WQV+K C+ +
Sbjct  821405  PVNFSVCQGKCTLTFYWLAL----HEPTWQVYKQCVPI  821304

>PHRA:scaffold_313
Length=18787

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 51/104 (49%), Gaps = 18/104 (17%)
 Frame = -2

Query  299    ADFRCGFTDPDAAPQPIPDGIMR------STGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              AD +CGFT  D  PQP+P             GYTH GPCE+++DD  VL  DNC     G
Sbjct  14745  ADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPG  14566

Query  353    KTYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYK  388
                 D        +DYS+CNG CT   YWLG     Q   WQ Y 
Sbjct  14565  GPNDSGIMSEMPVDYSSCNGDCTFSIYWLGF----QNAQWQAYS  14446

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 64/146 (44%), Gaps = 26/146 (18%)
 Frame = -2

Query  74     QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI-----TSGY  128
              +T  AE+G +    ++D  G           CG T  + + QP+PTNG  +       GY
Sbjct  14805  KTMAAEKGVSVRDVVLDMVGADK-------KCGFTRTDVDPQPVPTNGKAVWLGNDGGGY  14647

Query  129    TLDGPCEIWIDNTLALAGRNCHTEFPEG--------HHTIDYSVCGESCRVSWFWLGIKY  180
              T  GPCE++ID+ + L   NC  ++P G           +DYS C   C  S +WLG   
Sbjct  14646  THVGPCELYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGF--  14473

Query  181    QGERYSWQVFKN--CINLSASALVTM  204
                +   WQ +    C   +   LV M
Sbjct  14472  --QNAQWQAYSTSMCFYFTVIVLVLM  14401

>PYVX:scaffold_385 pve_scaffold_385 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_385:1:26997:1 
REF
Length=26997

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 14/137 (10%)
 Frame = -3

Query  266    STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR----  321
              + T  F    DA+ + SLR F++D     V +     CG+T+P+   Q +PD  +     
Sbjct  26122  TNTASFTKAFDASTYTSLREFVEDLGQV-VESDFTITCGYTNPNETAQALPDEYVEWAHT  25946

Query  322    -STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVR  376
               + G+T  H+GPCEVW D+TRV Q D+C    +     L  D  AC GS  L +YWL + 
Sbjct  25945  STEGFTSSHEGPCEVWCDETRVFQDDDCAANYTTAPAKLPYDRDACLGSSALTFYWLAL-  25769

Query  377    YLKQVYSWQVYKACVPI  393
                    +WQVY  C  +
Sbjct  25768  ---HSSTWQVYINCAAL  25727

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 13/123 (11%)
 Frame = -3

Query  82     YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
              Y +LR  ++D G   V  +    CG T PN   Q +P          T G+T   +GPCE
Sbjct  26080  YTSLREFVEDLGQV-VESDFTITCGYTNPNETAQALPDEYVEWAHTSTEGFTSSHEGPCE  25904

Query  136    IWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
              +W D T      +C   +      +  D   C  S  ++++WL +       +WQV+ NC
Sbjct  25903  VWCDETRVFQDDDCAANYTTAPAKLPYDRDACLGSSALTFYWLALHSS----TWQVYINC  25736

Query  194    INL  196
                L
Sbjct  25735  AAL  25727

>PHRA:scaffold_28
Length=530368

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 51/104 (49%), Gaps = 18/104 (17%)
 Frame = +1

Query  299    ADFRCGFTDPDAAPQPIPDGIMR------STGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              AD +CGFT  D  PQP+P             GYTH GPCE+++DD  VL  DNC     G
Sbjct  77515  ADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPG  77694

Query  353    KTYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYK  388
                 D        +DYS+CNG CT   YWLG     Q   WQ Y 
Sbjct  77695  GPNDSGIMSEMPVDYSSCNGDCTFSIYWLGF----QNAQWQAYS  77814

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 66/146 (45%), Gaps = 26/146 (18%)
 Frame = +1

Query  74     QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI-----TSGY  128
              +T  AE+G +    ++D  G           CG T  + + QP+PTNG  +       GY
Sbjct  77455  KTMAAEKGVSVRDVVLDMVGADK-------KCGFTRTDVDPQPVPTNGKAVWLGNDGGGY  77613

Query  129    TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGESCRVSWFWLGIKY  180
              T  GPCE++ID+ + L   NC  ++P G +         +DYS C   C  S +WLG   
Sbjct  77614  THVGPCELYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGF--  77787

Query  181    QGERYSWQVFKN--CINLSASALVTM  204
                +   WQ +    C + +   LV M
Sbjct  77788  --QNAQWQAYSTSMCFHFTVIVLVLM  77859

>PYAP:scaffold_558 pag1_scaffold_558 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_558:1:21510:1 
REF
Length=21510

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 68/147 (46%), Gaps = 21/147 (14%)
 Frame = +1

Query  260    LEGQNFST--TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-  316
               EG+ ++   T +   + +A  F S + F     +  V       CG +     PQ +  
Sbjct  19399  FEGRKYNNDPTSNVKAFTEA--FKSQKTFKTLKDM--VEKQLKGSCGKSSGKGKPQSVEG  19566

Query  317    ------DGIMRSTGY--THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSC  366
                    +     TG+  +H GPCE+W+DDTRV+  DNC     G      ++YS C G C
Sbjct  19567  LSDVHWENTEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGEC  19746

Query  367    TLYWYWLGVRYLKQVYSWQVYKACVPI  393
               L +YWL +   +    WQVYK CVPI
Sbjct  19747  MLRFYWLALHEPE----WQVYKNCVPI  19815

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 16/99 (16%)
 Frame = +1

Query  100    EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP--EGH  157
              EGL D  + + NTE +       F++S     GPCEIWID+T  +   NC  +F      
Sbjct  19561  EGLSD--VHWENTEEKT-----GFVSS---HSGPCEIWIDDTRVMHEDNCVAKFKGYPAK  19710

Query  158    HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                ++YSVC   C + ++WL +        WQV+KNC+ +
Sbjct  19711  MPVNYSVCKGECMLRFYWLAL----HEPEWQVYKNCVPI  19815

>PYIW:scaffold_2639 piw_scaffold_2639 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_2639:1:4508:1 
REF
Length=4508

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 74/164 (45%), Gaps = 23/164 (14%)
 Frame = -3

Query  239   ILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNAS  298
             +LP P             LAF     FS+  D + Y +      LR  +D  +++S  A 
Sbjct  3852  VLPVPEGMSYSGSPEMNALAFKTA--FSSQTDSIKYRN------LRDLIDTKAVFS--AG  3703

Query  299   ADFRCGFTDPDAAPQPIPDGIMR----STG---YTHDGPCEVWLDDTRVLQHDNCHEVIS  351
              D  CGFT+  +A QP+    +     +TG    TH GPCE+W D   V Q+DNC +   
Sbjct  3702  TDKECGFTNVTSAKQPLSAQYVE*KSSATGGFTPTHQGPCEIWCDRVLVFQNDNCAKNYP  3523

Query  352   GKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  L Y  S C G+  L +YWL V  +K    W+ Y  C P+
Sbjct  3522  AAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAPL  3403

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 63/130 (48%), Gaps = 15/130 (12%)
 Frame = -3

Query  273   GYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-------DGIMRSTGY  325
              + + N + +LR  +D  +++S  A AD  CGFT    A QP+P       + + +    
Sbjct  1998  AFGNQNRYRNLRELVDFTAVFS--AGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAP  1825

Query  326   THDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYS  383
             TH+GPCEVW D     +  NC +   G    L Y  S C G+  L +YWL +        
Sbjct  1824  THEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSRE  1657

Query  384   WQVYKACVPI  393
             W+VY  CVP+
Sbjct  1656  WEVYINCVPL  1627

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 58/123 (47%), Gaps = 15/123 (12%)
 Frame = +2

Query  280  FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCE  332
            + SL+A +D +  +   AS +  CG T    A QP+P   +        G+T  H GPCE
Sbjct  278  YASLKALIDANGKFISGASKE--CGVTSATGAKQPLPATYVEWAHSNEEGFTPSHQGPCE  451

Query  333  VWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
            VW D      +DNC +  +     L Y  S C G+  L +YWL +       +WQ Y AC
Sbjct  452  VWCDGKVAFSNDNCPKNYATAPAKLPYDKSKCTGASMLKFYWLALHS----DTWQAYIAC  619

Query  391  VPI  393
             P+
Sbjct  620  APL  628

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 69/165 (42%), Gaps = 18/165 (11%)
 Frame = -3

Query  40    VLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE  99
             +L P    V +GM Y GSP   +      TA  +QT      Y  LR L+D   ++S   
Sbjct  3867  MLGPEVLPVPEGMSYSGSP--EMNALAFKTAFSSQT--DSIKYRNLRDLIDTKAVFSAGT  3700

Query  100   EGLFDCGLTFPNTETQPIPTN----GSFITSGYT--LDGPCEIWIDNTLALAGRNCHTEF  153
             +   +CG T   +  QP+        S  T G+T    GPCEIW D  L     NC   +
Sbjct  3699  DK--ECGFTNVTSAKQPLSAQYVE*KSSATGGFTPTHQGPCEIWCDRVLVFQNDNCAKNY  3526

Query  154   PEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             P     + Y  S C  +  + ++WL +        W+ + NC  L
Sbjct  3525  PAAPAQLPYQKSRCAGAKMLKFYWLAV----HSIKWEAYINCAPL  3403

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (46%), Gaps = 14/123 (11%)
 Frame = -3

Query  82    YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGY--TLDGPCE  135
             Y  LR L+D   ++S   +   +CG T      QP+P       + +  G   T +GPCE
Sbjct  1977  YRNLRELVDFTAVFSAGADK--ECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGPCE  1804

Query  136   IWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
             +W D  LA    NC   F      + Y  SVC  +  + ++WL +    +   W+V+ NC
Sbjct  1803  VWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEVYINC  1636

Query  194   INL  196
             + L
Sbjct  1635  VPL  1627

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 65/154 (42%), Gaps = 21/154 (14%)
 Frame = +2

Query  51   GMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFP  110
            G  + G P +        TA +AQT      YA+L+AL+D +G +        +CG+T  
Sbjct  206  GKSFSGDPSS--NALAFSTAFKAQT-----KYASLKALIDANGKF--ISGASKECGVTSA  358

Query  111  NTETQPIPTN----GSFITSGYTLD--GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--  162
                QP+P            G+T    GPCE+W D  +A +  NC   +      + Y  
Sbjct  359  TGAKQPLPATYVEWAHSNEEGFTPSHQGPCEVWCDGKVAFSNDNCPKNYATAPAKLPYDK  538

Query  163  SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            S C  +  + ++WL +       +WQ +  C  L
Sbjct  539  SKCTGASMLKFYWLALHSD----TWQAYIACAPL  628

>PYVX:scaffold_639 pve_scaffold_639 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_639:1:17349:1 
REF
Length=17349

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 59/111 (53%), Gaps = 7/111 (6%)
 Frame = -3

Query  286   FMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQH  343
             +   D +  +  +A   CG TD +AA QP+P DG++       H GPCEVWLDDT+V   
Sbjct  2317  YTGSDVIRDLANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHIGPCEVWLDDTKVASA  2138

Query  344   DNCHEVISGKTYDLDYSACNG-SCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             ++C    + KT  +DYS C G SC L W WL          W+++  CV +
Sbjct  2137  NDCWSTYADKTIPIDYSVCTGSSCQLRWVWLATHNDP----WEIFDNCVNV  1997

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = -3

Query  104   DCGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTID  161
             +CG T  N   QP+P++G  +F  S   + GPCE+W+D+T   +  +C + + +    ID
Sbjct  2269  NCGNTDGNAAVQPVPSDGLVTFDISAVHI-GPCEVWLDDTKVASANDCWSTYADKTIPID  2093

Query  162   YSVC-GESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             YSVC G SC++ W WL          W++F NC+N+
Sbjct  2092  YSVCTGSSCQLRWVWLAT----HNDPWEIFDNCVNV  1997

>PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.460, whole genome 
shotgun sequence
Length=3430

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 51/93 (55%), Gaps = 8/93 (9%)
 Frame = -3

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G    + D F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  719  DGNKPGSVDAFKALKTANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  558

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
               S    H GPCE+WLDDT+VL  D+C  + +
Sbjct  557  ATFSRAIVHVGPCEIWLDDTKVLYEDDCFTLTA  459

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 38/73 (52%), Gaps = 7/73 (10%)
 Frame = -3

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
              +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEIW+
Sbjct  668  NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  507

Query  139  DNTLALAGRNCHT  151
            D+T  L   +C T
Sbjct  506  DDTKVLYEDDCFT  468

>PYVX:scaffold_563 pve_scaffold_563 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_563:1:19577:1 
REF
Length=19577

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 68/138 (49%), Gaps = 20/138 (14%)
 Frame = +1

Query  262   GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM  320
             G  +   DD   +  ANG  SL+ ++      +   S D  CG T+ D  PQP+P DG  
Sbjct  7729  GDYYQAVDD---WFTANGISSLKEYI------TTYGSFD-ECGNTEKDGTPQPVPSDGYA  7878

Query  321   R--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGV  375
             +  + G +H GPCE+W DDTRV    NC    SG++     +D + C GS    +YWL +
Sbjct  7879  QHDTLGNSHPGPCEIWCDDTRVFTSTNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLAL  8058

Query  376   RYLKQVYSWQVYKACVPI  393
                     WQVY  CV +
Sbjct  8059  H----AQPWQVYINCVAL  8100

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 80/179 (45%), Gaps = 24/179 (13%)
 Frame = +2

Query  34    LGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQ-QGVHTAIEAQ------TWLAERGYATLR  86
             LG G ++L P P    D + Y G P   ++  + +  +I ++       W  E G ++L+
Sbjct  9446  LGHGNIIL-PKPTGDSDHVYYYGGPAGTIDMPEIIGDSIYSEYYQGVADWFTENGISSLK  9622

Query  87    ALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLAL  144
                     Y      + +CG T  +   QP+P++G     T G +  GPCEIW D+T   
Sbjct  9623  E-------YXXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGNSHPGPCEIWCDDTRVF  9781

Query  145   AGRNCHTEF---PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                NC T+F         ID + C  S    ++WL +  Q     WQV+ NC+ L  ++
Sbjct  9782  NSTNCVTDFSGQSPAMIPIDVATCTASSEFVFYWLALHAQ----PWQVYINCVALDGTS  9946

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 57/122 (47%), Gaps = 17/122 (14%)
 Frame = +2

Query  278   NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVW  334
             NG  SL+ +    +  S        CG T+ D   QP+P DG     + G +H GPCE+W
Sbjct  9602  NGISSLKEYXXXXTNIS-------ECGNTEKDGTAQPVPSDGYAEHDTLGNSHPGPCEIW  9760

Query  335   LDDTRVLQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              DDTRV    NC    SG++     +D + C  S    +YWL +        WQVY  CV
Sbjct  9761  CDDTRVFNSTNCVTDFSGQSPAMIPIDVATCTASSEFVFYWLALH----AQPWQVYINCV  9928

Query  392   PI  393
              +
Sbjct  9929  AL  9934

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 74/175 (42%), Gaps = 26/175 (15%)
 Frame = +1

Query  35    GEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIE-------AQTWLAERGYATLRA  87
             G G +++ P P    D + Y G P   ++   +  +            W    G ++L+ 
Sbjct  7615  GHGNIIV-PQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDDWFTANGISSLKE  7791

Query  88    LMDDDGLYSVTEEGLFD-CGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLAL  144
                      +T  G FD CG T  +   QP+P++G     T G +  GPCEIW D+T   
Sbjct  7792  Y--------ITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVF  7947

Query  145   AGRNCHTEF---PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                NC TEF         ID + C  S    ++WL +  Q     WQV+ NC+ L
Sbjct  7948  TSTNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLALHAQ----PWQVYINCVAL  8100

>PYAP:scaffold_583 pag1_scaffold_583 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_583:1:20637:1 
REF
Length=20637

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 83/184 (45%), Gaps = 37/184 (20%)
 Frame = +2

Query  234   AHQLVILP----APTYTVEGKDNRWKPLAFLEGQNFS-------TTDDFVGYLDANGFDS  282
             AH  + LP    A +YT  G ++     A+   Q F         T  F     A GF S
Sbjct  6188  AHGYISLPRASYANSYTKTGYNSILTASAYPAFQGFKWNGSPEDNTKAFTEGFRAGGFSS  6367

Query  283   LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPD-GIMR------STGY--THDGPCEV  333
             LRA +D          A   CG +  D AP  +    +M+        G+  +H GPCE 
Sbjct  6368  LRALLD---------PAAPGCGNSRTDVAPVDVSGLSVMQFQNDEEGKGFITSHHGPCEA  6520

Query  334   WLDDTRVLQHDNCHEVISG--KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKA  389
             W+D+TRV   D+C    +G   T  ++Y+AC    +C L +YWL +       +WQVYK 
Sbjct  6521  WIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLALHEA----NWQVYKQ  6688

Query  390   CVPI  393
             CVPI
Sbjct  6689  CVPI  6700

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 35/133 (26%)
 Frame = +2

Query  81    GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SFITSG  127
             G+++LRAL+D              CG +   T+  P+  +G              FITS 
Sbjct  6356  GFSSLRALLDPAAP---------GCGNS--RTDVAPVDVSGLSVMQFQNDEEGKGFITSH  6502

Query  128   YTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVC--GESCRVSWFWLGIKYQGE  183
             +   GPCE WIDNT    G +C  +F     T  I+Y+ C  G++C ++++WL +     
Sbjct  6503  H---GPCEAWIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLAL----H  6661

Query  184   RYSWQVFKNCINL  196
               +WQV+K C+ +
Sbjct  6662  EANWQVYKQCVPI  6700

>PYIR:scaffold_3497 pir_scaffold_3497 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_3497:1:1521:1 
REF
Length=1521

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 78/178 (44%), Gaps = 26/178 (15%)
 Frame = -1

Query  234   AHQLVILPAPTYTVEGKDNRW------KPLAFLEGQNFST-----TDDFVGYLDANGFDS  282
             AH  + +P PT+T++G   ++        L    G +F+T     T  F   +  + + S
Sbjct  1233  AHGSMSIPKPTFTIQGDTTQFAGTVDSSALTAPAGMSFTTDPESNTKAFTAAIKTSAYKS  1054

Query  283   LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWL  335
             +R  ++   +  + A A  +CG T     PQP+P   +      S G+T  H GPCEVW 
Sbjct  1053  VRDLINAKGV--MMAGATKQCGITSATGTPQPLPAKYVEWSHGASEGFTPSHQGPCEVWC  880

Query  336   DDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             DD     +DNC +       +L  D+S C G   L   WL +       +WQ Y  C 
Sbjct  879   DDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLALHS----PTWQAYINCA  718

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 54/128 (42%), Gaps = 14/128 (11%)
 Frame = -1

Query  77    LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLD-  131
             +    Y ++R L++  G+  +       CG+T      QP+P          + G+T   
Sbjct  1077  IKTSAYKSVRDLINAKGV--MMAGATKQCGITSATGTPQPLPAKYVEWSHGASEGFTPSH  904

Query  132   -GPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
              GPCE+W D+ LA    NC   +P       ID+S C     ++  WL +       +WQ
Sbjct  903   QGPCEVWCDDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLAL----HSPTWQ  736

Query  189   VFKNCINL  196
              + NC  L
Sbjct  735   AYINCAVL  712

>PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:pug:scf1117875581402:1:979788:1 
REF
Length=979788

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 28/139 (20%)
 Frame = -2

Query  268     TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY--  325
               T  F       G+ SL+  MD          A   CG++  D AP  +    M S  +  
Sbjct  147959  TQQFTAAWPKTGYKSLKQMMDK---------AVPGCGYSRTDIAPVDVSR--MSSMKFQN  147813

Query  326     ---------THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLG  374
                        +H GPCE W+D+TRV  +D+C     G   T  + + AC G+C L +YWL 
Sbjct  147812  NEYKEGFLASHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLA  147633

Query  375     VRYLKQVYSWQVYKACVPI  393
               +   K    WQ YK+CVPI
Sbjct  147632  LHSPK----WQAYKSCVPI  147588

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 66/137 (48%), Gaps = 24/137 (18%)
 Frame = -3

Query  268     TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPD-GIMR-----  321
               T  F       G+ SL+  MD          A   CG+++P+AAP  +     M+     
Sbjct  150133  TQQFTAAWPKTGYKSLKQMMD---------KAVPGCGYSNPNAAPVDVSKMSAMKFQNNE  149981

Query  322     -STGY--THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVR  376
                  G+  +H GPCE W+D+TRV  +D+C     G   T  + Y +C G+C L +YWL + 
Sbjct  149980  YKEGFLGSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALH  149801

Query  377     YLKQVYSWQVYKACVPI  393
                 K    WQ YK+CV I
Sbjct  149800  SPK----WQAYKSCVAI  149762

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 66/137 (48%), Gaps = 24/137 (18%)
 Frame = -2

Query  268     TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPD-GIMR-----  321
               T  F       G+ SL+  MD          A   CG+++P+AAP  +     M+     
Sbjct  153725  TQQFTAAWPKTGYKSLKQMMD---------KAVPGCGYSNPNAAPVDVSKMSAMKFQNNE  153573

Query  322     -STGY--THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVR  376
                  G+  +H GPCE W+D+TRV  +D+C     G   T  + Y +C G+C L +YWL + 
Sbjct  153572  YKEGFLGSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALH  153393

Query  377     YLKQVYSWQVYKACVPI  393
                 K    WQ YK+CV I
Sbjct  153392  SPK----WQAYKSCVAI  153354

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 28/136 (21%)
 Frame = -2

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----  325
               F     ++ + SLR  +D         SA   CGFT  D  P  +    ++S  +     
Sbjct  159932  FTTAFASSSYKSLREMLD---------SAVPDCGFTLTDGTPVDV--SSLKSMKWQNDQE  159786

Query  326     ------THDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRY  377
                     +H GPCE+W+DDT+++  D+C    +    ++  DYS C G C L +YWL +  
Sbjct  159785  QKGFIDSHHGPCELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLALHE  159606

Query  378     LKQVYSWQVYKACVPI  393
                    +WQ+YK CVPI
Sbjct  159605  P----NWQIYKQCVPI  159570

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 64/138 (46%), Gaps = 35/138 (25%)
 Frame = -2

Query  75      TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------  121
               T  A   Y +LR ++D           + DCG T   T+  P+  +              
Sbjct  159926  TAFASSSYKSLREMLD---------SAVPDCGFTL--TDGTPVDVSSLKSMKWQNDQEQK  159780

Query  122     SFITSGYTLDGPCEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGI  178
                FI S +   GPCE+WID+T  +   +C   +T +P     +DYSVC   C+++++WL +
Sbjct  159779  GFIDSHH---GPCELWIDDTKIMHSDDCRADYTAYP-AEIPVDYSVCKGKCQLTFYWLAL  159612

Query  179     KYQGERYSWQVFKNCINL  196
                      +WQ++K C+ +
Sbjct  159611  ----HEPNWQIYKQCVPI  159570

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 24/128 (19%)
 Frame = -1

Query  271     FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAP---QPIPDGIMRSTGY--  325
               F       G+ SL+  +D        A+ D  CG + PD AP     + +   ++  Y  
Sbjct  158412  FTAAWPQTGYKSLKEMLDP-------AAPD--CGLSLPDVAPIDVSSMTEFKFQNNEYKE  158260

Query  326     ----THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLK  379
                   +H GPCE+W+ DTR   +D+C     G   T   D+S C G+C + +YWL +    
Sbjct  158259  GFIASHRGPCELWIGDTRAWHYDDCAAKFPGYPATIPTDFSVCKGTCRVTFYWLAL----  158092

Query  380     QVYSWQVY  387
                  +WQ+Y
Sbjct  158091  HSPNWQIY  158068

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 67/139 (48%), Gaps = 24/139 (17%)
 Frame = -1

Query  79      ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF------ITSGYTLD-  131
               + GY +L+ ++D             DCGL+ P+     + +   F         G+    
Sbjct  158394  QTGYKSLKEMLD---------PAAPDCGLSLPDVAPIDVSSMTEFKFQNNEYKEGFIASH  158242

Query  132     -GPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                GPCE+WI +T A    +C  +FP    TI  D+SVC  +CRV+++WL +       +WQ
Sbjct  158241  RGPCELWIGDTRAWHYDDCAAKFPGYPATIPTDFSVCKGTCRVTFYWLAL----HSPNWQ  158074

Query  189     VF-KNCINLSASALVTMIG  206
               ++ K    ++ S L+ M+G
Sbjct  158073  IYSKLAQRIACSWLLVMVG  158017

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 10/76 (13%)
 Frame = -1

Query  319     IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLG  374
               ++   G +  GPCE+WL++TRVL +D+C  V +  TY     ++YS C G+C L +YWL 
Sbjct  164214  VVLRFGLSS*GPCEIWLNNTRVLHNDDC--VATYTTYPAVLPVNYSVCKGNCILTFYWLA  164041

Query  375     VRYLKQVYSWQVYKAC  390
               +       +WQ+Y AC
Sbjct  164040  L----HEPNWQIYSAC  164005

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 60/130 (46%), Gaps = 23/130 (18%)
 Frame = -2

Query  81      GYATLRALMDDDGLYSVTEEGLFDCGLTFPN------TETQPIPTNGSFITSGY--TLDG  132
               GY +L+ +MD         + +  CG + PN      ++   +    +    G+  +  G
Sbjct  153692  GYKSLKQMMD---------KAVPGCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHG  153540

Query  133     PCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               PCE WIDNT      +C  +FP    TI   Y  C  +CR++++WL +        WQ +
Sbjct  153539  PCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLAL----HSPKWQAY  153372

Query  191     KNCINLSASA  200
               K+C+ +  +A
Sbjct  153371  KSCVAIKNNA  153342

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 60/130 (46%), Gaps = 23/130 (18%)
 Frame = -3

Query  81      GYATLRALMDDDGLYSVTEEGLFDCGLTFPN------TETQPIPTNGSFITSGY--TLDG  132
               GY +L+ +MD         + +  CG + PN      ++   +    +    G+  +  G
Sbjct  150100  GYKSLKQMMD---------KAVPGCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHG  149948

Query  133     PCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               PCE WIDNT      +C  +FP    TI   Y  C  +CR++++WL +        WQ +
Sbjct  149947  PCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLAL----HSPKWQAY  149780

Query  191     KNCINLSASA  200
               K+C+ +  +A
Sbjct  149779  KSCVAIKNNA  149750

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 60/129 (47%), Gaps = 21/129 (16%)
 Frame = -2

Query  81      GYATLRALMDDDGL---YSVTEEGLFDCG----LTFPNTETQPIPTNGSFITSGYTLDGP  133
               GY +L+ +MD       YS T+    D      + F N E +       F+ S +   GP
Sbjct  147926  GYKSLKQMMDKAVPGCGYSRTDIAPVDVSRMSSMKFQNNEYKE-----GFLASHH---GP  147771

Query  134     CEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFK  191
               CE WIDNT      +C  +FP    TI   +  C  +CR++++WL +        WQ +K
Sbjct  147770  CEGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLAL----HSPKWQAYK  147603

Query  192     NCINLSASA  200
               +C+ +  +A
Sbjct  147602  SCVPIKYNA  147576

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = -1

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGV  375
               GPCEVW+D+T   Q ++C +V  G    +DYS+C G C L +YWL V
Sbjct  139998  GPCEVWIDNTLRFQREDCSKVFPGAI-KMDYSSCQGDCVLRFYWLFV  139861

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 11/65 (17%)
 Frame = -2

Query  328     DGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGS-CTLYWYWLGVRYLKQVY  382
                GPCEVW+D+TRV  H++C  V + KTY     ++Y+AC  S CTL +YWL +       
Sbjct  162098  QGPCEVWIDNTRVFHHNDC--VAAYKTYPAVLPINYAACKTSKCTLTFYWLALHEP----  161937

Query  383     SWQVY  387
               +WQ+Y
Sbjct  161936  NWQIY  161922

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = -1

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGI  178
               GPCE+WIDNTL     +C   FP G   +DYS C   C + ++WL +
Sbjct  139998  GPCEVWIDNTLRFQREDCSKVFP-GAIKMDYSSCQGDCVLRFYWLFV  139861

 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (56%), Gaps = 6/61 (10%)
 Frame = -1

Query  329     GPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
               GPCE+W++DT+  Q ++C    +     + +DYS C G C L +Y + V   +    WQ+
Sbjct  178404  GPCEIWINDTKAFQTNDCRGYTTEYPAVFPVDYSVCKGDCVLTFYLVAVHEPQ----WQI  178237

Query  387     Y  387
               Y
Sbjct  178236  Y  178234

 Score = 45.1 bits (105),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 38/65 (58%), Gaps = 8/65 (12%)
 Frame = -1

Query  132     GPCEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               GPCEIW++NT  L   +C   +T +P     ++YSVC  +C ++++WL +       +WQ
Sbjct  164184  GPCEIWLNNTRVLHNDDCVATYTTYP-AVLPVNYSVCKGNCILTFYWLAL----HEPNWQ  164020

Query  189     VFKNC  193
               ++  C
Sbjct  164019  IYSAC  164005

 Score = 40.8 bits (94),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 34/64 (53%), Gaps = 8/64 (13%)
 Frame = -1

Query  132     GPCEIWIDNTLALAGRNCH---TEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               GPCEIWI++T A    +C    TE+P     +DYSVC   C ++++ + +        WQ
Sbjct  178404  GPCEIWINDTKAFQTNDCRGYTTEYP-AVFPVDYSVCKGDCVLTFYLVAV----HEPQWQ  178240

Query  189     VFKN  192
               ++  
Sbjct  178239  IYSK  178228

 Score = 38.9 bits (89),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 7/73 (10%)
 Frame = -2

Query  131     DGPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGES-CRVSWFWLGIKYQGERYSW  187
                GPCE+WIDNT      +C   +        I+Y+ C  S C ++++WL +       +W
Sbjct  162098  QGPCEVWIDNTRVFHHNDCVAAYKTYPAVLPINYAACKTSKCTLTFYWLAL----HEPNW  161931

Query  188     QVFKNCINLSASA  200
               Q++   + LS  A
Sbjct  161930  QIYSKFLLLSLWA  161892

>ALCA:scaffold_168 AcNc2_CONTIG_168_length_51659 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_168_length_51659:1:51659:1 
REF
Length=51659

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 71/139 (51%), Gaps = 24/139 (17%)
 Frame = -3

Query  260    LEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP--D  317
               +G     T  F+    ++ F +LR F+ D   Y         CG T+P+A+P+PIP  +
Sbjct  27906  FDGSPKDNTATFLTAFASSPFRTLRDFLKDKGPY---------CGSTNPNASPKPIPADN  27754

Query  318    GIM-----RSTGY--THDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTL  368
               I+        G+  +H GPCEVWL +TRV   DNC  H   S     +++S+C+G C L
Sbjct  27753  AIVWENPDTREGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLL  27574

Query  369    YWYWLGVRYLKQVYSWQVY  387
               ++WL +   +    WQVY
Sbjct  27573  QFFWLALHEPQ----WQVY  27529

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 51/126 (40%), Gaps = 23/126 (18%)
 Frame = -3

Query  75     TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSGY  128
              T  A   + TLR  + D G Y         CG T PN   +PIP + + +        G+
Sbjct  27867  TAFASSPFRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGF  27715

Query  129    TLD--GPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGER  184
                   GPCE+W+  T      NC   F        I++S C   C + +FWL +      
Sbjct  27714  VASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLAL----HE  27547

Query  185    YSWQVF  190
                WQV+
Sbjct  27546  PQWQVY  27529

>PLHA:NW_020187244.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_323, whole genome shotgun sequence
Length=2746546

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 13/131 (10%)
 Frame = +2

Query  271      FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM----RSTGYT  326
                F    D++ + S++ F+++     V   A+  CG T+P++ PQP+P+ I      + G+T
Sbjct  2022764  FNEAFDSSKYSSIKDFINNFGKI-VTHGANLECGLTNPNSTPQPLPNEIQWTHSDTEGFT  2022940

Query  327      --HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
                  H+GPCE W D TRV    NC  H   +      D + C G+  L +YWL +       
Sbjct  2022941  PSHEGPCEAWCDYTRVFHDGNCAAHFPTAPARLPFDRTGCLGANRLTFYWLALHSP----  2023108

Query  383      SWQVYKACVPI  393
                +WQ+Y  C P+
Sbjct  2023109  TWQIYVNCAPL  2023141

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 77/177 (44%), Gaps = 24/177 (14%)
 Frame = +1

Query  234     AHQLVILPAPTY--------TVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDANGF  280
               AH  + +P PT+        +  G  N  K L    G +++T     T  +    +++ F
Sbjct  373579  AHNKMAVPLPTWPAGFYAQNSPSGTINPEKVLPVPSGMSYTTNSASNTKAYWTAFNSSKF  373758

Query  281     DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRS--TGYTHDGPCEVWLDDT  338
                +L+    +      NAS +  CGF+  D  PQ +PD +     TG +H GPCEVW DD 
Sbjct  373759  KTLKELAWESQTLVDNASKE--CGFSVVDGTPQVLPDMVQWDFFTG-SHQGPCEVWCDDI  373929

Query  339     RVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                   + NC         +L Y  S C G+  L  YW+ +        WQVY  C P+
Sbjct  373930  LAFTNWNCAVDYPQTPANLPYDKSKCQGASVLSSYWIALH----TTPWQVYTNCAPL  374088

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 12/135 (9%)
 Frame = +2

Query  82       YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI---TSGYT--LDGPCEI  136
                Y++++  +++ G   VT     +CGLT PN+  QP+P    +    T G+T   +GPCE 
Sbjct  2022791  YSSIKDFINNFGKI-VTHGANLECGLTNPNSTPQPLPNEIQWTHSDTEGFTPSHEGPCEA  2022967

Query  137      WIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                W D T      NC   FP     +  D + C  + R++++WL +       +WQ++ NC 
Sbjct  2022968  WCDYTRVFHDGNCAAHFPTAPARLPFDRTGCLGANRLTFYWLALH----SPTWQIYVNCA  2023135

Query  195      NLSASALVTMIGLQH  209
                 L   + +     Q+
Sbjct  2023136  PLEGGSSLNSATQQN  2023180

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 37/71 (52%), Gaps = 6/71 (8%)
 Frame = +1

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQV  189
               GPCE+W D+ LA    NC  ++P+    + Y  S C  +  +S +W+ +        WQV
Sbjct  373900  GPCEVWCDDILAFTNWNCAVDYPQTPANLPYDKSKCQGASVLSSYWIAL----HTTPWQV  374067

Query  190     FKNCINLSASA  200
               + NC  L+ ++
Sbjct  374068  YTNCAPLTGAS  374100

>PYVX:scaffold_121 pve_scaffold_121 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_121:1:49194:1 
REF
Length=49194

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 73/161 (45%), Gaps = 38/161 (24%)
 Frame = -1

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP--DG  318
               G +  + D +V   + NG  ++R+ +DD S+Y  +      CG+T+PD   Q IP    
Sbjct  20010  NGNSQESVDTYVSLKEENGLSNIRSLLDDTSIYGAD------CGYTNPDGTAQDIPTDST  19849

Query  319    IMRSTGYTH----------------------DGPCEVWLDDTRVLQHDNCHEVISGKTYD  356
                 S G  H                       GPCE+WLDDT VL  D+C+ +  G   D
Sbjct  19848  ATFSRGMVHVVSHSRCS*WSGWC*IGLAXXXXGPCEIWLDDTMVLSEDDCYSLYGGDDQD  19669

Query  357    ------LDYSACN-GSCT-LYWYWLGVRYLKQVYSWQVYKA  389
                    +DYS+C+ G C+ + +YWL  + +     WQVY  
Sbjct  19668  VKSVFPVDYSSCDSGGCSEMRFYWLAFQGVDDETVWQVYST  19546

 Score = 57.4 bits (137),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 8/68 (12%)
 Frame = -3

Query  328    DGPCEVWLDDTRVLQHDNCHEVISG------KTYDLDYSACN-GSCT-LYWYWLGVRYLK  379
               GPCE+WLDDT VL  D+C+    G        +++DYS+CN G C  + +YWL  + + 
Sbjct  17638  QGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFNIDYSSCNSGGCKEMRFYWLAFQGVD  17459

Query  380    QVYSWQVY  387
                  WQVY
Sbjct  17458  GATKWQVY  17435

 Score = 37.7 bits (86),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (45%), Gaps = 6/56 (11%)
 Frame = -1

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
               G    + D +       G   +R+ +DD S+Y  +      CGFT+P    QPIP
Sbjct  17889  NGNTQQSVDTYKSLASEKGVSQIRSLLDDTSIYGAD------CGFTNPSGTAQPIP  17740

 Score = 50.1 bits (118),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 43/101 (43%), Gaps = 23/101 (23%)
 Frame = -1

Query  311    APQPIPDGIMRSTGYTH----------------DGPCEVWLDDTRVLQHDNCHEVISG--  352
               P  +P     ST Y H                 GPCE+WLDDT  + +D+C+    G  
Sbjct  24558  VPARLPSRAASSTWYVHR*VEQNRGLT*SNNVLQGPCEIWLDDTLAMYNDDCYSAYGGDE  24379

Query  353    ---KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYK  388
                   + +DYS C  +G   + +YWL  + +     WQVY 
Sbjct  24378  DVKSVFPVDYSTCESSGCSEMRFYWLAFQGVDDETVWQVYS  24256

 Score = 40.8 bits (94),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (54%), Gaps = 6/56 (11%)
 Frame = -3

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
              +G    +   ++   +  G  ++R+F+DD S+Y  +      CG+TDPD   QPIP
Sbjct  24709  DGNTNQSVTTYIELKEEKGVTNIRSFLDDTSIYGAD------CGYTDPDGTAQPIP  24560

 Score = 55.5 bits (132),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = -1

Query  329    GPCEVWLDDTRVLQHDNCHEVISGK-----TYDLDYSACNGS-CTLYWYWLGVRYLKQVY  382
              GPCE+WLDDT V+ +D+C     G+      + +DYS+C+ S C L +YWL ++ +    
Sbjct  28977  GPCEIWLDDTMVMYNDDCQAAYGGEQDIKSVFPVDYSSCSSSGCMLRFYWLALQGIDGEV  28798

Query  383    SWQVYK  388
               WQVY 
Sbjct  28797  VWQVYS  28780

 Score = 34.3 bits (77),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 7/36 (19%)
 Frame = -3

Query  282    SLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQPIP  316
              +LR+FMDDD SLY         CG+TDPD   + IP
Sbjct  29179  NLRSFMDDDTSLYGAE------CGYTDPDVDAKDIP  29090

 Score = 41.2 bits (95),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 9/58 (16%)
 Frame = -1

Query  64     QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG  121
              QQ V T    ++  +E+G + +R+L+DD  +Y        DCG T P+   QPIPT+G
Sbjct  17877  QQSVDTY---KSLASEKGVSQIRSLLDDTSIYGA------DCGFTNPSGTAQPIPTDG  17731

 Score = 41.2 bits (95),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 10/82 (12%)
 Frame = -3

Query  119    TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEF------PEGHHTIDYSVC--GESCR  170
              ++ + +T G  L GPCEIW+D+T+ L   +C++ +       +    IDYS C  G    
Sbjct  17668  SHATLLTFG--LQGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFNIDYSSCNSGGCKE  17495

Query  171    VSWFWLGIKYQGERYSWQVFKN  192
              + ++WL  +       WQV+  
Sbjct  17494  MRFYWLAFQGVDGATKWQVYST  17429

 Score = 45.8 bits (107),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 39/83 (47%), Gaps = 7/83 (8%)
 Frame = -1

Query  117    IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT-----IDYSVCGES--C  169
              +  N     S   L GPCEIW+D+TLA+   +C++ +           +DYS C  S   
Sbjct  24501  VEQNRGLT*SNNVLQGPCEIWLDDTLAMYNDDCYSAYGGDEDVKSVFPVDYSTCESSGCS  24322

Query  170    RVSWFWLGIKYQGERYSWQVFKN  192
               + ++WL  +   +   WQV+  
Sbjct  24321  EMRFYWLAFQGVDDETVWQVYSK  24253

 Score = 35.8 bits (81),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 28/56 (50%), Gaps = 9/56 (16%)
 Frame = -3

Query  64     QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT  119
               Q V T IE +    E+G   +R+ +DD  +Y        DCG T P+   QPIP+
Sbjct  24697  NQSVTTYIELK---EEKGVTNIRSFLDDTSIYGA------DCGYTDPDGTAQPIPS  24557

 Score = 43.9 bits (102),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 37/71 (52%), Gaps = 7/71 (10%)
 Frame = -1

Query  132    GPCEIWIDNTLALAGRNCHTEF-----PEGHHTIDYSVCGES-CRVSWFWLGIKYQGERY  185
              GPCEIW+D+T+ +   +C   +      +    +DYS C  S C + ++WL ++      
Sbjct  28977  GPCEIWLDDTMVMYNDDCQAAYGGEQDIKSVFPVDYSSCSSSGCMLRFYWLALQGIDGEV  28798

Query  186    SWQVFKN-CIN  195
               WQV+   CI+
Sbjct  28797  VWQVYSE*CIH  28765

 Score = 34.7 bits (78),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (52%), Gaps = 7/54 (13%)
 Frame = -3

Query  74     QTWLAERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS  126
              +T  AER    LR+ MDDD  LY        +CG T P+ + + IPT+ +   S
Sbjct  29209  KTLAAERNVTNLRSFMDDDTSLYGA------ECGYTDPDVDAKDIPTDNTATLS  29066

 Score = 42.4 bits (98),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (55%), Gaps = 8/71 (11%)
 Frame = -1

Query  130    LDGPCEIWIDNTLALAGRNCHTEFP------EGHHTIDYSVCGES-CR-VSWFWLGIKYQ  181
              L GPCEIW+D+T+ L   +C+T +       +    +DYSVC  + C+ + ++WL  +  
Sbjct  27213  LQGPCEIWLDDTMVLHDDDCYTTYGGEDQDIKSVFPVDYSVCETTGCKEMRFYWLAFQGL  27034

Query  182    GERYSWQVFKN  192
                +  WQV+  
Sbjct  27033  SGKTVWQVYSK  27001

 Score = 35.4 bits (80),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 21/35 (60%), Gaps = 6/35 (17%)
 Frame = -2

Query  87     ALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG  121
              +L+DD  +Y        DCG T P+ E QPIPT+G
Sbjct  27416  SLLDDTSIYGA------DCGFTDPDGEAQPIPTDG  27330

 Score = 43.5 bits (101),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 40/81 (49%), Gaps = 8/81 (10%)
 Frame = -2

Query  126    SGYTLDGPCEIWIDNTLALAGRNCHTEF------PEGHHTIDYSVCGES--CRVSWFWLG  177
              S   L GPCEIW+D+T+ L   +C++ +       +    +DYS C  S    + ++WL 
Sbjct  22133  STIALQGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLA  21954

Query  178    IKYQGERYSWQVFKNCINLSA  198
               +   +   WQV+     LSA
Sbjct  21953  FQGVDDETVWQVYSKFGFLSA  21891

 Score = 33.9 bits (76),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 6/44 (14%)
 Frame = -3

Query  79     ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGS  122
              E+G   +R+L+DD  +Y        DCG T P+   Q IPT+ +
Sbjct  22327  EKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDST  22214

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 67/159 (42%), Gaps = 40/159 (25%)
 Frame = -1

Query  64     QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF  123
              Q+ V T +  +    E G + +R+L+DD  +Y        DCG T P+   Q IPT+ + 
Sbjct  19998  QESVDTYVSLK---EENGLSNIRSLLDDTSIYGA------DCGYTNPDGTAQDIPTDSTA  19846

Query  124    ITS-----------------------GYTLDGPCEIWIDNTLALAGRNCHTEF------P  154
                S                            GPCEIW+D+T+ L+  +C++ +       
Sbjct  19845  TFSRGMVHVVSHSRCS*WSGWC*IGLAXXXXGPCEIWLDDTMVLSEDDCYSLYGGDDQDV  19666

Query  155    EGHHTIDYSVC--GESCRVSWFWLGIKYQGERYSWQVFK  191
              +    +DYS C  G    + ++WL  +   +   WQV+ 
Sbjct  19665  KSVFPVDYSSCDSGGCSEMRFYWLAFQGVDDETVWQVYS  19549

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 37/73 (51%), Gaps = 8/73 (11%)
 Frame = -1

Query  328    DGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC--NGSCTLYWYWLGVRYLK  379
               GPCE+WLDDT VL  D+C+    G+  D+      DYS C   G   + +YWL  + L 
Sbjct  27210  QGPCEIWLDDTMVLHDDDCYTTYGGEDQDIKSVFPVDYSVCETTGCKEMRFYWLAFQGLS  27031

Query  380    QVYSWQVYKACVP  392
                  WQVY    P
Sbjct  27030  GKTVWQVYSKLRP  26992

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 8/68 (12%)
 Frame = -2

Query  329    GPCEVWLDDTRVLQHDNCHEVISGKTYD------LDYSACN--GSCTLYWYWLGVRYLKQ  380
              GPCE+WLDDT VL  D+C+    G   D      +DYS+C+  G   + +YWL  + +  
Sbjct  22115  GPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDD  21936

Query  381    VYSWQVYK  388
                 WQVY 
Sbjct  21935  ETVWQVYS  21912

 Score = 43.1 bits (100),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 51/119 (43%), Gaps = 12/119 (10%)
 Frame = -3

Query  251    DNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDA  310
              D +W+   +  G +  + D +V   +  G   +R+ +DD S+Y  +      CG+TDPD 
Sbjct  22402  DPQWESDGW-NGNSQDSVDTYVSLAEEKGVTQIRSLLDDTSIYGAD------CGYTDPDG  22244

Query  311    APQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLY  369
                Q IP     ST     G   V      +L H    EVI+G+          GS TL+
Sbjct  22243  TAQDIP---TDSTATFSRGMVHVVSSKHSMLVH--MTEVITGQLLLFRVRVRFGSMTLW  22082

 Score = 35.4 bits (80),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 6/32 (19%)
 Frame = -2

Query  285    AFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
              + +DD S+Y  +      CGFTDPD   QPIP
Sbjct  27416  SLLDDTSIYGAD------CGFTDPDGEAQPIP  27339

>PHSO:scaffold_31
Length=53937

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 77/179 (43%), Gaps = 24/179 (13%)
 Frame = +3

Query  234    AHQLVILPAPTYTVEGKDNRWK---PLAFLE---GQNFSTTDD-------FVGYLDANGF  280
              AH  ++ PA T T  G    ++   P+  L    G  F+T  D       F   L A+ +
Sbjct  11283  AHGKLVKPALTLTGTGYGGNFQSTIPMTSLTPKPGDIFTTYPDYSKNTAAFDRALKASQY  11462

Query  281    DSLRAFM---DDDSLYSVNASADFRCGFTDP-DAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
               SL+ FM    D +    N      CGFTDP D A QP+PD +     G  HDGPCE+W 
Sbjct  11463  KSLKEFMYSTQDMTKGRFNLPKTAECGFTDPVDGAVQPLPDQVEWYGGGMIHDGPCEIWC  11642

Query  336    DDTRVLQHD-NCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              DD   +    NC        +  + + C G   L  YWLG      +  WQVY  C  I
Sbjct  11643  DDEVAMPFTPNCRAAYPDGKFPYEKAKCEGKKRLTMYWLGT-----LLEWQVYIDCAKI  11804

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 7/102 (7%)
 Frame = +3

Query  104    DCGLTFP-NTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTID  161
              +CG T P +   QP+P    +   G   DGPCEIW D+ +A+    NC   +P+G    +
Sbjct  11535  ECGFTDPVDGAVQPLPDQVEWYGGGMIHDGPCEIWCDDEVAMPFTPNCRAAYPDGKFPYE  11714

Query  162    YSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
               + C    R++ +WLG   +     WQV+ +C  +      T
Sbjct  11715  KAKCEGKKRLTMYWLGTLLE-----WQVYIDCAKIGEGGSAT  11825

>ALLA:FR824076 dna:supercontig supercontig:ENA1:FR824076:1:147313:1 
REF
Length=147313

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 65/139 (47%), Gaps = 24/139 (17%)
 Frame = +3

Query  260    LEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP---  316
               +G     T  F+    ++ F +LR F+ D   Y         CG T+P+A P+PIP   
Sbjct  47601  FDGAPIDNTATFLNAFASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADH  47753

Query  317    ----DGIMRSTGY--THDGPCEVWLDDTRVLQHDNCHEVI--SGKTYDLDYSACNGSCTL  368
                  +      G+  +H GPCEVWL++ RV   DNC E    S     +D+S C   C L
Sbjct  47754  AIVWENPDTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLL  47933

Query  369    YWYWLGVRYLKQVYSWQVY  387
               ++WL +   +    WQVY
Sbjct  47934  QFFWLALHEPQ----WQVY  47978

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 50/124 (40%), Gaps = 23/124 (19%)
 Frame = +3

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSGYTL  130
               A   +  LR  + D G Y         CG T PN + +PIP + + +        G+  
Sbjct  47646  FASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPDTKEGFVA  47798

Query  131    D--GPCEIWIDNTLALAGRNCHTEF--PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
                 GPCE+W++        NC   F        ID+S C   C + +FWL +        
Sbjct  47799  SHMGPCEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLAL----HEPQ  47966

Query  187    WQVF  190
              WQV+
Sbjct  47967  WQVY  47978

>PYAR:scaffold_1366 par_scaffold_1366 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1366:1:8801:1 
REF
Length=8801

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 61/131 (47%), Gaps = 14/131 (11%)
 Frame = -3

Query  264   NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDG--IMR  321
              F T   +     A G   LR F++D             CG +  DA P+ IP    I  
Sbjct  1629  TFKTGAQYAAKAKAEGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKISL  1477

Query  322   STGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQ  380
             ++   H GPCEVW DD      D+C +   S  ++ +D+S C+GSC L +YWLG++   +
Sbjct  1476  ASTIEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQDGGK  1297

Query  381   VYSWQVYKACV  391
                WQ Y   V
Sbjct  1296  --RWQSYSTIV  1270

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 17/133 (13%)
 Frame = -3

Query  64    QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF  123
             + G   A +A+      G   LR  ++D G           CG +  +   + IP +G  
Sbjct  1623  KTGAQYAAKAKA----EGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKI  1483

Query  124   -ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQ  181
              + S     GPCE+W D+ LA    +C   F       +D+S C  SC + ++WLG++  
Sbjct  1482  SLASTIEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQDG  1303

Query  182   GERYSWQVFKNCI  194
             G+R  WQ +   +
Sbjct  1302  GKR--WQSYSTIV  1270

>PYAR:scaffold_212 par_scaffold_212 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_212:1:25069:1 
REF
Length=25069

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 57/121 (47%), Gaps = 13/121 (11%)
 Frame = +2

Query  276    DANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRST-GYTHDGPCEVW  334
               A+ F SLR  ++  S       +   CG T P  APQP+PD +  S    +H GPCEVW
Sbjct  19994  KASSFTSLRDLIEKKS------PSTPACGITPPGGAPQPVPDHVEWSAFADSHVGPCEVW  20155

Query  335    LDDTRVLQHDNCHEVISGKTYDLDYSA--CNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
               D  RV Q DNC      +   L  +A  C  +  L +YWL +        WQ+Y  C P
Sbjct  20156  CDQKRVFQEDNCAGKYPARPAKLPINAADCANAKELKFYWLAL----HSQDWQIYINCAP  20323

Query  393    I  393
              +
Sbjct  20324  L  20326

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 66/145 (46%), Gaps = 18/145 (12%)
 Frame = +1

Query  257    LAFLEGQNFSTT-----DDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAA  311
              L    G +FS++     D F     A+G  SL+A ++        A +   CG T P  A
Sbjct  17902  LKVPAGGSFSSSPQVNVDSFTKAFKASGLSSLKALIEKA------APSTPACGITPPGGA  18063

Query  312    PQPIPDGIMRST-GYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTL  368
              PQ +PD +  S    +H GPCEVW D+TRV Q  NC      +   L  + + C+ +  +
Sbjct  18064  PQDVPDHVEWSAFADSHVGPCEVWCDNTRVFQEANCAGRYPSRPARLPINKAQCSNAKQM  18243

Query  369    YWYWLGVRYLKQVYSWQVYKACVPI  393
                 WL +        WQVY  C P+
Sbjct  18244  KIIWLAL----HSQDWQVYINCAPL  18306

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 12/118 (10%)
 Frame = +1

Query  81     GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDN  140
              G ++L+AL++     +        CG+T P    Q +P +  +     +  GPCE+W DN
Sbjct  17983  GLSSLKALIEKAAPSTPA------CGITPPGGAPQDVPDHVEWSAFADSHVGPCEVWCDN  18144

Query  141    TLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              T      NC   +P       I+ + C  + ++   WL +  Q     WQV+ NC  L
Sbjct  18145  TRVFQEANCAGRYPSRPARLPINKAQCSNAKQMKIIWLALHSQ----DWQVYINCAPL  18306

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 43/94 (46%), Gaps = 6/94 (6%)
 Frame = +2

Query  105    CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPE--GHHTIDY  162
              CG+T P    QP+P +  +     +  GPCE+W D        NC  ++P       I+ 
Sbjct  20057  CGITPPGGAPQPVPDHVEWSAFADSHVGPCEVWCDQKRVFQEDNCAGKYPARPAKLPINA  20236

Query  163    SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              + C  +  + ++WL +  Q     WQ++ NC  L
Sbjct  20237  ADCANAKELKFYWLALHSQ----DWQIYINCAPL  20326

>PHCA:scaffold_8 PHYCAscaffold_8
Length=1194346

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 66/131 (50%), Gaps = 18/131 (14%)
 Frame = -3

Query  271     FVGYLDANGFDSLRAFMD---DDSLYSVNASADFRC-GFTDPDAAPQPIPDGIMRSTGYT  326
               F  + +A G+ SLR  +D    D  +SV  +      G+T+         +G + S    
Sbjct  824222  FADHWNATGYKSLREMVDPIATDYGFSVKTATPVDVTGYTEMWWQNDEYKEGFIAS----  824055

Query  327     HDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQVY  382
               H+GPCE W+DDTR+  +DNC      KTY      DYS+C G C   +YWL +       
Sbjct  824054  HEGPCEGWIDDTRIFHYDNC--AAQFKTYPAKIPADYSSCKGDCLFSFYWLALHEP----  823893

Query  383     SWQVYKACVPI  393
               +WQ+YK CVPI
Sbjct  823892  NWQIYKQCVPI  823860

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 65/131 (50%), Gaps = 18/131 (14%)
 Frame = -1

Query  271     FVGYLDANGFDSLRAFMDD---DSLYSVNASADFR-CGFTDPDAAPQPIPDGIMRSTGYT  326
               F  + +A G+ SLR  +D    D  +S+  +      G+T+         +G + S    
Sbjct  820519  FTDHWNATGYKSLREMLDPIAPDYGHSLKTATPVDVSGYTEMWWQNDEYKEGFIAS----  820352

Query  327     HDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQVY  382
               H+GPCE W+DDTR+  +DNC      KTY      DYS+C G C   +YWL +       
Sbjct  820351  HEGPCEAWIDDTRIFHYDNCAAQF--KTYPAKVPADYSSCKGDCLFVFYWLALHEPD---  820187

Query  383     SWQVYKACVPI  393
                WQ+YK CVPI
Sbjct  820186  -WQIYKQCVPI  820157

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = -1

Query  326     THDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYS  383
               +H GPCE W+DDTRV   D+C    +G   ++  D+S+C+G CT  +YWL +       +
Sbjct  815128  SHRGPCEGWIDDTRVFHSDDCRGDYTGYPAEIPVDFSSCSGDCTFTFYWLALHEP----N  814961

Query  384     WQVYKACVPI  393
               WQVYK C  I
Sbjct  814960  WQVYKQCAAI  814931

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 37/74 (50%), Gaps = 6/74 (8%)
 Frame = -3

Query  320     MRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRY  377
                R T +   GPCE W+D+T+V  +D+C          +  DYS+C G C   +YWL +  
Sbjct  817235  FRLTRFHTQGPCETWIDNTKVFHYDDCSGDFRSYPAKIPTDYSSCKGECKFVFYWLAL--  817062

Query  378     LKQVYSWQVYKACV  391
                    +WQVY   +
Sbjct  817061  --HSPTWQVYSTLI  817026

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 60/127 (47%), Gaps = 24/127 (19%)
 Frame = -1

Query  82      YATLRALMD----DDGLYSVTEEGLFDCG----LTFPNTETQPIPTNGSFITSGYTLDGP  133
               + TL+A+MD    D G  S+T +   D      +T+ N + Q       FI S     GP
Sbjct  815269  FKTLKAMMDTAAPDCGKTSLTGKAPVDVSSLKSMTWQNDQEQ-----KGFIDSHR---GP  815114

Query  134     CEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               CE WID+T      +C   +T +P     +D+S C   C  +++WL +       +WQV+
Sbjct  815113  CEGWIDDTRVFHSDDCRGDYTGYP-AEIPVDFSSCSGDCTFTFYWLAL----HEPNWQVY  814949

Query  191     KNCINLS  197
               K C  ++
Sbjct  814948  KQCAAIT  814928

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 36/69 (52%), Gaps = 6/69 (9%)
 Frame = -3

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               +GPCE WID+T      NC  +F      I  DYS C   C  S++WL +       +WQ
Sbjct  824051  EGPCEGWIDDTRIFHYDNCAAQFKTYPAKIPADYSSCKGDCLFSFYWLAL----HEPNWQ  823884

Query  189     VFKNCINLS  197
               ++K C+ ++
Sbjct  823883  IYKQCVPIT  823857

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 44/97 (45%), Gaps = 11/97 (11%)
 Frame = -3

Query  116     PIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSW  173
               P+ T  +F  + +   GPCE WIDNT      +C  +F      I  DYS C   C+  +
Sbjct  817256  PLETTCTFRLTRFHTQGPCETWIDNTKVFHYDDCSGDFRSYPAKIPTDYSSCKGECKFVF  817077

Query  174     FWLGIKYQGERYSWQVFK-----NCINLSASALVTMI  205
               +WL +       +WQV+      NC NL  S    MI
Sbjct  817076  YWLALHSP----TWQVYSTLIVYNCANLLFSGGNFMI  816978

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (49%), Gaps = 6/74 (8%)
 Frame = +3

Query  320     MRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRY  377
                R T +   GPCE W+D+T+V  +D+C          +  DYS+C G     +YWL +  
Sbjct  850311  FRLTRFHTQGPCEAWIDNTKVFHYDDCSGDFRSYPAKIPTDYSSCKGERKFVFYWLAL--  850484

Query  378     LKQVYSWQVYKACV  391
                    +WQVY   +
Sbjct  850485  --HSPTWQVYSTLI  850520

 Score = 46.6 bits (109),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 36/77 (47%), Gaps = 7/77 (9%)
 Frame = -3

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVC-GESCRVSWFWLGIKYQGERYSWQ  188
               GPCE WIDN +     +C  EFP     I  DYS C G+ C   ++WL +        WQ
Sbjct  818906  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLALHSP----EWQ  818739

Query  189     VFKNCINLSASALVTMI  205
               ++  C       L+ +I
Sbjct  818738  IYSTCNRREFEVLLRLI  818688

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 34/69 (49%), Gaps = 6/69 (9%)
 Frame = -1

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               +GPCE WID+T      NC  +F      +  DYS C   C   ++WL +        WQ
Sbjct  820348  EGPCEAWIDDTRIFHYDNCAAQFKTYPAKVPADYSSCKGDCLFVFYWLAL----HEPDWQ  820181

Query  189     VFKNCINLS  197
               ++K C+ ++
Sbjct  820180  IYKQCVPIT  820154

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/149 (26%), Positives = 58/149 (39%), Gaps = 32/149 (21%)
 Frame = +3

Query  266     STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPI--PDGIMRST  323
               S  D F       GF SLR F+DD   +S    +  +      +A  Q I   D      
Sbjct  821403  SNVDTFTQAFPLTGFASLREFIDDVCSFSTACGS--KSSSVSVEAGSQKIYWDDSAAVDG  821576

Query  324     GYTHD----------------------GPCEVWLDDTRVLQHDNCHEVI--SGKTYDLDY  359
               G+ H                       GPCE+WLD+  V++ +NC      +     +DY
Sbjct  821577  GFEHVRYYLSPQLELALFL**FFRKF*GPCELWLDEVVVVKSNNCAVAFPTNPAICAVDY  821756

Query  360     SACNGSCTLYWYWLGVRYLKQVYSWQVYK  388
               S+C+  C L +Y L +  ++    WQ + 
Sbjct  821757  SSCSECCVLRFYALALTGVE----WQAFS  821831

 Score = 43.9 bits (102),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 34/64 (53%), Gaps = 6/64 (9%)
 Frame = +3

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHH--TIDYSVCGESCRVSWFWL---GIKYQG-ERY  185
               GPCE+W+D  + +   NC   FP       +DYS C E C + ++ L   G+++Q     
Sbjct  821658  GPCELWLDEVVVVKSNNCAVAFPTNPAICAVDYSSCSECCVLRFYALALTGVEWQAFSTL  821837

Query  186     SWQV  189
               +WQ+
Sbjct  821838  NWQL  821849

 Score = 43.1 bits (100),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 31/65 (48%), Gaps = 7/65 (11%)
 Frame = -3

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNG-SCTLYWYWLGVRYLKQVYSWQ  385
               GPCE W+D+  V  +D+C          +  DYS+C G  C   +YWL +        WQ
Sbjct  818906  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLAL----HSPEWQ  818739

Query  386     VYKAC  390
               +Y  C
Sbjct  818738  IYSTC  818724

 Score = 41.6 bits (96),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 41/94 (44%), Gaps = 11/94 (12%)
 Frame = +3

Query  119     TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWL  176
               T  +F  + +   GPCE WIDNT      +C  +F      I  DYS C    +  ++WL
Sbjct  850299  TTCTFRLTRFHTQGPCEAWIDNTKVFHYDDCSGDFRSYPAKIPTDYSSCKGERKFVFYWL  850478

Query  177     GIKYQGERYSWQVFK-----NCINLSASALVTMI  205
                +       +WQV+      NC NL  S    MI
Sbjct  850479  AL----HSPTWQVYSTLIVYNCANLLFSGDNFMI  850568

 Score = 37.0 bits (84),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
 Frame = +3

Query  321     RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNG  364
               R T +   GPCE W+D+T+V  +D+C          +  DYS+C G
Sbjct  831372  RLTRFHTQGPCETWIDNTKVFHYDDCSGDFRSYPAKIPTDYSSCKG  831509

>PHRA:scaffold_105
Length=157074

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = -2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
               AHQ+V+LP P +T + +D ++ PLAFLE + F+T +DF  + D NG+ SLR FM D++ Y
Sbjct  154871  AHQVVLLPEPQWTTDDRDTKYNPLAFLESEGFTTQEDFASWRDENGYKSLRDFM-DNAKY  154695

Query  294     SVNASADF  301
               SV   ADF
Sbjct  154694  SVTNGADF  154671

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 1/66 (2%)
 Frame = -2

Query  38      QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
               QVVL P P +  D  D + +P+A+LE +G  T  +  +W  E GY +LR  M D+  YSV
Sbjct  154865  QVVLLPEPQWTTDDRDTKYNPLAFLESEGFTTQEDFASWRDENGYKSLRDFM-DNAKYSV  154689

Query  98      TEEGLF  103
               T    F
Sbjct  154688  TNGADF  154671

>PHCA:scaffold_40 PHYCAscaffold_40
Length=570383

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 67/136 (49%), Gaps = 19/136 (14%)
 Frame = +2

Query  262     GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM  320
               G  +   DD   +   N  DS++ ++      +  AS    CG T  +  PQP+P DG +
Sbjct  164132  GDYYQAVDD---WFTKNNVDSVKDYV------TKYASDIPECGNTKKNGTPQPLPTDGFV  164284

Query  321     R--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK---TYDLDYSACNGSCTLYWYWLGV  375
               +  S G +H GPCE+W DDTRV  + NC    +G+   +  +D   C  S  L +YWL +
Sbjct  164285  KHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSLPIDLDTCKSSSELVFYWLAL  164464

Query  376     RYLKQVYSWQVYKACV  391
                    V  WQVY  CV
Sbjct  164465  ----HVQPWQVYINCV  164500

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = +2

Query  302     RCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK---TY  355
                CG T  +  PQP+P DG ++  S G +H GPCE+W DDTRV  + NC    +G+   + 
Sbjct  112637  ECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSL  112816

Query  356     DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                +D   C  S  L +YWL +    Q   WQVY  CV +
Sbjct  112817  PIDLDTCKSSSELVFYWLSL----QGAPWQVYINCVKL  112918

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 72/175 (41%), Gaps = 29/175 (17%)
 Frame = +2

Query  235     HQLVILPAPTYTVEGKDNRWKPLAFLE----------GQNFSTTDDFVGYLDANGFDSLR  284
               H  +I+P P    E       P   ++          G  +   DD   +   N   SL+
Sbjct  108584  HGNIIVPKPQGNAENPYYIGGPAGTIDMPEIIGSASYGDYYQAVDD---WFTKNNVASLK  108754

Query  285     AFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRVL  341
                ++   + Y    S    CG T+     Q +P DG  +  + G +H GPCE+W DDTRV 
Sbjct  108755  EYI---TTYGTGIS---ECGNTEKKGTAQSVPSDGYAQHDTLGNSHPGPCEIWCDDTRVF  108916

Query  342     QHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                  NC    SG++     +D S C  S    +YWL +        WQVY  CV +
Sbjct  108917  HDTNCVTTFSGQSPAKIPIDVSTCKSSSEFVFYWLALH----AQPWQVYINCVAL  109069

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 52/103 (50%), Gaps = 11/103 (11%)
 Frame = +2

Query  104     DCGLTFPNTETQPIPTNGSFI---TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT-  159
               +CG T  N   QP+PT+G F+   + G +  GPCEIW D+T      NC  E+     T 
Sbjct  164225  ECGNTKKNGTPQPLPTDG-FVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTS  164401

Query  160     --IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                 ID   C  S  + ++WL +  Q     WQV+ NC+ L  SA
Sbjct  164402  LPIDLDTCKSSSELVFYWLALHVQ----PWQVYINCVTLDGSA  164518

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 73/186 (39%), Gaps = 23/186 (12%)
 Frame = +2

Query  23      LCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIE-------AQT  75
               + F    +    G G +++ P P    +   Y G P   ++   +  +            
Sbjct  108545  IVFNAAAISQTAGHGNIIV-PKPQGNAENPYYIGGPAGTIDMPEIIGSASYGDYYQAVDD  108721

Query  76      WLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYTLDGP  133
               W  +   A+L+  +   G       G+ +CG T      Q +P++G     T G +  GP
Sbjct  108722  WFTKNNVASLKEYITTYGT------GISECGNTEKKGTAQSVPSDGYAQHDTLGNSHPGP  108883

Query  134     CEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
               CEIW D+T      NC T F         ID S C  S    ++WL +  Q     WQV+
Sbjct  108884  CEIWCDDTRVFHDTNCVTTFSGQSPAKIPIDVSTCKSSSEFVFYWLALHAQ----PWQVY  109051

Query  191     KNCINL  196
                NC+ L
Sbjct  109052  INCVAL  109069

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 53/103 (51%), Gaps = 11/103 (11%)
 Frame = +2

Query  104     DCGLTFPNTETQPIPTNGSFI---TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT-  159
               +CG T  N   QP+PT+G F+   + G +  GPCEIW D+T      NC  E+     T 
Sbjct  112637  ECGNTKKNGTPQPLPTDG-FVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTS  112813

Query  160     --IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                 ID   C  S  + ++WL +  QG    WQV+ NC+ L  SA
Sbjct  112814  LPIDLDTCKSSSELVFYWLSL--QGA--PWQVYINCVKLDGSA  112930

 Score = 29.3 bits (64),  Expect(2) = 0.34, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 19/41 (46%), Gaps = 4/41 (10%)
 Frame = +3

Query  160     IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               ID S C  S    ++W  +  Q     WQV  NC+ L  SA
Sbjct  110625  IDVSTCKSSSEFVFYWQALHVQ----PWQVHVNCVALDGSA  110735

 Score = 28.1 bits (61),  Expect(2) = 0.34, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 17/30 (57%), Gaps = 4/30 (13%)
 Frame = +1

Query  124     ITSGYTL----DGPCEIWIDNTLALAGRNC  149
               + S YTL     GPCEIW DNT   +  +C
Sbjct  110497  LRSTYTLGNPHPGPCEIWCDNTRVYSDADC  110586

 Score = 36.6 bits (83),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 3/38 (8%)
 Frame = +1

Query  320     MRST---GYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
               +RST   G  H GPCE+W D+TRV    +C + + G +
Sbjct  110497  LRSTYTLGNPHPGPCEIWCDNTRVYSDADCAKTLKGAS  110610

>PLHA:NW_020188258.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1343, whole genome shotgun sequence
Length=1546205

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (49%), Gaps = 13/131 (10%)
 Frame = -2

Query  271      FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRS----TGYT  326
                F     A+ + S++  ++D ++ SV   A   CG  +PDA PQP+P+ +  S     G+T
Sbjct  1356595  FTTAFKASNYKSIKELIEDKAVISVTG-ASLTCGNANPDAPPQPLPEQVEWSHSAEEGFT  1356419

Query  327      --HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
                  H GPCEVW D+ +    +NC    +     L Y  + C+G+  L  YW+ +       
Sbjct  1356418  PSHQGPCEVWCDNKQAFHDENCAAHFTTAPAQLSYEKTMCSGASKLTLYWIAMHGPI---  1356248

Query  383      SWQVYKACVPI  393
                 WQVY  C  I
Sbjct  1356247  -WQVYINCANI  1356218

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (47%), Gaps = 12/130 (9%)
 Frame = -2

Query  75       TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTLD  131
                T      Y +++ L++D  + SVT   L  CG   P+   QP+P    +  S   G+T  
Sbjct  1356589  TAFKASNYKSIKELIEDKAVISVTGASLT-CGNANPDAPPQPLPEQVEWSHSAEEGFTPS  1356413

Query  132      --GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSW  187
                  GPCE+W DN  A    NC   F      + Y  ++C  + +++ +W+ +        W
Sbjct  1356412  HQGPCEVWCDNKQAFHDENCAAHFTTAPAQLSYEKTMCSGASKLTLYWIAM----HGPIW  1356245

Query  188      QVFKNCINLS  197
                QV+ NC N+S
Sbjct  1356244  QVYINCANIS  1356215

>PYIR:scaffold_1744 pir_scaffold_1744 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1744:1:5237:1 
REF
Length=5237

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 72/153 (47%), Gaps = 20/153 (13%)
 Frame = +1

Query  255   KPLAFLEGQNFST-----TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPD  309
             K L    GQ+F+T        F   L ++ + S+R  ++  + +   AS +  CG +   
Sbjct  1582  KTLTAPAGQSFTTDPSSNAKAFTAALKSSSYKSVRDLVNAKASFISGASKE--CGISSSS  1755

Query  310   AAPQPIPDGIMR-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--S  360
              A QP+P   +      S G+T  H+GPCEVW D+     +DNC +        L Y  S
Sbjct  1756  GAKQPLPAQYVEWAHSSSEGFTPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKS  1935

Query  361   ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              C+G+  L +YW+ +       +WQVY  C P+
Sbjct  1936  KCSGASMLRFYWVAL----HSSTWQVYINCAPL  2022

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (46%), Gaps = 14/129 (11%)
 Frame = +1

Query  77    LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--  130
             L    Y ++R L++     S       +CG++  +   QP+P          + G+T   
Sbjct  1657  LKSSSYKSVRDLVNAKA--SFISGASKECGISSSSGAKQPLPAQYVEWAHSSSEGFTPSH  1830

Query  131   DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQ  188
             +GPCE+W DN LA +  NC   +P     + Y  S C  +  + ++W+ +       +WQ
Sbjct  1831  EGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVAL----HSSTWQ  1998

Query  189   VFKNCINLS  197
             V+ NC  LS
Sbjct  1999  VYINCAPLS  2025

 Score = 41.6 bits (96),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 30/67 (45%), Gaps = 6/67 (9%)
 Frame = -2

Query  329   GPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQV  386
             GPCEVW DD      +NC     G    L Y  S C G+  L   WL +     V + QV
Sbjct  3151  GPCEVWCDDVLAFSDENCATNYPGNPAKLPYDESKCIGASMLTSIWLAL----HVPT*QV  2984

Query  387   YKACVPI  393
             Y  C P+
Sbjct  2983  YLNCAPL  2963

 Score = 24.6 bits (52),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (47%), Gaps = 12/81 (15%)
 Frame = -3

Query  242   APTYTVEGKDNRWKPLAFLEGQNFST--TDDFVGYLDA----NGFDSLRAFMDDDSLYSV  295
             +P+ T++G +     L    G +FST  T +   Y  A      +DSLR  +   +  ++
Sbjct  3390  SPSGTIDGPNA----LTVPTGMSFSTDSTSNTKAYTTAFKAQAKYDSLRDLVF--ATQTL  3229

Query  296   NASADFRCGFTDPDAAPQPIP  316
              + A   CGF+  +   QP+P
Sbjct  3228  ESGASQECGFSLTNGTAQPLP  3166

 Score = 40.8 bits (94),  Expect(2) = 0.039, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 33/67 (49%), Gaps = 6/67 (9%)
 Frame = -2

Query  132   GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQV  189
             GPCE+W D+ LA +  NC T +P     + Y  S C  +  ++  WL +       + QV
Sbjct  3151  GPCEVWCDDVLAFSDENCATNYPGNPAKLPYDESKCIGASMLTSIWLALHVP----T*QV  2984

Query  190   FKNCINL  196
             + NC  L
Sbjct  2983  YLNCAPL  2963

 Score = 20.0 bits (40),  Expect(2) = 0.039, Method: Compositional matrix adjust.
 Identities = 16/76 (21%), Positives = 31/76 (41%), Gaps = 4/76 (5%)
 Frame = -3

Query  45    PFFVVDGMDYRGSP--VAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGL  102
             P   +DG +    P  +++      +T      + A+  Y +LR L+      ++     
Sbjct  3387  PSGTIDGPNALTVPTGMSFSTDSTSNTKAYTTAFKAQAKYDSLRDLVF--ATQTLESGAS  3214

Query  103   FDCGLTFPNTETQPIP  118
              +CG +  N   QP+P
Sbjct  3213  QECGFSLTNGTAQPLP  3166

 Score = 38.1 bits (87),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 31/67 (46%), Gaps = 6/67 (9%)
 Frame = -1

Query  132   GPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSV--CGESCRVSWFWLGIKYQGERYSWQV  189
             GPCE+  DN LA +  NC   +PE    + Y +  C     +   W+ +        WQV
Sbjct  4739  GPCEV*CDNVLAFSDENCVINYPEAPARLPYDMAKCTGVKILKSVWMVLHLPA----WQV  4572

Query  190   FKNCINL  196
             +  C++L
Sbjct  4571  YLYCVSL  4551

 Score = 34.7 bits (78),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (46%), Gaps = 10/70 (14%)
 Frame = -1

Query  326   THDGPCEVWLDDTRVLQHDNC----HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
             +H GPCEV  D+      +NC     E  +   YD+  + C G   L   W+ +     +
Sbjct  4748  SHQGPCEV*CDNVLAFSDENCVINYPEAPARLPYDM--AKCTGVKILKSVWMVL----HL  4587

Query  382   YSWQVYKACV  391
              +WQVY  CV
Sbjct  4586  PAWQVYLYCV  4557

>PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 
genomic scaffold, whole genome shotgun sequence
Length=5928454

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 10/72 (14%)
 Frame = -3

Query  326      THDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQV  381
                +H+GPCE W+D+TRV  HDNC      K+Y      DYS+C G C   +YWL +      
Sbjct  5326208  SHEGPCEAWIDETRVFHHDNCAAQF--KSYPAKVPTDYSSCKGDCLFVFYWLALHEP---  5326044

Query  382      YSWQVYKACVPI  393
                 +WQ+YK CVPI
Sbjct  5326043  -NWQIYKQCVPI  5326011

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 67/139 (48%), Gaps = 14/139 (10%)
 Frame = -3

Query  261      EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL---YSVNASADFRC-GFTDPDAAPQPIP  316
                +G     T  F  + +A G+ SLR  +D  +    YSV  +      G+T+         
Sbjct  5331938  DGSPSQNTQVFTDHWNATGYKSLRDMVDPIAPGYGYSVETATPVDVTGYTEMWWQNDEYK  5331759

Query  317      DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLG  374
                +G + S    H+GPCE W+ +T++  H++C          +  DYS+C G C L +YWL 
Sbjct  5331758  EGFIAS----HEGPCEAWIGETQIFHHNDCAAQFKSYPAKIPADYSSCKGDCLLVFYWLA  5331591

Query  375      VRYLKQVYSWQVYKACVPI  393
                +       +WQ+YK CVPI
Sbjct  5331590  LHEP----NWQIYKQCVPI  5331546

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = -1

Query  326      THDGPCEVWLDDTRVLQHDNCHEVISGKTYD--LDYSACNGSCTLYWYWLGVRYLKQVYS  383
                +H GPCE W+DD RV   D+C    +    +  +D+S+C+G CT  +YWL +       +
Sbjct  5289256  SHHGPCEAWIDDKRVFHSDDCRADFTTYPAEIPIDFSSCSGDCTFTFYWLALHEP----N  5289089

Query  384      WQVYKACVPI  393
                WQVYK C PI
Sbjct  5289088  WQVYKQCAPI  5289059

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (46%), Gaps = 21/125 (17%)
 Frame = -1

Query  82       YATLRALMD----DDGLYSVTEEGLFDCGL---TFPNTETQPIPTNGSFITSGYTLDGPC  134
                + TL+ALMD    D G  S+T   +    L   T+ N + Q       FI S +   GPC
Sbjct  5289394  FKTLKALMDTVASDCGKTSLTGSPVDVSSLSSMTWQNDQEQ-----KGFIDSHH---GPC  5289239

Query  135      EIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
                E WID+       +C  +F        ID+S C   C  +++WL +       +WQV+K 
Sbjct  5289238  EAWIDDKRVFHSDDCRADFTTYPAEIPIDFSSCSGDCTFTFYWLAL----HEPNWQVYKQ  5289071

Query  193      CINLS  197
                C  ++
Sbjct  5289070  CAPIT  5289056

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 33/69 (48%), Gaps = 6/69 (9%)
 Frame = -3

Query  131      DGPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                +GPCE WID T      NC  +F         DYS C   C   ++WL +       +WQ
Sbjct  5326202  EGPCEAWIDETRVFHHDNCAAQFKSYPAKVPTDYSSCKGDCLFVFYWLAL----HEPNWQ  5326035

Query  189      VFKNCINLS  197
                ++K C+ ++
Sbjct  5326034  IYKQCVPIT  5326008

 Score = 46.6 bits (109),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 33/70 (47%), Gaps = 6/70 (9%)
 Frame = +2

Query  124      ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQ  181
                ITS  +L GPCE+WID  +     NC   FP    T  +DY  C + C + ++ + +   
Sbjct  5329061  ITSFVSLQGPCELWIDEAVVFQANNCAVAFPTSPATCPVDYLSCYDKCVLRFYAMALT--  5329234

Query  182      GERYSWQVFK  191
                     WQ F 
Sbjct  5329235  --GVYWQAFS  5329258

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 6/69 (9%)
 Frame = -3

Query  131      DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                +GPCE WI  T      +C  +F      I  DYS C   C + ++WL +       +WQ
Sbjct  5331737  EGPCEAWIGETQIFHHNDCAAQFKSYPAKIPADYSSCKGDCLLVFYWLAL----HEPNWQ  5331570

Query  189      VFKNCINLS  197
                ++K C+ ++
Sbjct  5331569  IYKQCVPIT  5331543

 Score = 41.6 bits (96),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 31/64 (48%), Gaps = 7/64 (11%)
 Frame = -2

Query  132      GPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVC-GESCRVSWFWLGIKYQGERYSWQ  188
                GPCE WIDN +     +C  EFP     I  DYS C G+ C   ++WL +        WQ
Sbjct  5323509  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSFCKGDKCLFVFYWLAL----HTPQWQ  5323342

Query  189      VFKN  192
                ++  
Sbjct  5323341  IYSK  5323330

 Score = 40.0 bits (92),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (52%), Gaps = 6/62 (10%)
 Frame = +2

Query  329      GPCEVWLDDTRVLQHDNCHEVI--SGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
                GPCE+W+D+  V Q +NC      S  T  +DY +C   C L +Y +    L  VY WQ 
Sbjct  5329085  GPCELWIDEAVVFQANNCAVAFPTSPATCPVDYLSCYDKCVLRFYAMA---LTGVY-WQA  5329252

Query  387      YK  388
                + 
Sbjct  5329253  FS  5329258

 Score = 37.7 bits (86),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 29/62 (47%), Gaps = 7/62 (11%)
 Frame = -2

Query  329      GPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNG-SCTLYWYWLGVRYLKQVYSWQ  385
                GPCE W+D+  V  +D+C          +  DYS C G  C   +YWL +        WQ
Sbjct  5323509  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSFCKGDKCLFVFYWLAL----HTPQWQ  5323342

Query  386      VY  387
                +Y
Sbjct  5323341  IY  5323336

>PHSO:scaffold_3
Length=10773376

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 18/131 (14%)
 Frame = -1

Query  271      FVGYLDANGFDSLRAFMDD---DSLYSVNASADFRC-GFTDPDAAPQPIPDGIMRSTGYT  326
                F  + +A G+ SLR  +D    D  +S+  +      G+T+         +G + S    
Sbjct  6433741  FNDHWNATGYKSLREMLDPIAPDYGHSLKTATPVDVTGYTEMWWQNDEYKEGFINS----  6433574

Query  327      HDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQVY  382
                H GPCE W+DD ++  HDNC      K+Y      DYS+C G C L +YWL +       
Sbjct  6433573  HSGPCEAWIDDVKIFHHDNC--AAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEP----  6433412

Query  383      SWQVYKACVPI  393
                +WQ+YK CVPI
Sbjct  6433411  NWQIYKQCVPI  6433379

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 60/134 (45%), Gaps = 24/134 (18%)
 Frame = -1

Query  271      FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPD-------GIMRST  323
                F      + F +LRA MD         +A   CG T    +P  +               
Sbjct  6425881  FTKSFPNSQFKTLRAMMD---------TAASDCGNTALTGSPVDVSSLSSMKWQNDQEQM  6425729

Query  324      GY--THDGPCEVWLDDTRVLQHDNCHEVISGKTYD--LDYSACNGSCTLYWYWLGVRYLK  379
                G+  +H GPCE W+DDTRV   D+C    +    +  +DYSAC+G CT  +YWL +    
Sbjct  6425728  GFIDSHHGPCEAWIDDTRVFHSDDCRAAYTSYPAEIPIDYSACSGDCTFTFYWLALHEPN  6425549

Query  380      QVYSWQVYKACVPI  393
                    WQVYK C PI
Sbjct  6425548  ----WQVYKQCAPI  6425519

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 18/131 (14%)
 Frame = -2

Query  271      FVGYLDANGFDSLRAFMDD---DSLYSVNASADFRC-GFTDPDAAPQPIPDGIMRSTGYT  326
                F  + +A G+ SLR  +D    D  +S+  +      G+T+         +G + S    
Sbjct  6431346  FNDHWNATGYKSLREMLDPIAPDYGHSLKTATPVDVTGYTEMWWQNDEYKEGFINS----  6431179

Query  327      HDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQVY  382
                H GPCE W+DD ++  HDNC      K+Y      DYS+C G C L +YWL +       
Sbjct  6431178  HSGPCEAWIDDVKIFHHDNC--AAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEP----  6431017

Query  383      SWQVYKACVPI  393
                +WQ+YK CVPI
Sbjct  6431016  NWQIYKQCVPI  6430984

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 56/127 (44%), Gaps = 33/127 (26%)
 Frame = -1

Query  82       YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS----------GY--T  129
                + TLRA+MD             DCG    NT     P + S ++S          G+  +
Sbjct  6425854  FKTLRAMMD---------TAASDCG----NTALTGSPVDVSSLSSMKWQNDQEQMGFIDS  6425714

Query  130      LDGPCEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
                  GPCE WID+T      +C   +T +P     IDYS C   C  +++WL +       +
Sbjct  6425713  HHGPCEAWIDDTRVFHSDDCRAAYTSYP-AEIPIDYSACSGDCTFTFYWLAL----HEPN  6425549

Query  187      WQVFKNC  193
                WQV+K C
Sbjct  6425548  WQVYKQC  6425528

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 6/68 (9%)
 Frame = -2

Query  132      GPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQV  189
                GPCE WID+       NC  EF      +  DYS C   C + ++WL +       +WQ+
Sbjct  6431172  GPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLAL----HEPNWQI  6431005

Query  190      FKNCINLS  197
                +K C+ ++
Sbjct  6431004  YKQCVPIT  6430981

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 6/68 (9%)
 Frame = -1

Query  132      GPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQV  189
                GPCE WID+       NC  EF      +  DYS C   C + ++WL +       +WQ+
Sbjct  6433567  GPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLAL----HEPNWQI  6433400

Query  190      FKNCINLS  197
                +K C+ ++
Sbjct  6433399  YKQCVPIT  6433376

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 11/64 (17%)
 Frame = -2

Query  329      GPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNG-SCTLYWYWLGVRYLKQVYS  383
                GPCE W+DDT+V  +D+C  V    +Y     +DYSAC G  C   +YWL V   +    
Sbjct  6429465  GPCEGWIDDTKVFHYDDC--VAKFPSYPAKIPVDYSACKGDKCLFVFYWLAVHSPE----  6429304

Query  384      WQVY  387
                WQ+Y
Sbjct  6429303  WQIY  6429292

 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (56%), Gaps = 2/52 (4%)
 Frame = +2

Query  326      THDGPCEVWLDDTRVLQHDNCHEVI--SGKTYDLDYSACNGSCTLYWYWLGV  375
                   GPCE+WLD+  V Q +NC      S     +DYS+C+G C L +Y L +
Sbjct  6436019  VSKGPCELWLDEVVVFQSNNCAVAFPTSPAVCAVDYSSCSGFCVLRFYALAL  6436174

 Score = 40.8 bits (94),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 7/64 (11%)
 Frame = -2

Query  132      GPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVC-GESCRVSWFWLGIKYQGERYSWQ  188
                GPCE WID+T      +C  +FP       +DYS C G+ C   ++WL +        WQ
Sbjct  6429465  GPCEGWIDDTKVFHYDDCVAKFPSYPAKIPVDYSACKGDKCLFVFYWLAV----HSPEWQ  6429298

Query  189      VFKN  192
                ++  
Sbjct  6429297  IYST  6429286

 Score = 40.0 bits (92),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 21/79 (27%), Positives = 34/79 (43%), Gaps = 6/79 (8%)
 Frame = +2

Query  131      DGPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                 GPCE+W+D  +     NC   FP       +DYS C   C + ++ L +        W+
Sbjct  6436025  KGPCELWLDEVVVFQSNNCAVAFPTSPAVCAVDYSSCSGFCVLRFYALALT----GVQWR  6436192

Query  189      VFKNCINLSASALVTMIGL  207
                 F    ++   A VT + +
Sbjct  6436193  AFSTLTSVL*CAAVTTVRM  6436249

>PYIR:scaffold_573 pir_scaffold_573 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_573:1:20947:1 
REF
Length=20947

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 65/139 (47%), Gaps = 24/139 (17%)
 Frame = +1

Query  266   STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP---------  316
             + T  F       G+ SL+  +D     SV       CGFT  D AP  +          
Sbjct  5386  ANTKMFTSAFANTGYKSLKEMLD----LSVPG-----CGFTLTDGAPVDVSGLKSMKWQN  5538

Query  317   DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLG  374
             D   +    +H GPCEVW+D+T+++  D+C    +    ++  DYS C G C L +YWL 
Sbjct  5539  DQEQKGFIDSHHGPCEVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLA  5718

Query  375   VRYLKQVYSWQVYKACVPI  393
             +       +WQ+YK CVPI
Sbjct  5719  LHEP----NWQIYKQCVPI  5763

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 15/90 (17%)
 Frame = +1

Query  303    CGFTDPDAAPQPIPDGIMRSTGY-----------THDGPCEVWLDDTRVLQHDNCHEVIS  351
              CG+TDP+AAP  +    + S  Y           +H GPCE W+D+T+V  +D+C +   
Sbjct  15838  CGYTDPNAAPVDVSK--LSSMKYQNNEYKEGFLNSHHGPCEGWIDNTKVFHYDDCVKSFP  16011

Query  352    G--KTYDLDYSACNGSCTLYWYWLGVRYLK  379
              G   T  + +++C G+C L +YWL +   K
Sbjct  16012  GYPATIPMSFASCKGNCRLTFYWLALHSQK  16101

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 74/158 (47%), Gaps = 36/158 (23%)
 Frame = +2

Query  54    YRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTE  113
             + G P  +  +Q  +TA   + W    GY +L+ ++D           + DCGL+ P  +
Sbjct  7145  FAGRPFNWSPEQ--NTAQFTEAW-PNTGYKSLKEMLDT---------YVPDCGLSLP--D  7282

Query  114   TQPIPTNG-------------SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI  160
               P+  +G              FI S +   GPCE+W+ NT A    +C  +FP    TI
Sbjct  7283  VTPVDVSGMKEFKFQNNEYKEGFIASHH---GPCELWVGNTKAWHYDDCSAKFPGYPATI  7453

Query  161   --DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               D+SVC  +CRV+++WL +  Q     WQ++   I L
Sbjct  7454  PTDFSVCKGTCRVTFYWLALHSQ----KWQIYSASIIL  7555

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 10/63 (16%)
 Frame = +3

Query  329   GPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
             GPCE+W+D+TRVL +D+C  V + KTY     +DYS C G CTL +YWL +       +W
Sbjct  2799  GPCEIWIDNTRVLHNDDC--VATYKTYPAVLPVDYSKCKGKCTLTFYWLAL----HEPNW  2960

Query  385   QVY  387
             Q+Y
Sbjct  2961  QIY  2969

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 65/148 (44%), Gaps = 27/148 (18%)
 Frame = +2

Query  255   KPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQP  314
             +P  +   QN   T  F       G+ SL+  +D    Y  +      CG + PD  P  
Sbjct  7154  RPFNWSPEQN---TAQFTEAWPNTGYKSLKEMLD---TYVPD------CGLSLPDVTPVD  7297

Query  315   I---PDGIMRSTGY------THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACN  363
             +    +   ++  Y      +H GPCE+W+ +T+   +D+C     G   T   D+S C 
Sbjct  7298  VSGMKEFKFQNNEYKEGFIASHHGPCELWVGNTKAWHYDDCSAKFPGYPATIPTDFSVCK  7477

Query  364   GSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             G+C + +YWL +   K    WQ+Y A +
Sbjct  7478  GTCRVTFYWLALHSQK----WQIYSASI  7549

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 62/134 (46%), Gaps = 35/134 (26%)
 Frame = +1

Query  77    LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SF  123
              A  GY +L+ ++D           +  CG T   T+  P+  +G              F
Sbjct  5413  FANTGYKSLKEMLD---------LSVPGCGFTL--TDGAPVDVSGLKSMKWQNDQEQKGF  5559

Query  124   ITSGYTLDGPCEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKY  180
             I S +   GPCE+WIDNT  +   +C   +T +P     +DYS C   C+++++WL +  
Sbjct  5560  IDSHH---GPCEVWIDNTKIMHSDDCRADYTAYP-AEIPVDYSKCKGKCQLTFYWLAL--  5721

Query  181   QGERYSWQVFKNCI  194
                  +WQ++K C+
Sbjct  5722  --HEPNWQIYKQCV  5757

 Score = 43.5 bits (101),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 8/71 (11%)
 Frame = +3

Query  132   GPCEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
             GPCEIWIDNT  L   +C   +  +P     +DYS C   C ++++WL +       +WQ
Sbjct  2799  GPCEIWIDNTRVLHNDDCVATYKTYPAV-LPVDYSKCKGKCTLTFYWLAL----HEPNWQ  2963

Query  189   VFKNCINLSAS  199
             ++   + L  +
Sbjct  2964  IYSKSLFLHKA  2996

 Score = 43.1 bits (100),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 2/52 (4%)
 Frame = +1

Query  132    GPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQ  181
              GPCE WIDNT      +C   FP    TI   ++ C  +CR++++WL +  Q
Sbjct  15943  GPCEGWIDNTKVFHYDDCVKSFPGYPATIPMSFASCKGNCRLTFYWLALHSQ  16098

>PLHA:NW_020187410.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_490, whole genome shotgun sequence
Length=4199

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 60/126 (48%), Gaps = 17/126 (13%)
 Frame = +2

Query  278   NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWL  335
             N F  LR+  + + +Y         CG+TDP   P   P DG    S G  H G CE+W 
Sbjct  3314  NNFKDLRSLFEGNPIYGE------ECGYTDPKGPPADRPNDGAATFSRGILHAGTCEIWF  3475

Query  336   DDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQVY  387
             DD  VLQ+D+C       T         +DY  C    C L +YWL ++ + +   WQVY
Sbjct  3476  DDKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQRIDKTV-WQVY  3652

Query  388   KACVPI  393
             + C+P+
Sbjct  3653  RNCIPL  3670

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 62/127 (49%), Gaps = 16/127 (13%)
 Frame = +2

Query  79    ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIW  137
             +  +  LR+L + + +Y        +CG T P       P +G+   S G    G CEIW
Sbjct  3311  KNNFKDLRSLFEGNPIYGE------ECGYTDPKGPPADRPNDGAATFSRGILHAGTCEIW  3472

Query  138   IDNTLALAGRNCHTEFPEGHHT-------IDYSVCG-ESCRVSWFWLGIKYQGERYSWQV  189
              D+ + L   +C + + +G          +DY +C  E C + ++WL ++ + ++  WQV
Sbjct  3473  FDDKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQ-RIDKTVWQV  3649

Query  190   FKNCINL  196
             ++NCI L
Sbjct  3650  YRNCIPL  3670

>PYVX:scaffold_50 pve_scaffold_50 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_50:1:72629:1 
REF
Length=72629

 Score = 53.9 bits (128),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = +2

Query  329    GPCEVWLDDTRVLQHDNCHEVISGKTYD------LDYSACN-GSCT-LYWYWLGVRYLKQ  380
              GPCE+WLDDT VL  D+C+    G   D      +DYS+CN G C  + +YWL  + +  
Sbjct  42350  GPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDG  42529

Query  381    VYSWQVYKA  389
                 WQVY  
Sbjct  42530  DTVWQVYST  42556

 Score = 39.7 bits (91),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 27/56 (48%), Gaps = 6/56 (11%)
 Frame = +3

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
              +G N  + D +       G   +R+ +DD S+Y  +      CGFTDPD   Q IP
Sbjct  42084  DGNNQGSVDTYKSLAAEKGVTEIRSLLDDTSIYGQD------CGFTDPDGTAQDIP  42233

 Score = 37.4 bits (85),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 27/48 (56%), Gaps = 6/48 (13%)
 Frame = +3

Query  74     QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG  121
              ++  AE+G   +R+L+DD  +Y        DCG T P+   Q IPT+G
Sbjct  42117  KSLAAEKGVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTDG  42242

 Score = 37.4 bits (85),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 34/69 (49%), Gaps = 8/69 (12%)
 Frame = +2

Query  132    GPCEIWIDNTLALAGRNCHTEFP------EGHHTIDYSVC--GESCRVSWFWLGIKYQGE  183
              GPCEIW+D+T+ L   +C++ +       +    +DYS C  G    + ++WL  +    
Sbjct  42350  GPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDG  42529

Query  184    RYSWQVFKN  192
                 WQV+  
Sbjct  42530  DTVWQVYST  42556

>PYAP:scaffold_630 pag1_scaffold_630 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_630:1:18565:1 
REF
Length=18565

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 79/171 (46%), Gaps = 19/171 (11%)
 Frame = -2

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTT---------DDFVGYLDANGFDSLR  284
              AH  + +PAP +  +G  N   P+  + G +F+           D     ++  G+ +LR
Sbjct  15525  AHTNMAVPAPKFP-DGFYNGNSPMGRINGDSFAGAASIPSYQGADKLAKVMETEGYTTLR  15349

Query  285    AF-MDDDSLYSVNASADFR-CGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQ  342
                 M + +L +++     + CG T      QP+PD +    G  H GPCEVW D+ R+  
Sbjct  15348  QLIMKNVNLSTIDGHTGTKECGLTITTGPKQPLPDAVDFPWG--HPGPCEVWCDNNRIFF  15175

Query  343    HDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              + NC     GK   +D + C G   +   ++GV     V +W+VY  C PI
Sbjct  15174  NKNCQANNVGKV-PIDKTKCAGVNIIQAMYIGV----HVANWEVYANCAPI  15037

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 70/154 (45%), Gaps = 19/154 (12%)
 Frame = -1

Query  252    NRWKPLAFLEGQNFSTT----------DDFVGYLDANGFDSLRAF-MDDDSLYSVNA-SA  299
              N   P+  ++G +F ++          +     ++  G+ +LR   M +  L ++N  + 
Sbjct  17323  NGNSPMGRIDGDSFPSSAEVSKTSYGAEKLAKIMEKEGYTTLRQLIMKNVKLSAINGLTG  17144

Query  300    DFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY  359
                 CG T      QPIPD I    G  H GPCEVW D+ R+  + +C     GK   +D 
Sbjct  17143  KKECGLTITTGEKQPIPDEIDFPWG--HPGPCEVWCDNNRIFYNQDCQANNVGKV-KVDK  16973

Query  360    SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              + C G   +   ++GV     V +W+VY  C P+
Sbjct  16972  TKCAGVNIIQAMYIGV----HVANWEVYANCAPM  16883

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 78/161 (48%), Gaps = 20/161 (12%)
 Frame = -2

Query  234    AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY-------LDANGFDSLRAF  286
              AH  + +P PTY  +G      P+  ++G  F+   +  GY           G  SL++F
Sbjct  12516  AHSSMTVPKPTYD-QGFYQYMNPVMRIDGNKFA--KNIPGYKGIEKITAAMQGQSSLKSF  12346

Query  287    MDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNC  346
              +  +++     S +  CG+   +  PQP+PD +  +  + H GPCEVW D+T+V  + NC
Sbjct  12345  IMANAVLPGGGSKE--CGWGKVNGEPQPLPDAVEFT--WAHPGPCEVWCDNTKVFYNINC  12178

Query  347    HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                   GK   L+   CNG+  +   ++G      V +W+VY
Sbjct  12177  MGNNVGKV-PLN-GKCNGAKMVQAMYIGT----HVENWEVY  12073

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 79/175 (45%), Gaps = 26/175 (15%)
 Frame = -1

Query  234    AHQLVILPAPTYTVEGKDNRWKPL---AFLEGQNFSTTDDFVGY---------LDANGFD  281
              AH  + +P PT+     D  ++P+   A + G++F        Y         + + G  
Sbjct  13972  AHSYMSVPKPTF----PDQFYQPMSPFARINGESFPGAASVPSYKGPEKIAAAIKSTGAK  13805

Query  282    SLRAFMDDD---SLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDT  338
              +LR F+  +   ++  +       CG +  + A Q + D +  +  + H GPCE+W D+T
Sbjct  13804  TLRQFVMTNMNITMTDMVKQPTKECGMSQANGARQALTDTVEWT--WAHPGPCEIWCDNT  13631

Query  339    RVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              R+  + +C     G    +D S C G+  L   ++G      V +W+VY  CVP+
Sbjct  13630  RLFFNADCSGNNVGN-VKIDKSKCKGANFLQGMYVGT----HVPNWEVYVNCVPL  13481

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 52/119 (44%), Gaps = 10/119 (8%)
 Frame = -1

Query  77     LAERGYATLRALMDDDGLYSVTE--EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPC  134
              + + GY TLR L+  +   S      G  +CGLT    E QPIP    F    +   GPC
Sbjct  17224  MEKEGYTTLRQLIMKNVKLSAINGLTGKKECGLTITTGEKQPIPDEIDFP---WGHPGPC  17054

Query  135    EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
              E+W DN      ++C      G   +D + C     +   ++G+       +W+V+ NC
Sbjct  17053  EVWCDNNRIFYNQDCQANN-VGKVKVDKTKCAGVNIIQAMYIGVHVA----NWEVYANC  16892

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 52/119 (44%), Gaps = 10/119 (8%)
 Frame = -2

Query  77     LAERGYATLRAL-MDDDGLYSVT-EEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPC  134
              +   GY TLR L M +  L ++    G  +CGLT      QP+P    F    +   GPC
Sbjct  15378  METEGYTTLRQLIMKNVNLSTIDGHTGTKECGLTITTGPKQPLPDAVDFP---WGHPGPC  15208

Query  135    EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
              E+W DN      +NC      G   ID + C     +   ++G+       +W+V+ NC
Sbjct  15207  EVWCDNNRIFFNKNCQANN-VGKVPIDKTKCAGVNIIQAMYIGVHVA----NWEVYANC  15046

 Score = 42.4 bits (98),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 36/157 (23%), Positives = 68/157 (43%), Gaps = 19/157 (12%)
 Frame = -1

Query  45     PFFVVDGMDYRG--SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVT---E  99
              PF  ++G  + G  S  +Y   + +  AI++       G  TLR  +  +   ++T   +
Sbjct  13909  PFARINGESFPGAASVPSYKGPEKIAAAIKST------GAKTLRQFVMTNMNITMTDMVK  13748

Query  100    EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
              +   +CG++  N   Q +      +   +   GPCEIW DNT      +C      G++ 
Sbjct  13747  QPTKECGMSQANGARQAL---TDTVEWTWAHPGPCEIWCDNTRLFFNADC-----SGNNV  13592

Query  160    IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               +  +    C+ + F  G+       +W+V+ NC+ L
Sbjct  13591  GNVKIDKSKCKGANFLQGMYVGTHVPNWEVYVNCVPL  13481

 Score = 39.7 bits (91),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 44/108 (41%), Gaps = 13/108 (12%)
 Frame = -2

Query  42     YPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEG  101
              Y  P   +DG  +  +   Y   + +  A++ Q+ L  + +    A++   G        
Sbjct  12462  YMNPVMRIDGNKFAKNIPGYKGIEKITAAMQGQSSL--KSFIMANAVLPGGGSK------  12307

Query  102    LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
                +CG    N E QP+P    F    +   GPCE+W DNT      NC
Sbjct  12306  --ECGWGKVNGEPQPLPDAVEFT---WAHPGPCEVWCDNTKVFYNINC  12178

>PYAR:scaffold_4639 par_scaffold_4639 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4639:1:2087:1 
REF
Length=2087

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 8/89 (9%)
 Frame = +1

Query  309   DAAPQPIPDGIMRSTGY--THDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNG  364
             +  PQP+PD +    G+  +H+GPCEVW DDTRV   +NC +  +GK   L Y  S C G
Sbjct  1741  NGPPQPLPDAVEYGGGFDSSHEGPCEVWCDDTRVFYEENCSKKYTGKPAKLPYDKSKCAG  1920

Query  365   SCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             +  L  +W  +     V +WQ Y AC  I
Sbjct  1921  AKRLQSFWFAL----HVPAWQAYIACSTI  1995

 Score = 38.9 bits (89),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 13/92 (14%)
 Frame = +1

Query  111   NTETQPIPT----NGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SV  164
             N   QP+P      G F +S    +GPCE+W D+T      NC  ++      + Y  S 
Sbjct  1741  NGPPQPLPDAVEYGGGFDSS---HEGPCEVWCDDTRVFYEENCSKKYTGKPAKLPYDKSK  1911

Query  165   CGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             C  + R+  FW  +       +WQ +  C  +
Sbjct  1912  CAGAKRLQSFWFALHVP----AWQAYIACSTI  1995

>PYIR:scaffold_5821 pir_scaffold_5821 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_5821:1:515:1 
REF
Length=515

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 74/177 (42%), Gaps = 27/177 (15%)
 Frame = -1

Query  235  HQLVILPAPTYTVEGKDNRW-------KPLAFLEGQNFST-----TDDFVGYLDANGFDS  282
            H  + +P  T+ + G   ++         L    G +F+T     T  F   L A+ + S
Sbjct  515  HGYMSVPKTTFAINGDPTQFCATMNGPTTLTAPSGMSFTTDPASNTKAFTAALKASTYKS  336

Query  283  LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWL  335
            +RA +D    +   + A+ +CG T P    QP+P   +      + G+T  H GPCEVW 
Sbjct  335  VRALVDAKGQFI--SGANKQCGVTSPTGDKQPLPAQYVEWAHSSTEGFTPSHQGPCEVWC  162

Query  336  DDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
            DD      +NC          L Y  S C G+  L  YWL +       +WQ Y  C
Sbjct  161  DDKMAFSDENCATNYPTAPAKLPYDKSKCTGASMLKIYWLAL----HSSTWQAYINC  3

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 68/159 (43%), Gaps = 22/159 (14%)
 Frame = -1

Query  43   PPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGL  102
            P       GM +   P +    +    A++A T      Y ++RAL+D  G +       
Sbjct  437  PTTLTAPSGMSFTTDPAS--NTKAFTAALKAST------YKSVRALVDAKGQF--ISGAN  288

Query  103  FDCGLTFPNTETQPIPTN----GSFITSGYTLD--GPCEIWIDNTLALAGRNCHTEFPEG  156
              CG+T P  + QP+P          T G+T    GPCE+W D+ +A +  NC T +P  
Sbjct  287  KQCGVTSPTGDKQPLPAQYVEWAHSSTEGFTPSHQGPCEVWCDDKMAFSDENCATNYPTA  108

Query  157  HHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
               + Y  S C  +  +  +WL +       +WQ + NC
Sbjct  107  PAKLPYDKSKCTGASMLKIYWLAL----HSSTWQAYINC  3

>PYAP:scaffold_289 pag1_scaffold_289 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_289:1:35482:1 
REF
Length=35482

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (51%), Gaps = 8/108 (7%)
 Frame = +3

Query  92     DGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLALAGRNC  149
              D + ++ E     CG T  N   QPIPT+G  +F  S   + GPCE+W+DNT   + + C
Sbjct  14376  DLIKALAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHI-GPCEVWLDNTKVASAKEC  14552

Query  150    HTEFPEGHHTIDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                EFP     +D++ C   SC++ W W+          W+ F NC+ +
Sbjct  14553  WKEFPNKRIKVDFAKCKSGSCQLRWVWMATHTS----PWEFFDNCVRV  14684

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 19/120 (16%)
 Frame = -1

Query  81     GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF---ITSGYTLDGPCEIW  137
              G A ++ L D  G           CG T PN   QPIP +G     IT+ +   GPCE+W
Sbjct  12799  GNAVVKELADSHG---------SKCGKTDPNGAVQPIPADGYVQLQITAAHI--GPCELW  12653

Query  138    IDNTLALAGRNCHTEFPEGHHTIDYSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCINL  196
              +D  +  + + C  E+P+    +D+S C  S C++ W WL          W+++ NC+ +
Sbjct  12652  LDGEMVASAKQCVKEYPDRKIKVDFSKCKSSKCQLRWVWLAT----HNSPWEIYDNCVTV  12485

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 7/105 (7%)
 Frame = +3

Query  290    DSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQHDNCH  347
              D + ++  +A  +CG TD +A  QPIP DG++       H GPCEVWLD+T+V     C 
Sbjct  14376  DLIKALAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHIGPCEVWLDNTKVASAKECW  14555

Query  348    EVISGKTYDLDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              +    K   +D++ C +GSC L W W+          W+ +  CV
Sbjct  14556  KEFPNKRIKVDFAKCKSGSCQLRWVWMAT----HTSPWEFFDNCV  14678

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 45/93 (48%), Gaps = 7/93 (8%)
 Frame = -1

Query  302    RCGFTDPDAAPQPIP-DG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY  359
              +CG TDP+ A QPIP DG +       H GPCE+WLD   V     C +    +   +D+
Sbjct  12757  KCGKTDPNGAVQPIPADGYVQLQITAAHIGPCELWLDGEMVASAKQCVKEYPDRKIKVDF  12578

Query  360    SACNGS-CTLYWYWLGVRYLKQVYSWQVYKACV  391
              S C  S C L W WL          W++Y  CV
Sbjct  12577  SKCKSSKCQLRWVWLATHN----SPWEIYDNCV  12491

>PYIW:scaffold_182 piw_scaffold_182 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_182:1:25962:1 
REF
Length=25962

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 65/131 (50%), Gaps = 28/131 (21%)
 Frame = +1

Query  270   DFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY----  325
             +F       G+ SL+  +D     SV+      CG+T+P+AAP  +    ++S  Y    
Sbjct  1522  EFTAAWPKTGYTSLKEMLDK----SVSG-----CGYTNPNAAPVDVSG--LKSMKYQNNE  1668

Query  326   -------THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVR  376
                    +H GPCE W+D+T++   D+C +   G   T  +DYS C G+C L +YWL V 
Sbjct  1669  YKEGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVH  1848

Query  377   YLKQVYSWQVY  387
               K    WQVY
Sbjct  1849  SPK----WQVY  1869

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 6/61 (10%)
 Frame = -3

Query  329   GPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
             GPCE+W++ TRV Q ++C          + +DYS C G CT+ +Y L V  LK    WQ+
Sbjct  4099  GPCEIWIEKTRVFQTNDCRGYTDAYPAVFPVDYSVCKGDCTITFYLLAVHELK----WQI  3932

Query  387   Y  387
             Y
Sbjct  3931  Y  3929

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -3

Query  328    DGPCEVWLDDTRVLQHDNCHEVIS-GKTYDLDYSACNGSCTLYWYWL  373
               GPCEVW+D  R  +H NC ++     T   DYSAC+G+C L  YWL
Sbjct  21568  QGPCEVWIDSKRAFEHQNCAKLFEVTPTIPFDYSACHGTCLLTLYWL  21428

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 61/136 (45%), Gaps = 27/136 (20%)
 Frame = +1

Query  79    ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG----SFITSGY------  128
             + GY +L+ ++D         + +  CG T PN    P+  +G     +  + Y      
Sbjct  1543  KTGYTSLKEMLD---------KSVSGCGYTNPNA--APVDVSGLKSMKYQNNEYKEGFLG  1689

Query  129   TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYS  186
             +  GPCE WIDNT      +C   +P    T  +DYSVC  +CR++++WL +        
Sbjct  1690  SHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAV----HSPK  1857

Query  187   WQVFKNCINLSASALV  202
             WQV+      S  A V
Sbjct  1858  WQVYSKSACSSTIAYV  1905

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (49%), Gaps = 6/78 (8%)
 Frame = -3

Query  132   GPCEIWIDNTLALAGRNC--HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
             GPCEIWI+ T      +C  +T+       +DYSVC   C ++++ L +        WQ+
Sbjct  4099  GPCEIWIEKTRVFQTNDCRGYTDAYPAVFPVDYSVCKGDCTITFYLLAV----HELKWQI  3932

Query  190   FKNCINLSASALVTMIGL  207
             +    ++S S L T   +
Sbjct  3931  YSKLPSVSVSTLSTRASI  3878

 Score = 39.3 bits (90),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = -3

Query  131    DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWL  176
               GPCE+WID+  A   +NC   F E   TI  DYS C  +C ++ +WL
Sbjct  21568  QGPCEVWIDSKRAFEHQNCAKLF-EVTPTIPFDYSACHGTCLLTLYWL  21428

>PHRA:scaffold_23
Length=570991

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 67/137 (49%), Gaps = 17/137 (12%)
 Frame = +2

Query  266     STTDD---FVGYLDANGFDSLRAFMDD---DSLYSVNASADFR-CGFTDPDAAPQPIPDG  318
               S TD+   F  + +A G+ SLR  +D    D   S+  +A     G+T+         +G
Sbjct  380492  SPTDNAKVFNDHWNATGYKSLREMVDPIAPDYGKSIQTAAPIDVAGYTEMWWQNDEYKEG  380671

Query  319     IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVR  376
                + S    H GPCE W+DD R+  HDNC    +     +  DY++C G C   +YWL + 
Sbjct  380672  FIAS----HSGPCEAWIDDVRIFHHDNCAAQFTSYPAKIPADYASCKGDCLFSFYWLALH  380839

Query  377     YLKQVYSWQVYKACVPI  393
                     +WQ+YK CVPI
Sbjct  380840  EP----NWQIYKQCVPI  380878

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 6/70 (9%)
 Frame = +3

Query  326     THDGPCEVWLDDTRVLQHDNCHEVISGKTYD--LDYSACNGSCTLYWYWLGVRYLKQVYS  383
               +H GPCE W+DDTRV Q D+C    +G   +  +D+S+C+G CT  +YW+ +       +
Sbjct  390558  SHHGPCEAWIDDTRVFQSDDCRADYTGYPAEIPIDFSSCSGDCTFTFYWMAMHEP----N  390725

Query  384     WQVYKACVPI  393
               WQVYK C PI
Sbjct  390726  WQVYKQCAPI  390755

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 10/72 (14%)
 Frame = +2

Query  326     THDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQV  381
               +H+GPCE W+DD ++  HDNC      KTY      D+S+C G C   +YWL +      
Sbjct  384854  SHEGPCEAWVDDVQIFHHDNCAAQF--KTYPAKVPADFSSCKGDCLFVFYWLALHEPN--  385021

Query  382     YSWQVYKACVPI  393
                 WQ+YK CVPI
Sbjct  385022  --WQIYKQCVPI  385051

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 44/84 (52%), Gaps = 11/84 (13%)
 Frame = -3

Query  317     DGIMRSTGYTHDGPCEVWLDD-----TRVLQHDNCHEVISGKTYDL--DYSACNGSCTLY  369
               D  M+    +H GPCE W+D      TRV + D+C    +G   ++  DYS C G CT  
Sbjct  388667  DQEMKGFIESHHGPCEAWIDSNTGTKTRVFRSDDCRRDYTGYPAEIPIDYSLCTGECTFV  388488

Query  370     WYWLGVRYLKQVYSWQVYKACVPI  393
               +YWL +       +WQVYK C PI
Sbjct  388487  FYWLAMHEA----NWQVYKQCAPI  388428

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 57/122 (47%), Gaps = 15/122 (12%)
 Frame = +3

Query  82      YATLRALMD----DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIW  137
               + TLRALMD    D G  ++T   +    L+  + + Q       FI S +   GPCE W
Sbjct  390420  FKTLRALMDTAAPDCGNTALTGTAVDVSSLS--SMKWQNDQEQKGFIDSHH---GPCEAW  390584

Query  138     IDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
               ID+T      +C  ++        ID+S C   C  +++W+ +       +WQV+K C  
Sbjct  390585  IDDTRVFQSDDCRADYTGYPAEIPIDFSSCSGDCTFTFYWMAM----HEPNWQVYKQCAP  390752

Query  196     LS  197
               ++
Sbjct  390753  IA  390758

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (49%), Gaps = 6/68 (9%)
 Frame = +2

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                GPCE WID+       NC  +F      I  DY+ C   C  S++WL +       +WQ
Sbjct  380687  SGPCEAWIDDVRIFHHDNCAAQFTSYPAKIPADYASCKGDCLFSFYWLAL----HEPNWQ  380854

Query  189     VFKNCINL  196
               ++K C+ +
Sbjct  380855  IYKQCVPI  380878

 Score = 45.4 bits (106),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = -2

Query  329     GPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGV  375
               GPCE+WLD+  V Q  NC      +  T  +DYS C+G C L +Y L +
Sbjct  383433  GPCELWLDEAVVFQASNCAVAFPTRPATCAVDYSNCSGRCVLRFYALAL  383287

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 32/62 (52%), Gaps = 7/62 (11%)
 Frame = +1

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNG-SCTLYWYWLGVRYLKQVYSWQ  385
               GPCE W+DDT V  +D+C          +  DYSAC G  C   +YWL V   +    WQ
Sbjct  386578  GPCEGWIDDTMVFHYDDCVAKFPSYPAKIPTDYSACKGDKCLFVFYWLAVHSPE----WQ  386745

Query  386     VY  387
               +Y
Sbjct  386746  IY  386751

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 52/203 (26%), Positives = 78/203 (38%), Gaps = 53/203 (26%)
 Frame = -3

Query  46      FFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDC  105
               F  V+   Y   P A  +   V T+  A   L E   +    L  DD     T    F  
Sbjct  388964  FQQVNAHGYLSQPAAAFQGGSVTTSYNA--ILTESSDSAFAGLKWDDS--PETNTATFTN  388797

Query  106     GLTFPNTETQPI--------PTNGSFITSGYTLD-----------------------GPC  134
                  FPN++ + +        PT G+ +T+G  +D                       GPC
Sbjct  388796  A--FPNSKYKTLRDLLDTAAPTCGNTLTTGSPVDVSSLNSMKWQNDQEMKGFIESHHGPC  388623

Query  135     EIWIDNTLALAGR-----NC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
               E WID+      R     +C   +T +P     IDYS+C   C   ++WL +       +
Sbjct  388622  EAWIDSNTGTKTRVFRSDDCRRDYTGYP-AEIPIDYSLCTGECTFVFYWLAM----HEAN  388458

Query  187     WQVFKNC---INLSASALVTMIG  206
               WQV+K C   +N  A+   T++G
Sbjct  388457  WQVYKQCAPIVNGPATESTTVLG  388389

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 6/71 (8%)
 Frame = +2

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
               +GPCE W+D+       NC  +F      +  D+S C   C   ++WL +       +WQ
Sbjct  384860  EGPCEAWVDDVQIFHHDNCAAQFKTYPAKVPADFSSCKGDCLFVFYWLAL----HEPNWQ  385027

Query  189     VFKNCINLSAS  199
               ++K C+ ++ S
Sbjct  385028  IYKQCVPITNS  385060

 Score = 40.8 bits (94),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 7/64 (11%)
 Frame = +1

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVC-GESCRVSWFWLGIKYQGERYSWQ  188
               GPCE WID+T+     +C  +FP     I  DYS C G+ C   ++WL +        WQ
Sbjct  386578  GPCEGWIDDTMVFHYDDCVAKFPSYPAKIPTDYSACKGDKCLFVFYWLAV----HSPEWQ  386745

Query  189     VFKN  192
               ++  
Sbjct  386746  IYST  386757

 Score = 40.4 bits (93),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 7/70 (10%)
 Frame = -2

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
               GPCE+W+D  +     NC   FP    T  +DYS C   C + ++ L +        W+ 
Sbjct  383433  GPCELWLDEAVVFQASNCAVAFPTRPATCAVDYSNCSGRCVLRFYALALT----GVEWKA  383266

Query  190     FK-NCINLSA  198
               F  +C+ + A
Sbjct  383265  FSTSCLQIGA  383236

>HYAP:scaffold_8 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8:1:893728:1 
REF
Length=893728

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 61/125 (49%), Gaps = 10/125 (8%)
 Frame = +2

Query  271     FVGYLDANGFDSLRAF-MDDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHD  328
               F       G+ SL AF +++  L+      D  CG T   D+A   +P   +  TG+TH 
Sbjct  537653  FTETFPTKGYKSLGAFILENQELFL--PKVDLNCGLTVYKDSARSELPASELTYTGFTHP  537826

Query  329     GPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
               GPCEVW DDT+VL   +C     GK  T   D S C G+  +  YWLGV        WQV
Sbjct  537827  GPCEVWCDDTKVLFDSDCQTTYPGKPATMPYDKSKCAGANRMTIYWLGVHGDP----WQV  537994

Query  387     YKACV  391
               Y  C+
Sbjct  537995  YIDCM  538009

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 10/125 (8%)
 Frame = +2

Query  271     FVGYLDANGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHD  328
               F       G+ SL AF+ ++  ++  N   D  CG T   D+A   +P   +  T +TH 
Sbjct  522101  FTETFPTKGYKSLGAFIIENQEIHLPNVDPD--CGLTVYKDSARSELPASELTYTSFTHP  522274

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQV  386
               GPCEVW DDT+VL   +C      K   + Y  S C G+  +  Y + V        WQ 
Sbjct  522275  GPCEVWCDDTKVLFDSDCQTKYPNKPATMPYVKSKCAGANRMTIYRVAV----HADPWQS  522442

Query  387     YKACV  391
               Y  C+
Sbjct  522443  YINCM  522457

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 66/119 (55%), Gaps = 11/119 (9%)
 Frame = +2

Query  80      RGYATLRA-LMDDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIW  137
               +GY +L A ++++  L+    +   +CGLT + ++    +P +     +G+T  GPCE+W
Sbjct  537674  KGYKSLGAFILENQELFLPKVD--LNCGLTVYKDSARSELPAS-ELTYTGFTHPGPCEVW  537844

Query  138     IDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                D+T  L   +C T +P    T+ Y  S C  + R++ +WLG+   G+   WQV+ +C+
Sbjct  537845  CDDTKVLFDSDCQTTYPGKPATMPYDKSKCAGANRMTIYWLGV--HGDP--WQVYIDCM  538009

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 49/94 (52%), Gaps = 8/94 (9%)
 Frame = +2

Query  104     DCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY  162
               DCGLT + ++    +P +    TS +T  GPCE+W D+T  L   +C T++P    T+ Y
Sbjct  522191  DCGLTVYKDSARSELPASELTYTS-FTHPGPCEVWCDDTKVLFDSDCQTKYPNKPATMPY  522367

Query  163     --SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                 S C  + R++ + + +        WQ + NC+
Sbjct  522368  VKSKCAGANRMTIYRVAVHAD----PWQSYINCM  522457

>PYAR:scaffold_4452 par_scaffold_4452 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4452:1:2219:1 
REF
Length=2219

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 77/174 (44%), Gaps = 20/174 (11%)
 Frame = +2

Query  234  AHQLVILP--------APTYTVEGKDNRWKP--LAFLEGQNFSTTDDFVGYLDANGFDSL  283
            AH  + LP        AP+ T++G +    P  ++F  G   +T      Y   + + S+
Sbjct  356  AHSKMTLPKPNSAIDNAPSGTLDGPNTLQVPAGMSFGYGHEQNTAAFLKAYKSQSKYTSI  535

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY--THDGPCEVWLDDTRVL  341
            R  + D   +  +  A   CG +     PQ +PD +   TG+  TH GPCEVW DD RV 
Sbjct  536  RQMIYDK--FRPDGGATKECGRSAMTGPPQDLPDFVEYETGFDSTHWGPCEVWCDDKRVF  709

Query  342  QHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              DNC      K   L Y  + C G+  L  +WL +     V  WQ Y +C  +
Sbjct  710  YEDNCAVKYPQKPGKLPYDKAQCRGAKRLQSFWLAL----HVPDWQAYISCATL  859

 Score = 45.4 bits (106),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 59/138 (43%), Gaps = 9/138 (7%)
 Frame = +2

Query  68   HTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-  126
            +TA   + + ++  Y ++R ++ D   +        +CG +      Q +P    + T  
Sbjct  482  NTAAFLKAYKSQSKYTSIRQMIYDK--FRPDGGATKECGRSAMTGPPQDLPDFVEYETGF  655

Query  127  GYTLDGPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGER  184
              T  GPCE+W D+       NC  ++P+  G    D + C  + R+  FWL +      
Sbjct  656  DSTHWGPCEVWCDDKRVFYEDNCAVKYPQKPGKLPYDKAQCRGAKRLQSFWLALHVP---  826

Query  185  YSWQVFKNCINLSASALV  202
              WQ + +C  LS   L+
Sbjct  827  -DWQAYISCATLSGKRLL  877

>PYUU:scaffold_2012 scf1117875582012 dna:supercontig supercontig:pug:scf1117875582012:1:298282:1 
REF
Length=298282

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 61/125 (49%), Gaps = 14/125 (11%)
 Frame = -3

Query  277     ANGFDSLRAFMDDDSLY----SVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPC  331
               ANGF SLR ++             A     CGFTDP+  PQ IPD I  R + + H GPC
Sbjct  207473  ANGFKSLREYIKKYQKVVPYDGRPAGGTLECGFTDPNGPPQMIPDQIAWRGSTFQHSGPC  207294

Query  332     EVWLDDTRVLQHDNCH--EVISGK-TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYK  388
               EV  DD RV+   +C   E   GK TY  D + C G   L +YWL    +     +Q+Y 
Sbjct  207293  EV*CDDERVMYAPSCKVWEATGGKMTY--DKAKCIGKKRLTFYWLATFNV----PFQLYT  207132

Query  389     ACVPI  393
                C P+
Sbjct  207131  DCAPL  207117

 Score = 43.5 bits (101),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 5/100 (5%)
 Frame = -3

Query  101     GLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT-EFPEGHHT  159
               G  +CG T PN   Q IP   ++  S +   GPCE+  D+   +   +C   E   G  T
Sbjct  207395  GTLECGFTDPNGPPQMIPDQIAWRGSTFQHSGPCEV*CDDERVMYAPSCKVWEATGGKMT  207216

Query  160     IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                D + C    R++++WL          +Q++ +C  L  +
Sbjct  207215  YDKAKCIGKKRLTFYWLAT----FNVPFQLYTDCAPLQGT  207108

>PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_499.1_contig_1:1:23234:1 
REF
Length=23234

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = -3

Query  326   THDGPCEVWLDDTRVLQHDNCHEVISGKTYD--LDYSACNGSCTLYWYWLGVRYLKQVYS  383
             +H GPCE W+DDTRV+Q D+C         +  +DYS+C+G CT  +YW+ +        
Sbjct  9297  SHHGPCEAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMALHEPN----  9130

Query  384   WQVYKACVPI  393
             WQVYK C PI
Sbjct  9129  WQVYKQCAPI  9100

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 67/139 (48%), Gaps = 17/139 (12%)
 Frame = -2

Query  264    NFSTTDD---FVGYLDANGFDSLRAFMDDDSL---YSVNASADFR-CGFTDPDAAPQPIP  316
              N+S T +   F  + +A G+ SLR  +D  +    +S+  +      G+T+         
Sbjct  14497  NWSPTQNAQAFKDHWNATGYKSLRDMLDPIAPGYGFSLETADPVNVAGYTEMWWQNDEYK  14318

Query  317    DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLG  374
              +G + S    H+GPCE W+DD  V  HDNC          +  DYS+C G C   +YWL 
Sbjct  14317  EGFIAS----HEGPCEGWIDDIMVFHHDNCAAQFKSYPAKIPTDYSSCKGDCLFVFYWLA  14150

Query  375    VRYLKQVYSWQVYKACVPI  393
              +   +    WQ+YK CVPI
Sbjct  14149  LHQAE----WQIYKQCVPI  14105

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 63/144 (44%), Gaps = 29/144 (20%)
 Frame = +3

Query  266    STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP---------  316
              + T  F   L  + F +LRA MD         SA   CG T    +P  +          
Sbjct  11067  ANTATFASALPNSQFVTLRALMD---------SAVPTCGDTLTTGSPVDVSATSSMKWQN  11219

Query  317    DGIMRSTGYTHDGPCEVWLD-----DTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLY  369
              D  M     +H GPCE W+D      TRV Q D+C     G   ++  D+S CNG CT  
Sbjct  11220  DQEMMGFIDSHHGPCEAWIDGSDGSSTRVFQSDDCRRDYPGYPAEIPIDFSTCNGDCTFT  11399

Query  370    WYWLGVRYLKQVYSWQVYKACVPI  393
              +YWL +       +WQVYK C PI
Sbjct  11400  FYWLALHE----PNWQVYKQCAPI  11459

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 34/67 (51%), Gaps = 6/67 (9%)
 Frame = -1

Query  329    GPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
              GPCE W+D   V  +D+C          +  DYS+C G C   +YWL +        WQ+
Sbjct  12578  GPCEGWIDGKMVFHYDDCVAKFPSYPAKIPTDYSSCKGDCLFVFYWLALHQA----DWQI  12411

Query  387    YKACVPI  393
              YK CVPI
Sbjct  12410  YKQCVPI  12390

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 15/122 (12%)
 Frame = -3

Query  82    YATLRALMD----DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIW  137
             + TLRALMD    D G  ++T   +    L+  + + Q       FI S +   GPCE W
Sbjct  9435  FKTLRALMDTVAPDCGNTALTGSPVDVSALS--SMKWQNDQEQKGFIDSHH---GPCEAW  9271

Query  138   IDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
             ID+T  +   +C  ++P       IDYS C   C  +++W+ +       +WQV+K C  
Sbjct  9270  IDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMAL----HEPNWQVYKQCAP  9103

Query  196   LS  197
             ++
Sbjct  9102  IT  9097

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 37/69 (54%), Gaps = 6/69 (9%)
 Frame = -2

Query  131    DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
              +GPCE WID+ +     NC  +F      I  DYS C   C   ++WL + +Q E   WQ
Sbjct  14296  EGPCEGWIDDIMVFHHDNCAAQFKSYPAKIPTDYSSCKGDCLFVFYWLAL-HQAE---WQ  14129

Query  189    VFKNCINLS  197
              ++K C+ ++
Sbjct  14128  IYKQCVPIT  14102

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 6/68 (9%)
 Frame = -1

Query  132    GPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQV  189
              GPCE WID  +     +C  +FP     I  DYS C   C   ++WL +     +  WQ+
Sbjct  12578  GPCEGWIDGKMVFHYDDCVAKFPSYPAKIPTDYSSCKGDCLFVFYWLAL----HQADWQI  12411

Query  190    FKNCINLS  197
              +K C+ ++
Sbjct  12410  YKQCVPIT  12387

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 55/137 (40%), Gaps = 38/137 (28%)
 Frame = +3

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGS-------------F  123
              L    + TLRALMD           +  CG T   T   P+  + +             F
Sbjct  11094  LPNSQFVTLRALMD---------SAVPTCGDTL--TTGSPVDVSATSSMKWQNDQEMMGF  11240

Query  124    ITSGYTLDGPCEIWID-----NTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWL  176
              I S +   GPCE WID     +T      +C  ++P       ID+S C   C  +++WL
Sbjct  11241  IDSHH---GPCEAWIDGSDGSSTRVFQSDDCRRDYPGYPAEIPIDFSTCNGDCTFTFYWL  11411

Query  177    GIKYQGERYSWQVFKNC  193
               +       +WQV+K C
Sbjct  11412  AL----HEPNWQVYKQC  11450

 Score = 42.7 bits (99),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 23/83 (28%), Positives = 39/83 (47%), Gaps = 8/83 (10%)
 Frame = +2

Query  129    TLDGPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
              T+ GPCE+W++  +    +NC   FP       +DYS C   C + ++ L +        
Sbjct  15569  TV*GPCELWLNELMVFKAKNCAVAFPTSPAMCAVDYSSCSGYCLLRFYALALT----GVE  15736

Query  187    WQVFKNCINLSASALVTMIGLQH  209
              WQ F    +L+ + L+ + GL  
Sbjct  15737  WQAFST--SLANNVLLLIRGLSF  15799

 Score = 41.6 bits (96),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 33/62 (53%), Gaps = 6/62 (10%)
 Frame = +2

Query  329    GPCEVWLDDTRVLQHDNCHEVI--SGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
              GPCE+WL++  V +  NC      S     +DYS+C+G C L +Y L +  ++    WQ 
Sbjct  15578  GPCELWLNELMVFKAKNCAVAFPTSPAMCAVDYSSCSGYCLLRFYALALTGVE----WQA  15745

Query  387    YK  388
              + 
Sbjct  15746  FS  15751

>PHKE:scaffold_1151 scf_22126_1151.1_contig_1 dna:supercontig 
supercontig:PhyKer238_432v1:scf_22126_1151.1_contig_1:1:3259:1 
REF
Length=3259

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 49/96 (51%), Gaps = 10/96 (10%)
 Frame = -1

Query  302   RCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT---Y  355
             +CG TD    PQP+P DG  +  + G +H GPCE+W DDTRV    NC    +G+     
Sbjct  2038  KCGSTDMAGTPQPVPSDGYAQHDTLGTSHPGPCEIWCDDTRVFHDTNCAGKFAGQVPTKI  1859

Query  356   DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              +D S C  S    +YWL +     V  WQVY  C 
Sbjct  1858  PIDVSVCQASSEFIFYWLAL----HVKPWQVYINCA  1763

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 59/122 (48%), Gaps = 16/122 (13%)
 Frame = -3

Query  278  NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVW  334
            NG  SL+ ++   + Y  N S    CG T  D   + IP DG     + G +H GPCE+W
Sbjct  896  NGISSLKEYI---TTYGTNIS---ECGNTLKDGTAEAIPSDGYAEHDTLGNSHPGPCEIW  735

Query  335  LDDTRVLQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             DDTRV  + NC    SG++     +D S C  S    +YWL +        WQVY  CV
Sbjct  734  CDDTRVFNNTNCVTEFSGQSPAKIPIDVSTCKASSEFVFYWLAL----HAQPWQVYINCV  567

Query  392  PI  393
             +
Sbjct  566  AL  561

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 81/191 (42%), Gaps = 27/191 (14%)
 Frame = -3

Query  23    LCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGV---------HTAIEA  73
             L      L +  G G +++ PPP    D + Y G P   ++   +         + A++ 
Sbjct  1085  LVTQAANLPTVFGHGNIIV-PPPTGDSDHVYYFGGPAGTIDMPKIIGDASYGDYYEAVDE  909

Query  74    QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYTLD  131
               W  + G ++L+  +   G        + +CG T  +   + IP++G     T G +  
Sbjct  908   --WFTKNGISSLKEYITTYGT------NISECGNTLKDGTAEAIPSDGYAEHDTLGNSHP  753

Query  132   GPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
             GPCEIW D+T      NC TEF         ID S C  S    ++WL +  Q     WQ
Sbjct  752   GPCEIWCDDTRVFNNTNCVTEFSGQSPAKIPIDVSTCKASSEFVFYWLALHAQ----PWQ  585

Query  189   VFKNCINLSAS  199
             V+ NC+ L  +
Sbjct  584   VYINCVALDGT  552

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 54/123 (44%), Gaps = 15/123 (12%)
 Frame = -1

Query  76    WLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYTLDGP  133
             W  +   A+L+  +   G        +  CG T      QP+P++G     T G +  GP
Sbjct  2104  WFTKNKIASLKQYITTYG------TDIDKCGSTDMAGTPQPVPSDGYAQHDTLGTSHPGP  1943

Query  134   CEIWIDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
             CEIW D+T      NC  +F     T   ID SVC  S    ++WL +  +     WQV+
Sbjct  1942  CEIWCDDTRVFHDTNCAGKFAGQVPTKIPIDVSVCQASSEFIFYWLALHVK----PWQVY  1775

Query  191   KNC  193
              NC
Sbjct  1774  INC  1766

>PYIR:scaffold_973 pir_scaffold_973 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_973:1:12152:1 
REF
Length=12152

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 76/176 (43%), Gaps = 30/176 (17%)
 Frame = -1

Query  234   AHQLVILPAPTY-----------TVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDA  277
             AH  + LP PT+           T++G      P     G +FST     T  F   L +
Sbjct  4886  AHSKMSLPKPTWDNGYGTNSPSGTIDGPSALTAP----SGMSFSTDPSSNTKAFTAALKS  4719

Query  278   NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLD  336
             + + SL+            AS D  CGF+   AA QP+PD +       +H+GPCEVW D
Sbjct  4718  SKYGSLKELAFATQKTESGASKD--CGFSKVGAA-QPLPDVVQWDELTPSHEGPCEVWCD  4548

Query  337   DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
              T     DNC +  +G    L Y  S C+G+  L   WL +       +WQVY  C
Sbjct  4547  GTMAFHGDNCAKTYTGTPAKLPYDKSKCSGAKVLMSIWLAL----HTPTWQVYTNC  4392

 Score = 43.5 bits (101),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 8/99 (8%)
 Frame = -1

Query  98    TEEGLF-DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG  156
             TE G   DCG +      QP+P    +     + +GPCE+W D T+A  G NC   +   
Sbjct  4673  TESGASKDCGFSKVGA-AQPLPDVVQWDELTPSHEGPCEVWCDGTMAFHGDNCAKTYTGT  4497

Query  157   HHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
                + Y  S C  +  +   WL +       +WQV+ NC
Sbjct  4496  PAKLPYDKSKCSGAKVLMSIWLAL----HTPTWQVYTNC  4392

>PHSO:scaffold_15
Length=1143705

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 75/173 (43%), Gaps = 23/173 (13%)
 Frame = +2

Query  234     AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDA-------NGFDSLRAF  286
               AH  +I+P PT   E       P   ++      +  +  Y  A       N   SL+ +
Sbjct  573122  AHGNIIVPKPTGNAEHPYYIGGPAGTIDMAELVGSASYGDYYQAADDWFTKNNVASLKEY  573301

Query  287     MDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRVLQH  343
               +     Y  + S    CG T+     QP+P DG  +  + G +H GPCE+W DDTRV  +
Sbjct  573302  ITK---YGTDIS---ECGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHN  573463

Query  344     DNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                NC +  +G+      +D S C  S    +YWL +        WQVY  CV +
Sbjct  573464  TNCAQEYAGEVPTKLPIDVSTCKASSEFVFYWLALH----AQPWQVYINCVAL  573610

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 67/140 (48%), Gaps = 25/140 (18%)
 Frame = +2

Query  262     GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM  320
               G  +   DD   +   N  DS++ ++          S    CG T  +  PQP+P DG +
Sbjct  579311  GDYYQAVDD---WFSKNNIDSVKDYI------KTYGSDIAECGNTKKNGTPQPVPEDGFV  579463

Query  321     R--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK-------TYDLDYSACNGSCTLYWY  371
               +  + G +H GPCE+W DDTRV  + +C   +SG+       +  +D + C  S  L +Y
Sbjct  579464  KHDTLGTSHPGPCEIWCDDTRVFHNVDCG--LSGEFAGQAPTSLPIDVATCKASSQLVFY  579637

Query  372     WLGVRYLKQVYSWQVYKACV  391
               WL +     V  WQVY  CV
Sbjct  579638  WLAL----HVQPWQVYINCV  579685

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 59/133 (44%), Gaps = 15/133 (11%)
 Frame = +2

Query  73      AQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYTL  130
               A  W  +   A+L+  +   G        + +CG T      QP+P++G     T G + 
Sbjct  573254  ADDWFTKNNVASLKEYITKYGT------DISECGNTEKKGLAQPVPSDGYAQHDTLGSSH  573415

Query  131     DGPCEIWIDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKYQGERYSW  187
                GPCEIW D+T      NC  E+     T   ID S C  S    ++WL +  Q     W
Sbjct  573416  PGPCEIWCDDTRVFHNTNCAQEYAGEVPTKLPIDVSTCKASSEFVFYWLALHAQ----PW  573583

Query  188     QVFKNCINLSASA  200
               QV+ NC+ L  +A
Sbjct  573584  QVYINCVALDGTA  573622

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 13/107 (12%)
 Frame = +2

Query  102     LFDCGLTFPNTETQPIPTNGSFI---TSGYTLDGPCEIWIDNTLALAGRNC--HTEFPEG  156
               + +CG T  N   QP+P +G F+   T G +  GPCEIW D+T      +C    EF   
Sbjct  579398  IAECGNTKKNGTPQPVPEDG-FVKHDTLGTSHPGPCEIWCDDTRVFHNVDCGLSGEFAGQ  579574

Query  157     HHT---IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                 T   ID + C  S ++ ++WL +  Q     WQV+ NC+ L   A
Sbjct  579575  APTSLPIDVATCKASSQLVFYWLALHVQ----PWQVYINCVTLDGKA  579703

>PYIR:scaffold_81 pir_scaffold_81 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_81:1:58218:1 
REF
Length=58218

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 61/128 (48%), Gaps = 6/128 (5%)
 Frame = -3

Query  268   TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTH  327
             T  F     A G+ SL+  +D  +    N+  D         +A +   D        +H
Sbjct  4903  TQQFTAGFRAAGYPSLKTLLDPAAPGCGNSRLDVPAVDVSRLSAMEFRNDEYHEGFVSSH  4724

Query  328   DGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
              GPCEVW+D+TR   +D+C  +  G   +  +++S C   CTL +YWL +       +WQ
Sbjct  4723  HGPCEVWIDNTRAFHNDDCRALFPGFPASIPVNFSLCKDKCTLTFYWLALHEP----TWQ  4556

Query  386   VYKACVPI  393
             VYK CVPI
Sbjct  4555  VYKQCVPI  4532

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 44/76 (58%), Gaps = 9/76 (12%)
 Frame = -3

Query  123   FITSGYTLDGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKY  180
             F++S +   GPCE+WIDNT A    +C   FP       +++S+C + C ++++WL +  
Sbjct  4738  FVSSHH---GPCEVWIDNTRAFHNDDCRALFPGFPASIPVNFSLCKDKCTLTFYWLAL--  4574

Query  181   QGERYSWQVFKNCINL  196
                  +WQV+K C+ +
Sbjct  4573  --HEPTWQVYKQCVPI  4532

>PHKE:scaffold_22 scf_22126_22.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_22.1:1:203587:1 
REF
Length=203587

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 103/226 (46%), Gaps = 27/226 (12%)
 Frame = -3

Query  182    GERYSWQVFKNCINLSASALVTMIGLQHprsalpalalaaaafvatnapqaMAHQLVILP  241
              G R+S Q  K+  NL +  +V  +  +           A+     T  P  + H  ++ P
Sbjct  39668  GSRFSCQPTKSLGNLPSHFIVVNVPFE----MKVLALTASGTIALTFIPFVLGHGYIVDP  39501

Query  242    APT----YTVEG-----KDNRWKPLAF-LEGQNFSTTDDF-VGYLDANGFDSLRAFMDDD  290
              APT    Y V G      +N W  + + + G     T  F     DA+G++SL  +++ +
Sbjct  39500  APTWKDGYAVNGWGSSIDNNMWGAIDYSVYGYGTDGTVAFWKAKYDASGYESLGQYIETN  39321

Query  291    SLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH--  347
               +   +   D +CG+T   D+A Q +P   +  TG+TH GPCEVW DDT VL   NC   
Sbjct  39320  QVMYSD-EIDEQCGYTTYDDSARQTMPSTNLTYTGFTHPGPCEVWCDDTVVLFDYNCQST  39144

Query  348    --EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                ++ +G  YD   S C  +     YWLGV        WQV+  CV
Sbjct  39143  YPDIPAGIPYDE--SLCADANRFTIYWLGVHGAP----WQVFTDCV  39024

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 60/119 (50%), Gaps = 10/119 (8%)
 Frame = -1

Query  277    ANGFDSLRAFMDDD-SLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCEVW  334
              + G+DSL AF+  +  LYS    AD  CG T   D+A   +P   +  +G+TH GPCEVW
Sbjct  37594  SKGYDSLGAFISKNQELYSSATDAD--CGLTVYKDSARSELPASKLTYSGFTHTGPCEVW  37421

Query  335    LDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               DDT+VL   +C         T   D S C  +  L  YW+G+        WQVY  CV
Sbjct  37420  CDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLHGDP----WQVYTDCV  37256

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 68/120 (57%), Gaps = 11/120 (9%)
 Frame = -1

Query  79     ERGYATLRALMDDDG-LYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEI  136
               +GY +L A +  +  LYS   +   DCGLT + ++    +P +     SG+T  GPCE+
Sbjct  37594  SKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPAS-KLTYSGFTHTGPCEV  37424

Query  137    WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              W D+T  L   +C T++P+   T+ Y  S+C  + R++ +W+G+   G+   WQV+ +C+
Sbjct  37423  WCDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGL--HGD--PWQVYTDCV  37256

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 68/121 (56%), Gaps = 12/121 (10%)
 Frame = -3

Query  80     RGYATLRALM-DDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIW  137
              + Y TL AL+ D   LYS + +   +CGLT + ++    +P   +F  +G+T  GPCE+W
Sbjct  35357  KKYKTLSALIADKQELYSKSVDP--ECGLTAYKDSARSELPKELAF--TGFTHPGPCEVW  35190

Query  138    IDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
               DNT  L   +C   +P+   T+ Y  S+C  + R++ +W+ +   G+   WQV+ +C+ 
Sbjct  35189  CDNTKVLYKADCQKAYPDIPATMSYDSSLCANANRLTIYWIAV--HGD--PWQVYADCVW  35022

Query  196    L  196
              L
Sbjct  35021  L  35019

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 62/127 (49%), Gaps = 14/127 (11%)
 Frame = -3

Query  272    VGYLDAN---GFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYT  326
              + +++AN    + +L A + D   LYS   S D  CG T   D+A   +P  +   TG+T
Sbjct  35384  IKFIEANLPKKYKTLSALIADKQELYS--KSVDPECGLTAYKDSARSELPKELAF-TGFT  35214

Query  327    HDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
              H GPCEVW D+T+VL   +C +       T   D S C  +  L  YW+ V        W
Sbjct  35213  HPGPCEVWCDNTKVLYKADCQKAYPDIPATMSYDSSLCANANRLTIYWIAV----HGDPW  35046

Query  385    QVYKACV  391
              QVY  CV
Sbjct  35045  QVYADCV  35025

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 54/95 (57%), Gaps = 8/95 (8%)
 Frame = -3

Query  105    CG-LTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY-  162
              CG  T+ ++  Q +P+  +   +G+T  GPCE+W D+T+ L   NC + +P+    I Y 
Sbjct  39287  CGYTTYDDSARQTMPST-NLTYTGFTHPGPCEVWCDDTVVLFDYNCQSTYPDIPAGIPYD  39111

Query  163    -SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               S+C ++ R + +WLG+        WQVF +C+ L
Sbjct  39110  ESLCADANRFTIYWLGV----HGAPWQVFTDCVWL  39018

>PYAR:scaffold_3482 par_scaffold_3482 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3482:1:3236:1 
REF
Length=3236

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 63/128 (49%), Gaps = 12/128 (9%)
 Frame = +2

Query  271   FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGF-TDPDAAPQPIPDGIM--RSTGYTH  327
             F      + + SL+  +  +   S  A+A+  CGF T   A PQP+PD +     TG +H
Sbjct  1739  FNAAFKNSKYKSLKELVLQNQKVSAGATAE--CGFATLSGATPQPLPDVVEWDEFTG-SH  1909

Query  328   DGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYS--ACNGSCTLYWYWLGVRYLKQVYSWQ  385
              GPCEVW D+    Q DNC + I G    L+Y   AC G+  L  YW+ +        WQ
Sbjct  1910  TGPCEVWCDNNLAFQDDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIAL----HTAEWQ  2077

Query  386   VYKACVPI  393
             VY  C P+
Sbjct  2078  VYTGCAPL  2101

 Score = 41.6 bits (96),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 9/119 (8%)
 Frame = +2

Query  82    YATLRALMDDDGLYSVTEEGLFDCGL-TFPNTETQPIPTNGSFITSGYTLDGPCEIWIDN  140
             Y +L+ L+  +    V+     +CG  T      QP+P    +     +  GPCE+W DN
Sbjct  1766  YKSLKELVLQN--QKVSAGATAECGFATLSGATPQPLPDVVEWDEFTGSHTGPCEVWCDN  1939

Query  141   TLALAGRNCHTEFPEGHHTIDYS--VCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
              LA    NC          ++Y    C  +  ++ +W+ +        WQV+  C  LS
Sbjct  1940  NLAFQDDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIAL----HTAEWQVYTGCAPLS  2104

>PHCA:scaffold_39 PHYCAscaffold_39
Length=591971

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 50/102 (49%), Gaps = 18/102 (18%)
 Frame = +3

Query  300     DFRCGFTDPDAAPQPIPDGIMR------STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
               D +CGFT  D  P+P+P             G+TH GPCE+++DD  VL  D+C     G 
Sbjct  200079  DKKCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGG  200258

Query  354     TYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                 D        +DYS+CNG CT   YWLG     Q   WQ Y
Sbjct  200259  PNDSGIMSEMPVDYSSCNGDCTFSIYWLGF----QNAQWQAY  200372

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 17/99 (17%)
 Frame = +3

Query  105     CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
               CG T  + + +P+PTNG  +       G+T  GPCE++ID+ + L   +C  ++P G + 
Sbjct  200088  CGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPND  200267

Query  160     --------IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                       +DYS C   C  S +WLG     +   WQ +
Sbjct  200268  SGIMSEMPVDYSSCNGDCTFSIYWLGF----QNAQWQAY  200372

>PYUU:scaffold_1789 scf1117875581789 dna:supercontig supercontig:pug:scf1117875581789:1:837833:1 
REF
Length=837833

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 66/151 (44%), Gaps = 43/151 (28%)
 Frame = +2

Query  269     DDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM----RST  323
               +DF       G+ +LR+F+++             CG+T+P+  P+ IP DG +     + 
Sbjct  698189  NDFARISKQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNV  698341

Query  324     GYTH-------------------------DGPCEVWLDDTRVLQHDNCHEVISG--KTYD  356
               G+ H                          GPCE+WLD+  +L  DNC +   G      
Sbjct  698342  GFVHPVRTAT*MSLSCCCMKAHLDVSRFPQGPCELWLDNKMILHKDNCQKAFPGVKAVMP  698521

Query  357     LDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               +D+S+C G+C L  YWLG  +  Q   WQ Y
Sbjct  698522  VDFSSCKGTCMLRMYWLG--FQDQGQRWQTY  698608

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 67/153 (44%), Gaps = 43/153 (28%)
 Frame = +2

Query  79      ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTL--------  130
               ++GY TLR+ +++ G           CG T PNT  + IP +G  I +   +        
Sbjct  698213  QKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPVRT  698365

Query  131     ---------------------DGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGE  167
                                     GPCE+W+DN + L   NC   FP  +    +D+S C  
Sbjct  698366  AT*MSLSCCCMKAHLDVSRFPQGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKG  698545

Query  168     SCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               +C +  +WLG + QG+R  WQ +    N+ A++
Sbjct  698546  TCMLRMYWLGFQDQGQR--WQTYSK-YNVGAAS  698635

>PYUU:scaffold_2033 scf1117875582033 dna:supercontig supercontig:pug:scf1117875582033:1:91152:1 
REF
Length=91152

 Score = 58.2 bits (139),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 4/71 (6%)
 Frame = +3

Query  319    IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVR  376
              + RST     GPCE+WLDD RV+Q D+C      +   +++D+S+C  +C L ++WLG++
Sbjct  27723  LNRSTY*PR*GPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ  27902

Query  377    YLKQVYSWQVY  387
                     WQVY
Sbjct  27903  --DSGTRWQVY  27929

 Score = 33.5 bits (75),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 9/53 (17%)
 Frame = +1

Query  264    NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
              N+    +F       GFD+LR++++D             CG TDP+A P+ IP
Sbjct  27481  NWKDPANFAKVSKEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIP  27612

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 4/61 (7%)
 Frame = +3

Query  132    GPCEIWIDNTLALAGRNCHTEFPEGH--HTIDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
              GPCEIW+D+   +   +C   F +      ID+S C  +C + +FWLG++  G R  WQV
Sbjct  27753  GPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQDSGTR--WQV  27926

Query  190    F  190
              +
Sbjct  27927  Y  27929

>PYAR:scaffold_370 par_scaffold_370 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_370:1:20005:1 
REF
Length=20005

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 60/124 (48%), Gaps = 8/124 (6%)
 Frame = +3

Query  272    VGYLDAN----GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTH  327
              V Y + N     + +L+  +  +        +D +CG T  D A +      ++ +G+TH
Sbjct  17514  VKYFETNFPKSKYKTLKDLIMGEQTVLTEYKSDAQCGLTTKDEAKRATLPATLKYSGFTH  17693

Query  328    DGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
               GPCEVW D+T++   ++C +  +  T  +D S C G+  L  YW+ V        WQVY
Sbjct  17694  AGPCEVWCDNTKLAFANDCEKTYATGTIPIDTSKCQGADRLTIYWVAV----HSEPWQVY  17861

Query  388    KACV  391
                CV
Sbjct  17862  TDCV  17873

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 57/123 (46%), Gaps = 5/123 (4%)
 Frame = +3

Query  74     QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGP  133
              +T   +  Y TL+ L+  +       +    CGLT  + E +      +   SG+T  GP
Sbjct  17526  ETNFPKSKYKTLKDLIMGEQTVLTEYKSDAQCGLTTKD-EAKRATLPATLKYSGFTHAGP  17702

Query  134    CEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
              CE+W DNT      +C   +  G   ID S C  + R++ +W+ +  +     WQV+ +C
Sbjct  17703  CEVWCDNTKLAFANDCEKTYATGTIPIDTSKCQGADRLTIYWVAVHSE----PWQVYTDC  17870

Query  194    INL  196
              + L
Sbjct  17871  VYL  17879

>PHCA:scaffold_146 PHYCAscaffold_146
Length=47772

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = +1

Query  302  RCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK---TY  355
             CG T  +  PQP+P DG ++  S G +H GPCE+W DDTRV  + NC    +G+   + 
Sbjct  46   ECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSL  225

Query  356  DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             +D   C  S  L +YWL +    Q   WQVY  CV +
Sbjct  226  PIDLDTCKSSSELVFYWLSL----QGAPWQVYINCVKL  327

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 52/103 (50%), Gaps = 11/103 (11%)
 Frame = +1

Query  104  DCGLTFPNTETQPIPTNGSFI---TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT-  159
            +CG T  N   QP+PT+G F+   + G +  GPCEIW D+T      NC  E+     T 
Sbjct  46   ECGNTKKNGTPQPLPTDG-FVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTS  222

Query  160  --IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              ID   C  S  + ++WL +    +   WQV+ NC+ L  SA
Sbjct  223  LPIDLDTCKSSSELVFYWLSL----QGAPWQVYINCVKLDGSA  339

>PHPA:scaffold_76 NW_008649062.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.76, whole genome shotgun 
sequence
Length=282732

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 8/82 (10%)
 Frame = +1

Query  261    EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
              +G N  + + F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  43747  DGNNAGSVETFKSLKSANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  43908

Query  320    MR-STGYTHDGPCEVWLDDTRV  340
                 S    H GPCE+WLDDT+V
Sbjct  43909  ATFSRALVHVGPCEIWLDDTKV  43974

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 35/65 (54%), Gaps = 7/65 (11%)
 Frame = +1

Query  78     AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEI  136
              +   +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEI
Sbjct  43792  SANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEI  43953

Query  137    WIDNT  141
              W+D+T
Sbjct  43954  WLDDT  43968

>PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.1, whole genome shotgun 
sequence
Length=4724858

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = +2

Query  326      THDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYS  383
                +H GPCE W+DDTRV   D+C    +G   ++  D+S+C+G CT  +YWL +        
Sbjct  4462469  SHRGPCEGWIDDTRVFHSDDCRADYTGYPAEIPVDFSSCSGDCTFTFYWLALHEPN----  4462636

Query  384      WQVYKACVPI  393
                WQVYK C PI
Sbjct  4462637  WQVYKQCAPI  4462666

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 63/131 (48%), Gaps = 18/131 (14%)
 Frame = -3

Query  271      FVGYLDANGFDSLRAFMD---DDSLYSVNASADFR-CGFTDPDAAPQPIPDGIMRSTGYT  326
                F  + +A G+ SLR   D    D  +SV  +      G+T+         +G + S    
Sbjct  4473408  FTEHWNATGYKSLRDMTDPIATDYGHSVETATPVDVTGYTEMWWQNNEYKEGFIAS----  4473241

Query  327      HDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQVY  382
                H+GPCE W+ +T+V  +DNC      K+Y      DYS+C G C   +YWL +       
Sbjct  4473240  HEGPCEAWIGETQVFHYDNCAARF--KSYPAKIPADYSSCKGDCLFAFYWLALHEPN---  4473076

Query  383      SWQVYKACVPI  393
                 WQ+YK CVPI
Sbjct  4473075  -WQIYKQCVPI  4473046

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 13/121 (11%)
 Frame = -2

Query  264      NFSTTDD---FVGYLDANGFDSLRAFMDD---DSLYSVNASADFRC-GFTDPDAAPQPIP  316
                N+S T +   F  + +A G+ SLR  +D    D  +S+  +      G+T+         
Sbjct  1914946  NWSPTQNAQAFTDHWNATGYKSLRDMLDPIAPDYGHSLKTATPVDVSGYTEMWWQNDEYK  1914767

Query  317      DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLG  374
                +G + S    H+GPCE W+DDTR+  +DNC          +  DYS+C G C   +YWL 
Sbjct  1914766  EGFIAS----HEGPCEAWIDDTRIFHYDNCAAQFKSYPAKIPADYSSCKGDCLFAFYWLA  1914599

Query  375      V  375
                +
Sbjct  1914598  L  1914596

 Score = 46.6 bits (109),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 57/125 (46%), Gaps = 21/125 (17%)
 Frame = +2

Query  82       YATLRALMD----DDGLYSVTEEGLFDCGL---TFPNTETQPIPTNGSFITSGYTLDGPC  134
                + TL+A+MD    D G  S+T   +    L   T+ N + Q       FI S     GPC
Sbjct  4462331  FKTLKAMMDTVASDCGKTSLTGSPVDVSSLSSMTWQNDQEQ-----KGFIDSHR---GPC  4462486

Query  135      EIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
                E WID+T      +C  ++        +D+S C   C  +++WL +       +WQV+K 
Sbjct  4462487  EGWIDDTRVFHSDDCRADYTGYPAEIPVDFSSCSGDCTFTFYWLAL----HEPNWQVYKQ  4462654

Query  193      CINLS  197
                C  ++
Sbjct  4462655  CAPIT  4462669

 Score = 45.8 bits (107),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 33/69 (48%), Gaps = 6/69 (9%)
 Frame = -3

Query  131      DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
                +GPCE WI  T      NC   F      I  DYS C   C  +++WL +       +WQ
Sbjct  4473237  EGPCEAWIGETQVFHYDNCAARFKSYPAKIPADYSSCKGDCLFAFYWLAL----HEPNWQ  4473070

Query  189      VFKNCINLS  197
                ++K C+ ++
Sbjct  4473069  IYKQCVPIT  4473043

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 10/87 (11%)
 Frame = +1

Query  129      TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYS  186
                +L GPCE+WID  +     NC   FP    T  ++YS C + C + ++ L +        
Sbjct  1916260  SL*GPCELWIDEGVVFQANNCAVAFPSSPATCPVNYSSCNDKCVLRFYALSLAGTA----  1916427

Query  187      WQVFK--NCINLSASAL--VTMIGLQH  209
                WQ F   N + L AS +  V  I L++
Sbjct  1916428  WQAFSTLNSLPLLASRV*CVECIALEY  1916508

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 10/87 (11%)
 Frame = +3

Query  129      TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYS  186
                +L GPCE+WID  +     NC   FP    T  ++YS C + C + ++ L +        
Sbjct  4478703  SL*GPCELWIDEGVVFQANNCAVAFPSSPATCPVNYSSCNDKCVLRFYALSLAGTA----  4478870

Query  187      WQVFK--NCINLSASAL--VTMIGLQH  209
                WQ F   N + L AS +  V  I L++
Sbjct  4478871  WQAFSTLNSLPLLASRV*CVECIALEY  4478951

 Score = 44.3 bits (103),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 59/138 (43%), Gaps = 28/138 (20%)
 Frame = +1

Query  266      STTDDFVGYLDANGFDSLRAFMDDDSLYS--------------VNASADFRCGFTDPDAA  311
                +  D F     + GF SLR F+++    S              V   A+ +  F + DAA
Sbjct  1916002  NNVDTFTEAFPSTGFASLRQFVENVYQNSRSTGCSSGTGASKVVIVGAEVQKFFWNDDAA  1916181

Query  312      PQPIPDGIMRSTGYT-----HD-------GPCEVWLDDTRVLQHDNCHEVI--SGKTYDL  357
                 +   + +  S  +      HD       GPCE+W+D+  V Q +NC      S  T  +
Sbjct  1916182  AEGGFEHVSLSFAWQVG*RRHDKVFVSL*GPCELWIDEGVVFQANNCAVAFPSSPATCPV  1916361

Query  358      DYSACNGSCTLYWYWLGV  375
                +YS+CN  C L +Y L +
Sbjct  1916362  NYSSCNDKCVLRFYALSL  1916415

 Score = 43.9 bits (102),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 40/83 (48%), Gaps = 8/83 (10%)
 Frame = +2

Query  130      LDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVC-GESCRVSWFWLGIKYQGERYS  186
                L GPCE WIDN +     +C  EFP     I  DYS C G+ C   ++WL +        
Sbjct  4458293  LQGPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLAL----HSPE  4458460

Query  187      WQVFKNCINLSASALVTMIGLQH  209
                WQ++   +  S S L  ++  +H
Sbjct  4458461  WQIYSTSMK-SCSKLF*LMLTRH  4458526

 Score = 43.9 bits (102),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 59/138 (43%), Gaps = 28/138 (20%)
 Frame = +3

Query  266      STTDDFVGYLDANGFDSLRAFMDDDSLYS--------------VNASADFRCGFTDPDAA  311
                +  D F     + GF SLR F+++    S              V   A+ +  F + DAA
Sbjct  4478445  NNVDTFTEAFPSTGFASLRQFVENVYQNSRSTGCSSGTGASKVVIVGAEVQKFFWNDDAA  4478624

Query  312      PQPIPDGIMRSTGYT-----HD-------GPCEVWLDDTRVLQHDNCHEVI--SGKTYDL  357
                 +   + +  S  +      HD       GPCE+W+D+  V Q +NC      S  T  +
Sbjct  4478625  AEGGFEHVSLSFAWQVG*RRHDKVFVSL*GPCELWIDEGVVFQANNCAVAFPSSPATCPV  4478804

Query  358      DYSACNGSCTLYWYWLGV  375
                +YS+CN  C L +Y L +
Sbjct  4478805  NYSSCNDKCVLRFYALSL  4478858

 Score = 42.7 bits (99),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 32/64 (50%), Gaps = 7/64 (11%)
 Frame = -3

Query  130      LDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVC-GESCRVSWFWLGIKYQGERYS  186
                L GPCE WIDN +     +C  EFP     I  DYS C G+ C   ++WL +        
Sbjct  4470405  LQGPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLAL----HSPE  4470238

Query  187      WQVF  190
                WQ++
Sbjct  4470237  WQIY  4470226

 Score = 40.8 bits (94),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query  131      DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGI  178
                +GPCE WID+T      NC  +F      I  DYS C   C  +++WL +
Sbjct  1914745  EGPCEAWIDDTRIFHYDNCAAQFKSYPAKIPADYSSCKGDCLFAFYWLAL  1914596

 Score = 38.5 bits (88),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 31/62 (50%), Gaps = 7/62 (11%)
 Frame = -3

Query  329      GPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNG-SCTLYWYWLGVRYLKQVYSWQ  385
                GPCE W+D+  V  +D+C          +  DYS+C G  C   +YWL +   +    WQ
Sbjct  4470399  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLALHSPE----WQ  4470232

Query  386      VY  387
                +Y
Sbjct  4470231  IY  4470226

 Score = 38.5 bits (88),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 31/62 (50%), Gaps = 7/62 (11%)
 Frame = +2

Query  329      GPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNG-SCTLYWYWLGVRYLKQVYSWQ  385
                GPCE W+D+  V  +D+C          +  DYS+C G  C   +YWL +   +    WQ
Sbjct  4458299  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLALHSPE----WQ  4458466

Query  386      VY  387
                +Y
Sbjct  4458467  IY  4458472

>PLHA:NW_020188562.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1651, whole genome shotgun sequence
Length=1372582

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 82/177 (46%), Gaps = 24/177 (14%)
 Frame = +3

Query  234     AHQLVILPAPTYTVEGKDNRWKP---------LAFLEGQNFST--TDDFVGY---LDANG  279
               AH  + +P  T+  EG  N+  P         L   +G +++T    +   Y    +A+ 
Sbjct  929037  AHNQMTVPLATWP-EGFYNKNSPSGTIDAAAALPIPQGMSYTTDSASNVKAYWTAFNASK  929213

Query  280     FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI-MRSTGYTHDGPCEVWLDDT  338
               + +L+ F    +   +   A   CGF+  D  PQ +P+ +   +  Y+H GPCEVW DD 
Sbjct  929214  YKTLKEFAW--ATQKLEKGASNECGFSLVDGQPQELPEMVEWDAFSYSHMGPCEVWCDDK  929387

Query  339     RVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               RV Q+ NC    +     L Y  ++C G+  L  YW+ V  +     WQ+Y  C PI
Sbjct  929388  RVFQNWNCGVDYTETPAKLPYDKASCEGAAVLSCYWIAVHTV----PWQIYTNCAPI  929546

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 75/174 (43%), Gaps = 22/174 (13%)
 Frame = +2

Query  234     AHQLVILPAPTYTVEGKDNRWKP---------LAFLEGQNFST-----TDDFVGYLDANG  279
               AH  + +P  T+  EG  N+  P         L    G +++T     T  +    +A+ 
Sbjct  921233  AHNQMTVPVATWP-EGFYNKNSPSGTIDAAAALPIPSGMSYTTDQVSNTKAYWTAFNASK  921409

Query  280     FDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTR  339
               + +L+      +   +   A   CGF+  D  PQ +PD +    G+ H GPCEV  DD  
Sbjct  921410  YKTLKELAW--ATQKLEKGASKECGFSLVDGEPQELPDKVEWD-GFIHYGPCEVHCDDKL  921580

Query  340     VLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               V Q+ NC           D +AC G+  L  YW+G+        WQ+Y  C PI
Sbjct  921581  VFQNWNCAIDFKDGKLPYDKAACAGASVLTSYWIGL----HTTPWQIYTNCAPI  921730

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 71/169 (42%), Gaps = 16/169 (9%)
 Frame = -2

Query  32      SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
               +GL +GQ  L      V DGM Y   P   L  +    A EA  + + + +A     +  
Sbjct  906456  AGLIDGQKYLP-----VPDGMSYATDP--ELITKAYWIAFEASKYTSLKDFADQTMELQT  906298

Query  92      DGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
                  +        +CG +  N   + +P    ++  G +  GPCEIW D  LA   +NC  
Sbjct  906297  LPPFGKASP---ECGHSIVNGTARELPDKVKWLAFGLSHQGPCEIWCDKKLAFMDKNCAL  906127

Query  152     EFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                +P+    + Y   +C  +  +  +W+ +        WQ++ NC+ L +
Sbjct  906126  NYPQDPALLPYDIKICIGAKMMQAYWIAL----HGLPWQLYLNCVPLKS  905992

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 74/178 (42%), Gaps = 22/178 (12%)
 Frame = -2

Query  234     AHQLVILPAPTYTVE-------GKDNRWKPLAFLEGQNFSTTDDFVGY-----LDANGFD  281
               AH  +  P PT+ V        G  +  K L   +G +++T  + +        +A+ + 
Sbjct  906519  AHSYMSDPMPTWNVNFPSPSFAGLIDGQKYLPVPDGMSYATDPELITKAYWIAFEASKYT  906340

Query  282     SLRAFMDDD-SLYSVN--ASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDD  337
               SL+ F D    L ++     A   CG +  +   + +PD +   + G +H GPCE+W D 
Sbjct  906339  SLKDFADQTMELQTLPPFGKASPECGHSIVNGTARELPDKVKWLAFGLSHQGPCEIWCDK  906160

Query  338     TRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                      NC          L Y    C G+  +  YW+ +  L     WQ+Y  CVP+
Sbjct  906159  KLAFMDKNCALNYPQDPALLPYDIKICIGAKMMQAYWIALHGLP----WQLYLNCVPL  905998

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 70/178 (39%), Gaps = 25/178 (14%)
 Frame = +1

Query  233     MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDANGFDSLR-AF  286
               +   L I+ AP        +         G  FST      + F     ++ + S +   
Sbjct  904390  LTQPLAIMIAPDVDRSAYSSSIDANKLFPGGTFSTDPLINVESFKEKFKSSKYKSFKEMI  904569

Query  287     MDDDSLYSVNASADFRCGFTDPDAAPQPIPDG---------IMRSTGYTHDGPCEVWLDD  337
               MD+  L S  A+AD  CGFT  +       +          I +  G  H+G CE W ++
Sbjct  904570  MDNQVLVSKRATAD--CGFTTTEKVTYGSLNDTIYWGREFDITKGEGLVHEGVCESWCEN  904743

Query  338     TRVLQHDNC---HEVISGKT-YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                RV Q  NC   ++  SG +   +D + C  +  L +YW+ +        WQVY   V
Sbjct  904744  VRVQQDTNCMVTYKAASGSSPIPIDKAKCASAKRLTFYWIAMHGP----IWQVYSKLV  904905

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/93 (26%), Positives = 44/93 (47%), Gaps = 6/93 (6%)
 Frame = +2

Query  104     DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYS  163
               +CG +  + E Q +P    +   G+   GPCE+  D+ L     NC  +F +G    D +
Sbjct  921470  ECGFSLVDGEPQELPDKVEW--DGFIHYGPCEVHCDDKLVFQNWNCAIDFKDGKLPYDKA  921643

Query  164     VCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                C  +  ++ +W+G+        WQ++ NC  +
Sbjct  921644  ACAGASVLTSYWIGL----HTTPWQIYTNCAPI  921730

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 6/95 (6%)
 Frame = +3

Query  104     DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY-  162
               +CG +  + + Q +P    +    Y+  GPCE+W D+       NC  ++ E    + Y 
Sbjct  929274  ECGFSLVDGQPQELPEMVEWDAFSYSHMGPCEVWCDDKRVFQNWNCGVDYTETPAKLPYD  929453

Query  163     -SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                + C  +  +S +W+ +        WQ++ NC  +
Sbjct  929454  KASCEGAAVLSCYWIAV----HTVPWQIYTNCAPI  929546

>APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.11:1:1510989:1 
REF
Length=1510989

 Score = 56.2 bits (134),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 38/75 (51%), Gaps = 10/75 (13%)
 Frame = +3

Query  123     FITSGYTLDGPCEIWIDNTLALAGRNCHTEFPE---GHHTIDYSVCGESCRVSWFWLGIK  179
               F+TS     GPCEIW+DNT      NC   FPE       +D+S C  SC + ++WL + 
Sbjct  823074  FVTSS---QGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH  823244

Query  180     YQGERYSWQVFKNCI  194
                      WQV+  C+
Sbjct  823245  EDL----WQVYSTCL  823277

 Score = 34.3 bits (77),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 9/44 (20%)
 Frame = +2

Query  81      GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI  124
               G+ TLRA++D  G          DCG T  N   +PIPT+G  +
Sbjct  822893  GFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVV  822997

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = +3

Query  328     DGPCEVWLDDTRVLQHDNCHEVISGK---TYDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
                GPCE+WLD+TRV Q++NC      K      +D+S+C GSCT+ +YWL +        W
Sbjct  823089  QGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDLW  823256

Query  385     QVYKACVP  392
               QVY  C+P
Sbjct  823257  QVYSTCLP  823280

>PHSO:scaffold_8
Length=3549547

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query  267      TTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGY  325
                T + F     + G+DSL  F+  +    V++  D  CG T   D+A   +P   +  TG+
Sbjct  1238090  TLNFFKATFPSKGYDSLGEFIAKNQEL-VDSKTDADCGLTIYKDSARSELPASKLTHTGF  1238266

Query  326      THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYS  383
                TH GPCEVW DDT+VL   +C         T   D S C+G+  L  YWL +        
Sbjct  1238267  THTGPCEVWCDDTKVLFDYDCQTKYPAIPATLPYDESKCSGANRLTIYWLAL----HGDP  1238434

Query  384      WQVYKACV  391
                WQVY  CV
Sbjct  1238435  WQVYTDCV  1238458

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 14/128 (11%)
 Frame = +3

Query  272      VGYLDAN----GFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGY  325
                +G+  AN    G  SL AF+  +  LYS  +S D  CG T   ++A   +P   +  TG+
Sbjct  1240584  IGFFKANFPKKGGGSLGAFIAKNQKLYS--SSVDPNCGLTTYKESARSKLPSSQIEYTGF  1240757

Query  326      THDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYS  383
                TH GPCEVW DDT+VL   +C    +G    + Y  S C  +  L  YW+ +        
Sbjct  1240758  THPGPCEVWCDDTKVLFDYDCQTKFAGSPAKMAYDESKCANANRLTIYWVAMHGSP----  1240925

Query  384      WQVYKACV  391
                WQVY  CV
Sbjct  1240926  WQVYTDCV  1240949

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 66/128 (52%), Gaps = 15/128 (12%)
 Frame = +3

Query  233      MAHQLVILPAPT----YTVEG-----KDNRWKPL-AFLEGQNFSTTDDFV-GYLDANGFD  281
                + H  ++ PA T    Y V G       N W  +   + G   + T  F     +++G++
Sbjct  1236096  LGHGYIVDPAAT*KDGYAVNGWGSSIDSNMWGAIDNSVYGYGTAATVAFF*AQFNSSGYN  1236275

Query  282      SLRAFMDDDS-LYSVNASADFRCGFTDPDA-APQPIPDGIMRSTGYTHDGPCEVWLDDTR  339
                SL  F++ +  LYS +   D +CG+T  DA A Q +P   +  TG+TH GPCE+W DDT+
Sbjct  1236276  SLGQFIETNQVLYSDDI--DAQCGYTVYDASARQTMPSTNLTYTGFTHPGPCEIWCDDTK  1236449

Query  340      VLQHDNCH  347
                VL   NC 
Sbjct  1236450  VLFDYNCQ  1236473

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = +2

Query  104      DCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY  162
                DCGLT + ++    +P +     +G+T  GPCE+W D+T  L   +C T++P    T+ Y
Sbjct  1238192  DCGLTIYKDSARSELPAS-KLTHTGFTHTGPCEVWCDDTKVLFDYDCQTKYPAIPATLPY  1238368

Query  163      --SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                  S C  + R++ +WL +   G+   WQV+ +C+
Sbjct  1238369  DESKCSGANRLTIYWLAL--HGD--PWQVYTDCV  1238458

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 62/120 (52%), Gaps = 11/120 (9%)
 Frame = +3

Query  79       ERGYATLRALM-DDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEI  136
                ++G  +L A +  +  LYS + +   +CGLT +  +    +P++     +G+T  GPCE+
Sbjct  1240611  KKGGGSLGAFIAKNQKLYSSSVD--PNCGLTTYKESARSKLPSS-QIEYTGFTHPGPCEV  1240781

Query  137      WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                W D+T  L   +C T+F      + Y  S C  + R++ +W+ +        WQV+ +C+
Sbjct  1240782  WCDDTKVLFDYDCQTKFAGSPAKMAYDESKCANANRLTIYWVAM----HGSPWQVYTDCV  1240949

 Score = 40.0 bits (92),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 0/57 (0%)
 Frame = +3

Query  105      CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTID  161
                CG T  +   +    + +   +G+T  GPCEIW D+T  L   NC    P G  T +
Sbjct  1236336  CGYTVYDASARQTMPSTNLTYTGFTHPGPCEIWCDDTKVLFDYNCQASCPRGSRTTN  1236506

>PYIW:scaffold_3542 piw_scaffold_3542 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3542:1:2951:1 
REF
Length=2951

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 59/138 (43%), Gaps = 28/138 (20%)
 Frame = -3

Query  269   DDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY---  325
               F       G+ SL+  MD              CGF+  D A   +    M S  +   
Sbjct  1743  QQFTAAWSKTGYKSLKELMDKQVP---------GCGFSRTDIAAVDVSG--MSSMKFQNN  1597

Query  326   --------THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGV  375
                     +H GPCE W+D+T+V   D+C +   G      + Y+AC G+C L +YWL +
Sbjct  1596  EYKEGFLGSHHGPCEGWIDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLAL  1417

Query  376   RYLKQVYSWQVYKACVPI  393
                K    WQ YK CVPI
Sbjct  1416  HSQK----WQAYKHCVPI  1375

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 65/136 (48%), Gaps = 21/136 (15%)
 Frame = -3

Query  78    AERGYATLRALMDDDGL---YSVTEEGLFDCG----LTFPNTETQPIPTNGSFITSGYTL  130
             ++ GY +L+ LMD       +S T+    D      + F N E +       F+ S +  
Sbjct  1722  SKTGYKSLKELMDKQVPGCGFSRTDIAAVDVSGMSSMKFQNNEYKE-----GFLGSHH--  1564

Query  131   DGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
              GPCE WIDNT      +C   +P    +  + Y+ C  +CR++++WL +  Q     WQ
Sbjct  1563  -GPCEGWIDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLALHSQ----KWQ  1399

Query  189   VFKNCINLSASALVTM  204
              +K+C+ + A A  +M
Sbjct  1398  AYKHCVPIKAGAARSM  1351

>PHPA:scaffold_81 NW_008649067.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.81, whole genome shotgun 
sequence
Length=244838

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 57/107 (53%), Gaps = 18/107 (17%)
 Frame = +3

Query  295    VNASADFRCGFTDPDAAPQPIP-DGIM-----RSTGYTHDGPCEVWLDDTRVLQHDNCHE  348
              ++   D +CG T  + +P+PIP DG +     R  G+TH GPCE++LDD  VL  D+C E
Sbjct  87414  LDMVKDQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEE  87593

Query  349    --------VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                        SG    +D+S+CNG CTL  YWL      Q   WQ Y
Sbjct  87594  EYPGGSDGSSSGSEMPVDFSSCNGKCTLTIYWLAF----QNAQWQTY  87722

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 17/99 (17%)
 Frame = +3

Query  105    CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFP-----  154
              CG T  N   +PIP++G          G+T  GPCEI++D+ + L G +C  E+P     
Sbjct  87438  CGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGGSDG  87617

Query  155    ---EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                      +D+S C   C ++ +WL      +   WQ +
Sbjct  87618  SSSGSEMPVDFSSCNGKCTLTIYWLAF----QNAQWQTY  87722

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 7/62 (11%)
 Frame = -3

Query  329     GPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNG-SCTLYWYWLGVRYLKQVYSWQ  385
               GPCE W+DDT+V  +D+C          +  DYSAC G  C   +YWL +   K    WQ
Sbjct  134379  GPCEGWIDDTKVFHYDDCVAEFPSYPAKIPTDYSACKGDKCLFVFYWLALHSPK----WQ  134212

Query  386     VY  387
               +Y
Sbjct  134211  IY  134206

 Score = 43.9 bits (102),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 60/137 (44%), Gaps = 14/137 (10%)
 Frame = -1

Query  261     EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL---YSVNASADFRC-GFTDPDAAPQPIP  316
               +G     T  F  + +A G+ SLR   D  +    YSV  +      G+T+         
Sbjct  136415  DGSPSQNTQVFTEHWNAMGYKSLRDMTDPIATE*RYSVETATPVDVTGYTEMWWQNDEYM  136236

Query  317     DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVR  376
               +G + S    H+G CEV + +T+V  +DNC      K+Y       + S     YWL + 
Sbjct  136235  EGFIAS----HEGHCEV*IGETQVSHYDNCAARF--KSYPTKIPVVHSSRKSDCYWLALH  136074

Query  377     YLKQVYSWQVYKACVPI  393
                     +WQ+YK CVPI
Sbjct  136073  EP----NWQIYKQCVPI  136035

 Score = 42.7 bits (99),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 7/66 (11%)
 Frame = -3

Query  130     LDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVC-GESCRVSWFWLGIKYQGERYS  186
               L GPCE WID+T      +C  EFP     I  DYS C G+ C   ++WL +        
Sbjct  134385  LQGPCEGWIDDTKVFHYDDCVAEFPSYPAKIPTDYSACKGDKCLFVFYWLAL----HSPK  134218

Query  187     WQVFKN  192
               WQ++  
Sbjct  134217  WQIYST  134200

>PYVX:scaffold_305 pve_scaffold_305 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_305:1:30708:1 
REF
Length=30708

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 66/127 (52%), Gaps = 14/127 (11%)
 Frame = -1

Query  271    FVGYLDANGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHD  328
              F    +++G+DSL  F+  +  LYS  +S D  CG T   D+A   +P   +  +G+TH 
Sbjct  15759  FEAEFNSSGYDSLGQFIITNQVLYS--SSVDAECGMTVYKDSARSALPATNLTYSGFTHP  15586

Query  329    GPCEVWLDDTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
              GPCEVW DDT++L   NC     ++ +G  Y  D S C G+  L  YWL +        W
Sbjct  15585  GPCEVWCDDTKLLFDYNCQATYSDIPAGVPY--DESKCTGANRLTVYWLAL----HAAPW  15424

Query  385    QVYKACV  391
              Q Y  CV
Sbjct  15423  QAYIDCV  15403

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 44/93 (47%), Gaps = 5/93 (5%)
 Frame = -3

Query  300    DFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLD  358
              D  CG T   DA    +P      +G+TH GPCE W DD +V   ++C    +  T   +
Sbjct  10501  DAECGLTIYDDAKRSALPASKFTYSGFTHAGPCEFWCDDNKVAFDNDCQSTYADGTVPFE  10322

Query  359    YSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               + C G+  L  YW+GV        WQVY  CV
Sbjct  10321  AAQCEGANRLAVYWIGV----HGDPWQVYSDCV  10235

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 6/118 (5%)
 Frame = -1

Query  277    ANGFDSLRAFMDDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCEVWL  335
              ++G+DSL  F+  +   + + +AD +CG T   D+A   +P G +  +G+TH GPCE W 
Sbjct  13731  SSGYDSLGQFIIANQELASD-TADEQCGLTVYDDSARSTMPSGNLTYSGFTHQGPCEAWC  13555

Query  336    DDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              DD ++    +C       +   D S C  +     YWL +        WQ Y  CV I
Sbjct  13554  DDNKLFFEYDCSVSFPSGSMAYDSSLCTDANRFTIYWLALHGDP----WQAYIDCVWI  13393

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 4/90 (4%)
 Frame = -1

Query  105    CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSV  164
              CGLT  +   +    +G+   SG+T  GPCE W D+       +C   FP G    D S+
Sbjct  13656  CGLTVYDDSARSTMPSGNLTYSGFTHQGPCEAWCDDNKLFFEYDCSVSFPSGSMAYDSSL  13477

Query  165    CGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              C ++ R + +WL +   G+   WQ + +C+
Sbjct  13476  CTDANRFTIYWLAL--HGD--PWQAYIDCV  13399

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 61/124 (49%), Gaps = 7/124 (6%)
 Frame = -3

Query  74     QTWLAERGYATLRALMD-DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDG  132
              +T   + GYA+L  L+     LYS   +   +CGLT  +   +       F  SG+T  G
Sbjct  10582  ETLFPDSGYASLWDLIKAKQVLYSDDIDA--ECGLTIYDDAKRSALPASKFTYSGFTHAG  10409

Query  133    PCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
              PCE W D+       +C + + +G    + + C  + R++ +W+G+   G+   WQV+ +
Sbjct  10408  PCEFWCDDNKVAFDNDCQSTYADGTVPFEAAQCEGANRLAVYWIGV--HGD--PWQVYSD  10241

Query  193    CINL  196
              C+ L
Sbjct  10240  CVWL  10229

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 57/126 (45%), Gaps = 8/126 (6%)
 Frame = -1

Query  266    STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTG  324
              +T   F      +G+++L+ F+  +    V+++ D  CG T   DA    +PD     +G
Sbjct  12186  ATVKFFKAEFPESGYETLQDFILANQEL-VDSTIDKSCGMTIYDDAKRSALPDSAFSYSG  12010

Query  325    YTHDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
              +TH GPCE W DD +V    +C         +   D + C  +  L  YW+G+       
Sbjct  12009  FTHAGPCEFWCDDNKVAFDYDCQATYPDIPASVPFDSAQCANANKLTVYWIGLHGDP---  11839

Query  383    SWQVYK  388
               WQVY 
Sbjct  11838  -WQVYS  11824

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 60/118 (51%), Gaps = 11/118 (9%)
 Frame = -1

Query  81     GYATL-RALMDDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWI  138
              GY +L + ++ +  LYS + +   +CG+T + ++    +P   +   SG+T  GPCE+W 
Sbjct  15735  GYDSLGQFIITNQVLYSSSVDA--ECGMTVYKDSARSALPAT-NLTYSGFTHPGPCEVWC  15565

Query  139    DNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              D+T  L   NC   + +    + Y  S C  + R++ +WL +        WQ + +C+
Sbjct  15564  DDTKLLFDYNCQATYSDIPAGVPYDESKCTGANRLTVYWLAL----HAAPWQAYIDCV  15403

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 58/119 (49%), Gaps = 11/119 (9%)
 Frame = -1

Query  77     LAERGYATLR--ALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPC  134
                E GY TL+   L + + + S  ++    CG+T  +   +    + +F  SG+T  GPC
Sbjct  12159  FPESGYETLQDFILANQELVDSTIDKS---CGMTIYDDAKRSALPDSAFSYSGFTHAGPC  11989

Query  135    EIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFK  191
              E W D+       +C   +P+   ++  D + C  + +++ +W+G+   G+   WQV+ 
Sbjct  11988  EFWCDDNKVAFDYDCQATYPDIPASVPFDSAQCANANKLTVYWIGL--HGD--PWQVYS  11824

>PYAP:scaffold_23 pag1_scaffold_23 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_23:1:110862:1 
REF
Length=110862

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 11/129 (9%)
 Frame = -1

Query  271    FVGYLDANGFDSLRAFM---DDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMRSTG-Y  325
              F     A+ + +L+ F+    D S    N      CGFTDP++ P QP+P+ +    G  
Sbjct  10947  FARAFKASQYKTLKDFLLKNMDMSKGRSNMPKTRECGFTDPNSGPVQPLPNQLEWYGGQM  10768

Query  326    THDGPCEVWLDDTRVLQHD-NCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
               HDGPCEVW D+T V+    NC +      ++ + +AC G   L  YW+       +  W
Sbjct  10767  NHDGPCEVWCDNTVVIPFTANCAKTYPTGKFNYNKAACQGKKRLTMYWMST-----LMEW  10603

Query  385    QVYKACVPI  393
              QVY  C  I
Sbjct  10602  QVYIDCAKI  10576

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (48%), Gaps = 7/103 (7%)
 Frame = -1

Query  104    DCGLTFPNT-ETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTID  161
              +CG T PN+   QP+P    +       DGPCE+W DNT+ +    NC   +P G    +
Sbjct  10845  ECGFTDPNSGPVQPLPNQLEWYGGQMNHDGPCEVWCDNTVVIPFTANCAKTYPTGKFNYN  10666

Query  162    YSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
               + C    R++ +W+    +     WQV+ +C  +   A  +M
Sbjct  10665  KAACQGKKRLTMYWMSTLME-----WQVYIDCAKIGGGAARSM  10552

 Score = 39.3 bits (90),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
 Frame = -1

Query  295   VNASADFRCGFTDPDAAP-QPIPDGIMRSTG-YTHDGPCEVWLDDTRV  340
              N      CG TDP + P QP+PD +    G   HDGPCEV  DD  V
Sbjct  9117  TNMPRTLECGLTDPTSGPVQPLPDQLEWYGGKMNHDGPCEV*CDDEVV  8974

 Score = 30.0 bits (66),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 21/54 (39%), Gaps = 5/54 (9%)
 Frame = -2

Query  340   VLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              ++  NC        +  D + C G   L  YW+G      +  WQVY  C  I
Sbjct  8987  TMKSYNCAATFPDGKFKYDKAKCVGKKRLTMYWMGT-----LLQWQVYINCAKI  8841

 Score = 37.0 bits (84),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 24/49 (49%), Gaps = 5/49 (10%)
 Frame = -2

Query  148   NCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             NC   FP+G    D + C    R++ +W+G   Q     WQV+ NC  +
Sbjct  8972  NCAATFPDGKFKYDKAKCVGKKRLTMYWMGTLLQ-----WQVYINCAKI  8841

 Score = 30.4 bits (67),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (49%), Gaps = 1/47 (2%)
 Frame = -1

Query  103   FDCGLTFPNT-ETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRN  148
              +CGLT P +   QP+P    +       DGPCE+  D+ +    RN
Sbjct  9099  LECGLTDPTSGPVQPLPDQLEWYGGKMNHDGPCEV*CDDEVVQLCRN  8959

>PHCA:scaffold_49 PHYCAscaffold_49
Length=508508

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 58/131 (44%), Gaps = 17/131 (13%)
 Frame = +2

Query  271    FVGYLDANGFDSLRAFMDDDSLYSVNASADFR----CGFTDPDAAPQPIPDGIMRSTGYT  326
              F       G+ SLR  +D       N   D       G T  +        G + S    
Sbjct  24767  FTSSFPNTGYSSLRNMLDQQVSDCANTKTDVSPVDVSGLTVMNWQNDQEQKGFIDS----  24934

Query  327    HDGPCEVWLDDTRVLQHDNCHEVISGKTY----DLDYSACNGSCTLYWYWLGVRYLKQVY  382
              H GPCEVW+DDT V   D+C     G +Y      DYS C+G CTL +YWL +       
Sbjct  24935  HHGPCEVWIDDTMVDHQDDCVATY-GSSYPANVKADYSQCSGDCTLRFYWLALHEP----  25099

Query  383    SWQVYKACVPI  393
              +WQ+YK CVPI
Sbjct  25100  NWQIYKQCVPI  25132

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (45%), Gaps = 34/130 (26%)
 Frame = +2

Query  81     GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SFITSG  127
              GY++LR ++D         + + DC  T   T+  P+  +G              FI S 
Sbjct  24791  GYSSLRNMLD---------QQVSDCANT--KTDVSPVDVSGLTVMNWQNDQEQKGFIDSH  24937

Query  128    YTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKYQGER  184
              +   GPCE+WID+T+     +C   +   +      DYS C   C + ++WL +      
Sbjct  24938  H---GPCEVWIDDTMVDHQDDCVATYGSSYPANVKADYSQCSGDCTLRFYWLAL----HE  25096

Query  185    YSWQVFKNCI  194
               +WQ++K C+
Sbjct  25097  PNWQIYKQCV  25126

>PYIR:scaffold_2511 pir_scaffold_2511 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2511:1:2703:1 
REF
Length=2703

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 67/157 (43%), Gaps = 10/157 (6%)
 Frame = -3

Query  242   APTYTVEGKDNRWKPLAFLEGQNFSTTDD--FVGYLDANGFDSLRAFMDDDSLYSVNASA  299
             +P+ T++G      P     G +  +  +    G+     + SL+      ++  + A A
Sbjct  1930  SPSGTIDGPSTIPVPAGMSYGTDPQSNTNAYLAGFKAQTKYKSLKDLATSAAV-KLEAGA  1754

Query  300   DFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDDTRVLQHDNC--HEVISGKTYD  356
                CG++      QP+PD +       +H GPCEVW DD    + DNC  H   +     
Sbjct  1753  SKECGYSSVTGTAQPLPDTVQWDRFDSSHMGPCEVWCDDVLAFEDDNCSVHMTTTPAVLK  1574

Query  357   LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              D S C G   L  +W+ +     V +WQ+Y  C PI
Sbjct  1573  YDKSKCVGKKMLTSFWIAL----HVPTWQIYTNCAPI  1475

 Score = 44.3 bits (103),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 50/122 (41%), Gaps = 7/122 (6%)
 Frame = -3

Query  78    AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIW  137
             A+  Y +L+ L     +  +      +CG +      QP+P    +     +  GPCE+W
Sbjct  1822  AQTKYKSLKDLATSAAV-KLEAGASKECGYSSVTGTAQPLPDTVQWDRFDSSHMGPCEVW  1646

Query  138   IDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
              D+ LA    NC          + Y  S C     ++ FW+ +       +WQ++ NC  
Sbjct  1645  CDDVLAFEDDNCSVHMTTTPAVLKYDKSKCVGKKMLTSFWIALHVP----TWQIYTNCAP  1478

Query  196   LS  197
             ++
Sbjct  1477  IA  1472

>PYAP:scaffold_94 pag1_scaffold_94 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_94:1:69112:1 
REF
Length=69112

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 55/126 (44%), Gaps = 9/126 (7%)
 Frame = +1

Query  269    DDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM---RSTGY  325
              ++F     A+ + +L+  +D+  L          CGF+  +  PQP+PD +     S   
Sbjct  27016  EEFTKNFKASKYKTLKDLVDE--LSKPEGGTSKECGFSKEEGKPQPLPDKVEWEGFSGSP  27189

Query  326    THDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
              +H GPCEVW DD      DNC +  +      D + C G   L   WL +     V  WQ
Sbjct  27190  SHVGPCEVWCDDVLAFHDDNCVKNFADGKLPYDKAKCAGKKRLRSIWLAL----HVDKWQ  27357

Query  386    VYKACV  391
              VY  C 
Sbjct  27358  VYPYCA  27375

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 61/141 (43%), Gaps = 19/141 (13%)
 Frame = -3

Query  262    GQNFSTTDD-----FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAA-PQPI  315
              G  FS T D     F     + G+ SL +F+         A     CG +  D   PQ +
Sbjct  43394  GMKFSDTTDRNLAAFTQAFKSAGWSSLASFIKK------KAPGAGACGISRLDPKNPQAV  43233

Query  316    PDGIMRST-GYTHDGPCEVWLDDTRVLQHDNCHEV--ISGKTYDLDYSACNGSCTLYWYW  372
               D +  S    +H GPCEVW D TRV  HDNC      +     +  S C  +  L +YW
Sbjct  43232  GDYVQWSALADSHVGPCEVWCDSTRVFHHDNCAGAYRTAPAKLPIKKSKCTNAKQLTFYW  43053

Query  373    LGVRYLKQVYSWQVYKACVPI  393
              L +  +    +WQVY  CV +
Sbjct  43052  LALHEI----NWQVYINCVSL  43002

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 57/129 (44%), Gaps = 17/129 (13%)
 Frame = -1

Query  273   GYLDANGFDSLRAFMD----DDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHD  328
             GY  A GF SLR+ +D    D     ++  A    G T           G++ S    H 
Sbjct  5686  GYAKA-GFSSLRSILDLIVTDCGATRIDVPAVDVTGLTSMKFQNDEDKKGLIPS----HR  5522

Query  329   GPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSW  384
             GP E+W+D  R    D+C    +G      +DYS C    +C L +YWL +        W
Sbjct  5521  GPREIWIDSKRAFHGDDCAAEFTGYPAVLPVDYSLCPPQKTCILRFYWLAL----HESLW  5354

Query  385   QVYKACVPI  393
             QVYK CVPI
Sbjct  5353  QVYKQCVPI  5327

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 58/133 (44%), Gaps = 20/133 (15%)
 Frame = +2

Query  266    STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MR  321
              S T  +  ++  + F SL+  +       V       CG +     PQP+PD +      
Sbjct  50906  SNTKAYTAWIKTSEFKSLKDLI-------VKKGNVGECGISA-LGDPQPLPDQVEWAHSS  51061

Query  322    STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRY  377
              + G+T  H GPCEVW DD      DNC +  +     L Y  S C G+  L +YWL +  
Sbjct  51062  NEGFTPSHQGPCEVWCDDKMAFHDDNCAKDYTSAPAKLPYDKSKCVGAKKLTFYWLALHD  51241

Query  378    LKQVYSWQVYKAC  390
                   +WQ+Y  C
Sbjct  51242  P----NWQIYINC  51268

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 52/118 (44%), Gaps = 10/118 (8%)
 Frame = +1

Query  82     YATLRALMDDDGLYSVTEEGLF-DCGLTFPNTETQPIPTNGSF--ITSGYTLDGPCEIWI  138
              Y TL+ L+D+    S  E G   +CG +    + QP+P    +   +   +  GPCE+W 
Sbjct  27049  YKTLKDLVDE---LSKPEGGTSKECGFSKEEGKPQPLPDKVEWEGFSGSPSHVGPCEVWC  27219

Query  139    DNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              D+ LA    NC   F +G    D + C    R+   WL +        WQV+  C  L
Sbjct  27220  DDVLAFHDDNCVKNFADGKLPYDKAKCAGKKRLRSIWLALHVD----KWQVYPYCATL  27381

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 7/85 (8%)
 Frame = -2

Query  312    PQPIPDGIMRST-GYTHDGPCEVWLDDTRVLQHDNCHEV--ISGKTYDLDYSACNGSCTL  368
              PQ + D +  S    +H GPCEVW D+ RV Q+DNC      +     ++ + C  +  L
Sbjct  42159  PQIVGDYVQWSALADSHVGPCEVWCDNQRVFQNDNCAGAYRTAPAKLPINKAKCANAKQL  41980

Query  369    YWYWLGVRYLKQVYSWQVYKACVPI  393
               +YWL +  +    +WQVY  CV +
Sbjct  41979  TFYWLALHEI----NWQVYINCVSL  41917

 Score = 45.1 bits (105),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 32/125 (26%), Positives = 59/125 (47%), Gaps = 19/125 (15%)
 Frame = +2

Query  76     WLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTLD-  131
              W+    + +L+ L+   G  +V E G+   G      + QP+P    +  S   G+T   
Sbjct  50930  WIKTSEFKSLKDLIVKKG--NVGECGISALG------DPQPLPDQVEWAHSSNEGFTPSH  51085

Query  132    -GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQ  188
               GPCE+W D+ +A    NC  ++      + Y  S C  + +++++WL +       +WQ
Sbjct  51086  QGPCEVWCDDKMAFHDDNCAKDYTSAPAKLPYDKSKCVGAKKLTFYWLAL----HDPNWQ  51253

Query  189    VFKNC  193
              ++ NC
Sbjct  51254  IYINC  51268

 Score = 43.5 bits (101),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 6/71 (8%)
 Frame = -2

Query  132    GPCEIWIDNTLALAGRNCHTEF--PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
              GPCE+W DN       NC   +        I+ + C  + +++++WL +       +WQV
Sbjct  42105  GPCEVWCDNQRVFQNDNCAGAYRTAPAKLPINKAKCANAKQLTFYWLAL----HEINWQV  41938

Query  190    FKNCINLSASA  200
              + NC++L   A
Sbjct  41937  YINCVSLKGGA  41905

 Score = 42.7 bits (99),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 34/67 (51%), Gaps = 6/67 (9%)
 Frame = -3

Query  132    GPCEIWIDNTLALAGRNCHTEF--PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
              GPCE+W D+T      NC   +        I  S C  + +++++WL +       +WQV
Sbjct  43190  GPCEVWCDSTRVFHHDNCAGAYRTAPAKLPIKKSKCTNAKQLTFYWLAL----HEINWQV  43023

Query  190    FKNCINL  196
              + NC++L
Sbjct  43022  YINCVSL  43002

>PHRA:scaffold_123
Length=117378

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 7/71 (10%)
 Frame = +2

Query  326    THDGPCEVWLDDTRVLQHDNCHEVISG---KTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
              +H GPCEVW+DDT+V   D+C          +   D+S C+G CTL +YWL +       
Sbjct  24815  SHHGPCEVWIDDTKVDHQDDCVATYGSGYPASVSADFSKCSGDCTLRFYWLALHEPN---  24985

Query  383    SWQVYKACVPI  393
               WQVYK CVP+
Sbjct  24986  -WQVYKQCVPV  25015

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 59/130 (45%), Gaps = 34/130 (26%)
 Frame = +2

Query  81     GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SFITSG  127
              GY++LR ++D         + + DC  T   T+  P+  +G              FI S 
Sbjct  24674  GYSSLRDMLD---------QQVTDCANT--RTDVSPVDVSGLTVLNWQNDQEQKGFIDSH  24820

Query  128    YTLDGPCEIWIDNTLALAGRNCHTEFPEGHH---TIDYSVCGESCRVSWFWLGIKYQGER  184
              +   GPCE+WID+T      +C   +  G+    + D+S C   C + ++WL +      
Sbjct  24821  H---GPCEVWIDDTKVDHQDDCVATYGSGYPASVSADFSKCSGDCTLRFYWLAL----HE  24979

Query  185    YSWQVFKNCI  194
               +WQV+K C+
Sbjct  24980  PNWQVYKQCV  25009

>PYIR:scaffold_2176 pir_scaffold_2176 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2176:1:3569:1 
REF
Length=3569

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 55/112 (49%), Gaps = 10/112 (9%)
 Frame = -2

Query  282   SLRAFMDDDSLYSVNASADFR-----CGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLD  336
             SLR F+  +   SV A    +     CGF++P+ APQP+PD +     + H GPCEV+ D
Sbjct  2575  SLRDFILKNQDTSVQAEGAPKPLSAACGFSNPNGAPQPLPDKLQWEMNFEHPGPCEVYCD  2396

Query  337   DTRVLQH-DNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
             D  V+ +  +C    S      D + C G   L  Y+L V Y      WQVY
Sbjct  2395  DELVVPYTTDCWATFSDSILPYDKARCIGKKQLTLYFLAVHYP----PWQVY  2252

 Score = 35.8 bits (81),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (46%), Gaps = 6/87 (7%)
 Frame = -2

Query  105   CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTIDYS  163
             CG + PN   QP+P    +    +   GPCE++ D+ L +    +C   F +     D +
Sbjct  2497  CGFSNPNGAPQPLPDKLQW-EMNFEHPGPCEVYCDDELVVPYTTDCWATFSDSILPYDKA  2321

Query  164   VCGESCRVSWFWLGIKYQGERYSWQVF  190
              C    +++ ++L + Y      WQV+
Sbjct  2320  RCIGKKQLTLYFLAVHYP----PWQVY  2252

>PYAR:scaffold_674 par_scaffold_674 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_674:1:14611:1 
REF
Length=14611

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 8/94 (9%)
 Frame = -1

Query  302   RCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY  359
             +CG T+ +AA QP P DG++  +    H GPCE+WLDDT+V+   +C +    K   +D+
Sbjct  7543  KCGKTNANAAVQPAPSDGVVAFAISAQHIGPCEIWLDDTKVVSATDCWKQFPDKRIPVDF  7364

Query  360   SAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             S C    SC L W W+          W+ Y  CV
Sbjct  7363  SKCANKASCELRWIWMAT----HTSPWEFYDNCV  7274

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 17/126 (13%)
 Frame = -1

Query  87    ALMDDDGLYSVTEE--------GLFDCGLTFPNTETQPIPTNG--SFITSGYTLDGPCEI  136
             +L    G Y+ T+E        G   CG T  N   QP P++G  +F  S   + GPCEI
Sbjct  7618  SLPGPAGPYTGTDEVKSLLEKAGGSKCGKTNANAAVQPAPSDGVVAFAISAQHI-GPCEI  7442

Query  137   WIDNTLALAGRNCHTEFPEGHHTIDYSVCGE--SCRVSWFWLGIKYQGERYSWQVFKNCI  194
             W+D+T  ++  +C  +FP+    +D+S C    SC + W W+          W+ + NC+
Sbjct  7441  WLDDTKVVSATDCWKQFPDKRIPVDFSKCANKASCELRWIWMAT----HTSPWEFYDNCV  7274

Query  195   NLSASA  200
              +   A
Sbjct  7273  RVGTGA  7256

>PYAR:scaffold_505 par_scaffold_505 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_505:1:17100:1 
REF
Length=17100

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 78/180 (43%), Gaps = 25/180 (14%)
 Frame = +2

Query  234  AHQLVILPAPTY--TVEGKDNRWK---------PLAFLEGQNF-----STTDDFVGYLDA  277
            AH  + LPAPT+  + + K N W          P A   G             F      
Sbjct  23   AHGRLGLPAPTFIASAQSKPNYWAYGVYAAKNPPAASYAGSQSEPDLKKREQTFDTNFKK  202

Query  278  NGFDSLRAFMDDDSL---YSVNASADF-RCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCE  332
            NGF SL+ ++ ++ +   Y    S     CG+TDP+   QP+P  +   S  + H GPCE
Sbjct  203  NGFTSLKKWIMENQVVGKYDGRPSGGTPECGYTDPNGKEQPLPPQLKWPSPTFQHPGPCE  382

Query  333  VWLDDTRVLQHD-NCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             W DD  V+ +  +C+        D D + C G   L +Y+L V   +    +QVY +CV
Sbjct  383  AWCDDEVVIPYQASCNAYAKQGLMDYDKAKCVGKKMLSFYYLAVHVAE---PFQVYASCV  553

 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 4/100 (4%)
 Frame = +2

Query  101  GLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR-NCHTEFPEGHHT  159
            G  +CG T PN + QP+P    + +  +   GPCE W D+ + +  + +C+    +G   
Sbjct  278  GTPECGYTDPNGKEQPLPPQLKWPSPTFQHPGPCEAWCDDEVVIPYQASCNAYAKQGLMD  457

Query  160  IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
             D + C     +S+++L +        +QV+ +C+ L  +
Sbjct  458  YDKAKCVGKKMLSFYYLAVHVA---EPFQVYASCVRLQGA  568

>PYIR:scaffold_1332 pir_scaffold_1332 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1332:1:8114:1 
REF
Length=8114

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 66/146 (45%), Gaps = 19/146 (13%)
 Frame = +3

Query  257   LAFLEGQNFSTTDDFVGYLDANGFD--------SLRAFM--DDDSLYSVNASADFRCGFT  306
             L    G +FS   D     +A  FD        SL+ F+  + ++  + + +    CGF+
Sbjct  6828  LTVPAGMSFSAGPD----TNAEAFDTAFKKTGQSLKDFILKNQNTAGATSPTLSAACGFS  6995

Query  307   DPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHD-NCHEVISGKTYDLDYSACNGS  365
             DP   PQ +PD +   + + H GPCE W D+  V+ +  NC +  +  +     + C G 
Sbjct  6996  DPAGTPQALPDKLQWGSSFIHPGPCEAWCDNEIVVPYTANCWKTFADGSVPYSKAKCAGK  7175

Query  366   CTLYWYWLGVRYLKQVYSWQVYKACV  391
               L +YWL +        WQVY  CV
Sbjct  7176  KQLTFYWLALHSPP----WQVYINCV  7241

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 67/146 (46%), Gaps = 13/146 (9%)
 Frame = +1

Query  240   LPAPTYTVEGKD-NRWKPLAFLE---GQNF-----STTDDFVGYLDANGFDSLRAFM--D  288
             LPAPT++  G   +   P + L+   G +F     S  + F     A    SL+ F+  +
Sbjct  4792  LPAPTFSGYGGGFSAVIPSSVLKEPSGMHFNWGPDSNAEAFDTAFKAAKESSLKDFILKN  4971

Query  289   DDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTG-YTHDGPCEVWLDDTRVLQHD-NC  346
              D+  +        CG+++P   PQ +P  I  + G + H GPCE W DD  V+ +  NC
Sbjct  4972  QDTTQASGTILSKECGYSNPAGTPQALPAEIQWAGGNFIHPGPCEAWCDDEIVVPYTANC  5151

Query  347   HEVISGKTYDLDYSACNGSCTLYWYW  372
              +  S      + + C+G   L +YW
Sbjct  5152  WKTFSTGMVPYEKAKCSGKKQLTFYW  5229

 Score = 42.4 bits (98),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 33/70 (47%), Gaps = 5/70 (7%)
 Frame = +3

Query  126   SGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGER  184
             S +   GPCE W DN + +    NC   F +G      + C    +++++WL +      
Sbjct  7044  SSFIHPGPCEAWCDNEIVVPYTANCWKTFADGSVPYSKAKCAGKKQLTFYWLAL----HS  7211

Query  185   YSWQVFKNCI  194
               WQV+ NC+
Sbjct  7212  PPWQVYINCV  7241

 Score = 33.9 bits (76),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 32/73 (44%), Gaps = 1/73 (1%)
 Frame = +1

Query  104   DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTIDY  162
             +CG + P    Q +P    +    +   GPCE W D+ + +    NC   F  G    + 
Sbjct  5011  ECGYSNPAGTPQALPAEIQWAGGNFIHPGPCEAWCDDEIVVPYTANCWKTFSTGMVPYEK  5190

Query  163   SVCGESCRVSWFW  175
             + C    +++++W
Sbjct  5191  AKCSGKKQLTFYW  5229

>PHCA:scaffold_11 PHYCAscaffold_11
Length=1076090

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 23/175 (13%)
 Frame = -2

Query  233     MAHQLVILPAPT----YTVEG-----KDNRWKPL-AFLEGQNFSTTDDFVGY-LDANGFD  281
               + H  +  PA T    Y V G       N W  +   + G   S T  F     +A+G++
Sbjct  651670  LGHGYITNPAATWMDGYAVNGWGSSIDSNMWGAIDNSVYGYGTSATVAFFEVEFNASGYN  651491

Query  282     SLRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMRSTGYTHDGPCEVWLDDTRV  340
               SL  F++ + +   +   D +CG+T  DA+  Q +P   +  TG+TH GPCE+W DDT+V
Sbjct  651490  SLGQFIETNQVLYCD-DVDEQCGYTVYDASGRQTMPTTNLTHTGFTHPGPCEIWCDDTKV  651314

Query  341     LQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               L   NC     ++ +G  YD   S C  +     YWL V        WQVY  CV
Sbjct  651313  LFDYNCQATYPDIPAGIPYDE--SLCADANRFTIYWLAVHGAP----WQVYTDCV  651167

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 58/121 (48%), Gaps = 10/121 (8%)
 Frame = -2

Query  275     LDANGFDSLRAFMDDD-SLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCE  332
               L   G  SL+A +  +  LY  N   D  CG T   D+A   +P   +  TG+TH GPCE
Sbjct  685054  LSTTGGGSLKALISKNQKLY--NDKVDPECGLTAFKDSARSKLPASQLEFTGFTHPGPCE  684881

Query  333     VWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               VW DDT+VL   NC          + Y  S C+G+  L  +W+ V        WQVY  C
Sbjct  684880  VWCDDTKVLFDYNCQAKYPDIPAKIPYDESKCSGANRLTIHWIAV----HGEPWQVYTDC  684713

Query  391     V  391
               V
Sbjct  684712  V  684710

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 58/118 (49%), Gaps = 10/118 (8%)
 Frame = -1

Query  278     NGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCEVWL  335
                G+DSL AF+  +  LYS     D  CG T   D+A   +P   +  +G+TH GPCEVW 
Sbjct  649562  KGYDSLGAFIAKNQELYSSKTDPD--CGLTVYKDSARSKLPASELEYSGFTHTGPCEVWC  649389

Query  336     DDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
               DDT+VL   +C          L Y  S C  +  L  YW+G+        WQVY  CV
Sbjct  649388  DDTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGLHGDP----WQVYTDCV  649227

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 58/121 (48%), Gaps = 10/121 (8%)
 Frame = +1

Query  275     LDANGFDSLRAFMDDD-SLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCE  332
               L   G  SL+A +  +  LY  N   D  CG T   D+A   +P   +  TG+TH GPCE
Sbjct  647851  LPTTGGGSLKALISKNQKLY--NDKVDPECGLTAFKDSARSKLPASQLEFTGFTHPGPCE  648024

Query  333     VWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               VW DDT+VL   +C          + Y  S C+G+  L  +W+ V        WQVY  C
Sbjct  648025  VWCDDTKVLFDYDCQAKYPDIPAKIPYDESKCSGANRLTIHWVAV----HGEPWQVYTDC  648192

Query  391     V  391
               V
Sbjct  648193  V  648195

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 65/119 (55%), Gaps = 11/119 (9%)
 Frame = -1

Query  80      RGYATLRALM-DDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIW  137
               +GY +L A +  +  LYS   +   DCGLT + ++    +P +     SG+T  GPCE+W
Sbjct  649562  KGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPAS-ELEYSGFTHTGPCEVW  649392

Query  138     IDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                D+T  L   +C T++P     + Y  S C  + R++ +W+G+   G+   WQV+ +C+
Sbjct  649391  CDDTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGL--HGD--PWQVYTDCV  649227

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = -2

Query  77      LAERGYATLRALMDDD-GLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPC  134
               L+  G  +L+AL+  +  LY+   +   +CGLT F ++    +P +     +G+T  GPC
Sbjct  685054  LSTTGGGSLKALISKNQKLYNDKVD--PECGLTAFKDSARSKLPAS-QLEFTGFTHPGPC  684884

Query  135     EIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
               E+W D+T  L   NC  ++P+    I Y  S C  + R++  W+ +   GE   WQV+ +
Sbjct  684883  EVWCDDTKVLFDYNCQAKYPDIPAKIPYDESKCSGANRLTIHWIAV--HGE--PWQVYTD  684716

Query  193     CINLSASA  200
               C+ L   +
Sbjct  684715  CVYLEGGS  684692

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 15/109 (14%)
 Frame = -2

Query  105     CGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY-  162
               CG T +  +  Q +PT  +   +G+T  GPCEIW D+T  L   NC   +P+    I Y 
Sbjct  651430  CGYTVYDASGRQTMPTT-NLTHTGFTHPGPCEIWCDDTKVLFDYNCQATYPDIPAGIPYD  651254

Query  163     -SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL-------SASALVT  203
                S+C ++ R + +WL +        WQV+ +C+ L       SA +LVT
Sbjct  651253  ESLCADANRFTIYWLAVH----GAPWQVYTDCVWLETGSSSGSAPSLVT  651119

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = +1

Query  77      LAERGYATLRALMDDD-GLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPC  134
               L   G  +L+AL+  +  LY+  ++   +CGLT F ++    +P +    T G+T  GPC
Sbjct  647851  LPTTGGGSLKALISKNQKLYN--DKVDPECGLTAFKDSARSKLPASQLEFT-GFTHPGPC  648021

Query  135     EIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
               E+W D+T  L   +C  ++P+    I Y  S C  + R++  W+ +   GE   WQV+ +
Sbjct  648022  EVWCDDTKVLFDYDCQAKYPDIPAKIPYDESKCSGANRLTIHWVAV--HGE--PWQVYTD  648189

Query  193     CINLSASA  200
               C+ L   +
Sbjct  648190  CVYLEGGS  648213

>PYAR:scaffold_4887 par_scaffold_4887 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4887:1:1921:1 
REF
Length=1921

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 74/177 (42%), Gaps = 26/177 (15%)
 Frame = -1

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY---LDANGFDSLRAFMDDD  290
            AH  +  P P   +        P  F++G N     D + +    D N     +AF    
Sbjct  799  AHSRMTAPKPNSEISDS-----PSGFIDGPNTLKVPDGMHFDWNYDQNQAAYQKAFESQT  635

Query  291  SLYSV----------NASADFRCGFTDPDAAPQPIPDGIMRSTGYT--HDGPCEVWLDDT  338
               ++          N ++   CGF+     PQ +PD +  +TG++  H GPCEVW D+T
Sbjct  634  KYKTLRDLVYDKFVPNGASTKECGFSAMTGTPQSLPDYVEYATGFSESHWGPCEVWCDNT  455

Query  339  RVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            RV    NC      +   L Y  + C G+  L  +WL +   K    WQVY AC  +
Sbjct  454  RVFVDPNCRISYPTRPAKLPYDMAKCIGAKRLQTFWLALHEPK----WQVYTACATL  296

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 69/165 (42%), Gaps = 20/165 (12%)
 Frame = -1

Query  43   PPPFFVVDGMDYRGSPVAYLEQQGVH-TAIEAQTWLAERGYATLRALMDDDGLYSVTEEG  101
            P    V DGM +  +   Y + Q  +  A E+QT      Y TLR L+ D   +      
Sbjct  727  PNTLKVPDGMHFDWN---YDQNQAAYQKAFESQT-----KYKTLRDLVYDK--FVPNGAS  578

Query  102  LFDCGLTFPNTETQPIPTNGSFITSGYTLD--GPCEIWIDNTLALAGRNCHTEFPEGHHT  159
              +CG +      Q +P    + T G++    GPCE+W DNT      NC   +P     
Sbjct  577  TKECGFSAMTGTPQSLPDYVEYAT-GFSESHWGPCEVWCDNTRVFVDPNCRISYPTRPAK  401

Query  160  IDYSV--CGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
            + Y +  C  + R+  FWL +        WQV+  C  L+   ++
Sbjct  400  LPYDMAKCIGAKRLQTFWLAL----HEPKWQVYTACATLNGRRML  278

>PYIR:scaffold_277 pir_scaffold_277 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_277:1:34862:1 
REF
Length=34862

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 7/103 (7%)
 Frame = +1

Query  104   DCGLTFPNTET-QPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTID  161
             +CG T P+ +T QP+P N  +   G    GPCE W DN + L    NC   FP+G    D
Sbjct  931   ECGFTAPDKQTAQPLPDNIEWYGGGQNHPGPCEAWCDNEIVLPFTANCQAAFPKGIMAYD  1110

Query  162   YSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
              + C    R+S++W+    Q     WQV+ +C+ +   A V  
Sbjct  1111  KAKCVGKNRLSFYWMATLNQ-----WQVYIDCVKIGNGAAVAF  1224

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 65/167 (39%), Gaps = 25/167 (15%)
 Frame = +1

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFM--DDDS  291
             A  +  +PA    V G  N W              D F      + + SLR F   + D 
Sbjct  754   AIPMSAMPAVAPDVYGPSNSW-------------ADVFGNAFKKSKYKSLREFFMKNQDM  894

Query  292   LYSVNAS--ADFRCGFTDPDA-APQPIPDGIM-RSTGYTHDGPCEVWLDDTRVLQHD-NC  346
                V +   +   CGFT PD    QP+PD I     G  H GPCE W D+  VL    NC
Sbjct  895   SQGVKSGNPSTAECGFTAPDKQTAQPLPDNIEWYGGGQNHPGPCEAWCDNEIVLPFTANC  1074

Query  347   HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                        D + C G   L +YW+    L Q   WQVY  CV I
Sbjct  1075  QAAFPKGIMAYDKAKCVGKNRLSFYWMAT--LNQ---WQVYIDCVKI  1200

>PHIF:NW_003303743.1 Phytophthora infestans T30-4 supercont1.16 
genomic scaffold, whole genome shotgun sequence
Length=3114892

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 78/153 (51%), Gaps = 19/153 (12%)
 Frame = -1

Query  46       FFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALM-DDDGLYSVTEEGLFD  104
                F  +DG  Y   P       G    I+A   LA +G  +L AL+  +  LYS   E   D
Sbjct  1481407  FGEIDGGKYGYGP------NGAINIIKAN--LATKGGGSLGALIAKNQKLYS--SEVDPD  1481258

Query  105      CGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--D  161
                CGLT F ++    +P +     +G+T  GPCE+W D+T  L   +C T+FP     I  D
Sbjct  1481257  CGLTTFKDSARSKLPAS-QLEYTGFTHPGPCEVWCDDTKVLFDYDCQTKFPGSPSKIPFD  1481081

Query  162      YSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                 S C ++ R++ +WL +   GE+  WQV+ +C+
Sbjct  1481080  ESKCAKANRLTIYWLAV--HGEQ--WQVYSDCV  1480994

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 57/121 (47%), Gaps = 10/121 (8%)
 Frame = -1

Query  275      LDANGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCE  332
                L   G  SL A +  +  LYS     D  CG T   D+A   +P   +  TG+TH GPCE
Sbjct  1481338  LATKGGGSLGALIAKNQKLYSSEVDPD--CGLTTFKDSARSKLPASQLEYTGFTHPGPCE  1481165

Query  333      VWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
                VW DDT+VL   +C     G    +  D S C  +  L  YWL V   +    WQVY  C
Sbjct  1481164  VWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVHGEQ----WQVYSDC  1480997

Query  391      V  391
                V
Sbjct  1480996  V  1480994

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 59/129 (46%), Gaps = 10/129 (8%)
 Frame = -3

Query  267      TTDDFVGYLDANGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTG  324
                T + F       G+ SL AF+  +  LYS     D  CG T   D+A   +P   +  TG
Sbjct  1519631  TLNFFKATFPTKGYKSLGAFIAKNQELYSSKTDPD--CGLTVYKDSARSKLPASQLEHTG  1519458

Query  325      YTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
                +TH GPCEVW DDT+VL   +C    S     + Y  + C  +  L  YWL +       
Sbjct  1519457  FTHTGPCEVWCDDTKVLSDYDCQTKYSAIPAKIPYDEAKCAKANRLTIYWLAL----HGD  1519290

Query  383      SWQVYKACV  391
                 WQ Y  CV
Sbjct  1519289  PWQEYTDCV  1519263

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 13/119 (11%)
 Frame = -1

Query  278      NGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCEVWL  335
                 G+DSL  F+  +  LYS +   D  CG+T   D+A   +P   +  TG+TH GPCE+W 
Sbjct  1541395  KGYDSLGQFIAKNQELYSSDIDPD--CGWTVYKDSARSALPT-QLEYTGFTHPGPCEIWC  1541225

Query  336      DDTRVLQHDNC---HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
                DDT++L   +C   +  I  K    D S C  +  L  +W+G+        WQ+Y  CV
Sbjct  1541224  DDTKLLFDYDCWTKYPAIPAKI-PYDKSKCANANRLTIFWIGIHGTP----WQIYTDCV  1541063

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = -1

Query  104      DCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY  162
                DCG T + ++    +PT   +  +G+T  GPCEIW D+T  L   +C T++P     I Y
Sbjct  1541326  DCGWTVYKDSARSALPTQLEY--TGFTHPGPCEIWCDDTKLLFDYDCWTKYPAIPAKIPY  1541153

Query  163      --SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                  S C  + R++ FW+GI        WQ++ +C+ L   +
Sbjct  1541152  DKSKCANANRLTIFWIGI----HGTPWQIYTDCVWLKGGS  1541045

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 64/119 (54%), Gaps = 11/119 (9%)
 Frame = -3

Query  80       RGYATLRALM-DDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIW  137
                +GY +L A +  +  LYS   +   DCGLT + ++    +P +     +G+T  GPCE+W
Sbjct  1519598  KGYKSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPAS-QLEHTGFTHTGPCEVW  1519428

Query  138      IDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                 D+T  L+  +C T++      I Y  + C ++ R++ +WL +   G+   WQ + +C+
Sbjct  1519427  CDDTKVLSDYDCQTKYSAIPAKIPYDEAKCAKANRLTIYWLAL--HGD--PWQEYTDCV  1519263

>PHRA:scaffold_51
Length=360848

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 66/127 (52%), Gaps = 14/127 (11%)
 Frame = -3

Query  271    FVGYLDANGFDSLRAFMDDDS-LYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHD  328
              F    +++G++SL  F++ +  LYS N   D +CG+T   D A Q +P   +  TG+TH 
Sbjct  40461  FEAQFNSSGYNSLGQFIETNQVLYSDNI--DEQCGYTVYDDTARQTMPATNLTHTGFTHP  40288

Query  329    GPCEVWLDDTRVLQHDNCH----EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
              GPCEVW DDT VL   +C     ++ +G  Y  D S C  +     YWL V        W
Sbjct  40287  GPCEVWCDDTVVLFEYDCQATYPDIPAGIPY--DESLCADANRFTIYWLAVHGAP----W  40126

Query  385    QVYKACV  391
              QVY  CV
Sbjct  40125  QVYTDCV  40105

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 58/118 (49%), Gaps = 10/118 (8%)
 Frame = -2

Query  278    NGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCEVWL  335
               G+DSL AF+  +  LYS     D  CG T   D+A   +P   +  +G+TH GPCEVW 
Sbjct  38695  KGYDSLGAFIAKNQELYSSKTDPD--CGLTVYKDSARSELPASKLTYSGFTHTGPCEVWC  38522

Query  336    DDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
              DDT+VL   +C         T   D S C  +  L  YW+G+        WQVY  CV
Sbjct  38521  DDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLHGDP----WQVYTDCV  38360

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 68/120 (57%), Gaps = 11/120 (9%)
 Frame = -2

Query  79     ERGYATLRALM-DDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEI  136
              ++GY +L A +  +  LYS   +   DCGLT + ++    +P +     SG+T  GPCE+
Sbjct  38698  DKGYDSLGAFIAKNQELYSSKTD--PDCGLTVYKDSARSELPAS-KLTYSGFTHTGPCEV  38528

Query  137    WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
              W D+T  L   +C T++P    TI Y  S C ++ R++ +W+G+   G+   WQV+ +C+
Sbjct  38527  WCDDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGL--HGD--PWQVYTDCV  38360

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 8/95 (8%)
 Frame = -3

Query  105    CGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY-  162
              CG T + +T  Q +P   +   +G+T  GPCE+W D+T+ L   +C   +P+    I Y 
Sbjct  40368  CGYTVYDDTARQTMPAT-NLTHTGFTHPGPCEVWCDDTVVLFEYDCQATYPDIPAGIPYD  40192

Query  163    -SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               S+C ++ R + +WL +        WQV+ +C+ L
Sbjct  40191  ESLCADANRFTIYWLAVH----GAPWQVYTDCVWL  40099

>PYAP:scaffold_74 pag1_scaffold_74 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_74:1:72664:1 
REF
Length=72664

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 7/71 (10%)
 Frame = -3

Query  326   THDGPCEVWLDDTRVLQHDNCHEVISGK---TYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
             +H GPCEVW+DD +V   D+C     G+   +  +D+S C G C L +YW+ +   +   
Sbjct  2375  SHHGPCEVWIDDNKVFHDDDCSAKFDGQFPASIPVDFSKCKGKCELTFYWIALHQAQ---  2205

Query  383   SWQVYKACVPI  393
              WQ+YK C PI
Sbjct  2204  -WQLYKQCAPI  2175

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 40/71 (56%), Gaps = 7/71 (10%)
 Frame = -2

Query  326   THDGPCEVWLDDTRVLQHD-NCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVY  382
             +H GPCEVW+D+  V Q   +C    +G   +L  DYS C G C L +YWL +       
Sbjct  3741  SHTGPCEVWIDNKMVFQETGDCVAKFTGYPAELPVDYSVCKGKCQLTFYWLALHEP----  3574

Query  383   SWQVYKACVPI  393
             +WQVYK C PI
Sbjct  3573  NWQVYKQCAPI  3541

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 51/105 (49%), Gaps = 20/105 (19%)
 Frame = -3

Query  303  CGFTDPDAAPQPIPDGIMRSTGY-----------THDGPCEVWLDDTRVLQHD-NCHEVI  350
            CG T  D AP  +    M+S  +           +H GPCEVW+D+  V Q   +C    
Sbjct  959  CGNTLMDGAPVDVSG--MKSVKWANDQERVGFIKSHTGPCEVWIDNKMVFQETGDCVAKF  786

Query  351  SGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            +G   +L  DYS C G C L +YWL +       +WQVYK C PI
Sbjct  785  TGYPAELPVDYSVCKGKCQLTFYWLALHEP----NWQVYKQCAPI  663

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 34/133 (26%)
 Frame = -2

Query  77    LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SF  123
               +  Y +++ +MD           + DCG T   T+ +P+  +G              F
Sbjct  3894  FKQSSYKSIKEMMD---------PVVADCGNTL--TDGEPVDVSGMKSVKWANDQERVGF  3748

Query  124   ITSGYTLDGPCEIWIDNTLALAGR-NCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKY  180
             + S     GPCE+WIDN +      +C  +F        +DYSVC   C+++++WL +  
Sbjct  3747  VKSH---TGPCEVWIDNKMVFQETGDCVAKFTGYPAELPVDYSVCKGKCQLTFYWLAL--  3583

Query  181   QGERYSWQVFKNC  193
                  +WQV+K C
Sbjct  3582  --HEPNWQVYKQC  3550

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 7/65 (11%)
 Frame = -3

Query  132  GPCEIWIDNTLALAGR-NCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
            GPCE+WIDN +      +C  +F        +DYSVC   C+++++WL +       +WQ
Sbjct  854  GPCEVWIDNKMVFQETGDCVAKFTGYPAELPVDYSVCKGKCQLTFYWLAL----HEPNWQ  687

Query  189  VFKNC  193
            V+K C
Sbjct  686  VYKQC  672

 Score = 44.7 bits (104),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 28/117 (24%), Positives = 51/117 (44%), Gaps = 27/117 (23%)
 Frame = -3

Query  94    LYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SFITSGYTLDGPCEIWIDN  140
             +  +    + DCG T    +  PI  +G              F+ S +   GPCE+WID+
Sbjct  2504  IKEIVNSEVKDCGNTL--MDGDPIDVSGMKEVKWQNDYEKIGFVKSHH---GPCEVWIDD  2340

Query  141   TLALAGRNCHTEFPEGHH----TIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
                    +C  +F +G       +D+S C   C ++++W+ +     +  WQ++K C
Sbjct  2339  NKVFHDDDCSAKF-DGQFPASIPVDFSKCKGKCELTFYWIAL----HQAQWQLYKQC  2184

>PYAP:scaffold_793 pag1_scaffold_793 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_793:1:13419:1 
REF
Length=13419

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 71/160 (44%), Gaps = 9/160 (6%)
 Frame = +3

Query  234   AHQLVILPAPTYTV--EGKDNRWKP--LAFLEGQNFSTT-DDFVGYLDANGFDSLRAFMD  288
             AH  ++LP PTY     G  +   P  L F   Q+F    D+ +     +  D +  + +
Sbjct  2751  AHGELMLPRPTYPKWGGGVTSTISPSVLPFAWRQDFPQAFDEAITKTGLSLKDFIMKYQN  2930

Query  289   DDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQH-DNCH  347
                     ++ +  CG++DP   PQP+P+ I   TG+ H GPCE + D+  V +H  +C 
Sbjct  2931  MSGASDTGSTPE--CGYSDPKGTPQPLPEKIQFHTGFMHWGPCEAYCDNVLVTKHAADCK  3104

Query  348   EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
                 G     D + C G     +YWLG+        WQ Y
Sbjct  3105  VAYPGGAVPYDKAKCAGKKQFKFYWLGMDSGNSA-PWQAY  3221

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 69/172 (40%), Gaps = 36/172 (21%)
 Frame = +1

Query  234   AHQLVILPAPTYTVEGKDNR-----------WK---PLAFLEG---QNFSTTDDFVGYLD  276
             AH  ++LP PTY   G               W+   P AF E       S  D  + Y +
Sbjct  913   AHGELMLPRPTYPKWGGGVAATIAPSVMPFPWRQDYPQAFDEAFKKTGLSLKDFILKYQN  1092

Query  277   ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLD  336
              +G              + +  +  +CG++DP   PQP+P+ I   TG+ H GPCE + D
Sbjct  1093  TSG--------------ASDTGSSAQCGYSDPKGTPQPLPEKIQFHTGFIHWGPCEAYCD  1230

Query  337   DTRVLQHD-NCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
             D  V +H  +C           D + C G     ++WL +        WQVY
Sbjct  1231  DVLVTKHTADCRAAYPAGAVPYDKAKCAGKKQFTFWWLTM----DGSPWQVY  1374

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = +3

Query  104   DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTIDY  162
             +CG + P    QP+P    F T G+   GPCE + DN L      +C   +P G    D 
Sbjct  2964  ECGYSDPKGTPQPLPEKIQFHT-GFMHWGPCEAYCDNVLVTKHAADCKVAYPGGAVPYDK  3140

Query  163   SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
             + C    +  ++WLG+   G    WQ +      S
Sbjct  3141  AKCAGKKQFKFYWLGMD-SGNSAPWQAYGKSFAFS  3242

>HYAP:scaffold_463 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_463:1:12715:1 
REF
Length=12715

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 7/71 (10%)
 Frame = -1

Query  326   THDGPCEVWLDDTRVLQHDNCHEVISG---KTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
             +H GPCE W+DDT V + D+C          + + D+S C+G CTL +YWL +  +    
Sbjct  7642  SHHGPCETWIDDTMVDRQDDCVATYGTGFPASVNADFSRCSGVCTLRFYWLALHEV----  7475

Query  383   SWQVYKACVPI  393
             +WQVYK CVPI
Sbjct  7474  NWQVYKQCVPI  7442

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 60/129 (47%), Gaps = 18/129 (14%)
 Frame = -1

Query  74    QTWLAERGYATLRALMDDDG---LYSVTEEGLFD-CGLTFPNTETQPIPTNGSFITSGYT  129
             ++  A  GY +LR ++D        + T+    D  GLT  N +      +  FI S + 
Sbjct  7804  KSSFANAGYKSLRDMLDQQVPGCANTRTDVAPVDVAGLTVMNWQNDK--EHKGFIDSHH-  7634

Query  130   LDGPCEIWIDNTLALAGRNC----HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERY  185
               GPCE WID+T+     +C     T FP   +  D+S C   C + ++WL +       
Sbjct  7633  --GPCETWIDDTMVDRQDDCVATYGTGFPASVNA-DFSRCSGVCTLRFYWLAL----HEV  7475

Query  186   SWQVFKNCI  194
             +WQV+K C+
Sbjct  7474  NWQVYKQCV  7448

>PYIR:scaffold_452 pir_scaffold_452 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_452:1:24914:1 
REF
Length=24914

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 53/158 (34%)
 Frame = +2

Query  270    DFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHD-  328
              +F       GF +LR++++D             CGFTDP+ AP+ IP    R   ++ D 
Sbjct  23858  NFATAAKEKGFATLRSYLEDKGA---------TCGFTDPNVAPRAIPAD--RKVRFSRDI  24004

Query  329    -------------------------------------GPCEVWLDDTRVLQHDNCHEVIS  351
                                                   GPCE+W+DD RV Q+D+C    +
Sbjct  24005  SHPVRANIWCCLTQTRSACAELTRFVLSLTHWLLSM*GPCELWIDDKRVYQNDDCESAFT  24184

Query  352    G--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
              G   ++D+D++ C+G C + +YWL ++       WQVY
Sbjct  24185  GVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRWQVY  24292

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 81/205 (40%), Gaps = 67/205 (33%)
 Frame = +2

Query  39     VVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVT  98
              V++YPPP        + GS   + + +   TA +      E+G+ATLR+ ++D G     
Sbjct  23810  VIVYPPP--------WAGS---WKDPKNFATAAK------EKGFATLRSYLEDKGA----  23926

Query  99     EEGLFDCGLTFPNTETQPIPTNGS-------------------------------FITSG  127
                    CG T PN   + IP +                                 F+ S 
Sbjct  23927  -----TCGFTDPNVAPRAIPADRKVRFSRDISHPVRANIWCCLTQTRSACAELTRFVLSL  24091

Query  128    ----YTLDGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQ  181
                   ++ GPCE+WID+       +C + F        +D+++C   C + ++WL ++  
Sbjct  24092  THWLLSM*GPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQAS  24271

Query  182    GERYSWQVFKNCINLSASALVTMIG  206
              G R  WQV+     L  S L   IG
Sbjct  24272  GTR--WQVYSKWTRL--SVLTMRIG  24334

>PYVX:scaffold_1070 pve_scaffold_1070 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1070:1:7524:1 
REF
Length=7524

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 82/180 (46%), Gaps = 24/180 (13%)
 Frame = -2

Query  234   AHQLVILPAPTYTVEGKDNRWKPL----AFL---EGQNFSTT--DDFVGY---LDANGFD  281
             AH  +ILP PT+ V    N +  L     +L   +G ++ST   D+ + Y    + + + 
Sbjct  3410  AHSNMILPLPTWPVSWSTNSYSGLIEGDTYLPVPDGMSYSTDPYDNTLAYWTAFNESSYT  3231

Query  282   SLRAFMDDDSLYSVNASADF-----RCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
             SL+  +        +++  F      CG++  D   + +P+ +       +H GPCEVW 
Sbjct  3230  SLKDLVLATQELQTDSTGTFGTATAECGYSLADGTARDLPEYVEWNQLTSSHQGPCEVWC  3051

Query  336   DDTRVLQHDNCHEVISGKTYDLDYSA--CNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             DDT V ++ NC    +     L Y A  C G+  L  YW+ +  L     WQVY  C P+
Sbjct  3050  DDTLVFENWNCAYTYTADPAQLPYDASKCEGASMLTSYWIALHGLP----WQVYTNCAPL  2883

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 75/179 (42%), Gaps = 26/179 (15%)
 Frame = -3

Query  235   HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANGF  280
             H  +I P PT+ V    N +     + GQ +    D + Y               + + +
Sbjct  1882  HSYMIEPYPTWPVSWATNNFA--GTIAGQTYLPCPDGMSYQTDPLLNTEAYWTAFNESTY  1709

Query  281   DSLRAFMD---DDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT-HDGPCEVWLD  336
              SL+   D   +    S   +A   CGF+  +   + +P+ +  +   T HDGPCEVW D
Sbjct  1708  TSLKDLADQTMEMQTLSPFGTATKECGFSLANGTARALPEYVEWNQFTTGHDGPCEVWCD  1529

Query  337   DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             DT   Q DNC          L Y  S C G+  L  YW+ +  L     WQVY  CVP+
Sbjct  1528  DTLAFQDDNCAVNYPDDPAKLPYDISKCTGASMLTSYWIALHGLP----WQVYINCVPL  1364

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 71/154 (46%), Gaps = 15/154 (10%)
 Frame = -3

Query  50    DGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTF  109
             DGM Y   P++  E     TA  A  + + +  A    ++  D LY    +   +CG ++
Sbjct  6448  DGMSYSTDPLSNTE--AYWTAFNASKYTSLKELAFETQVVQTDSLYGTATK---ECGYSW  6284

Query  110   PNTETQPIPTNGSF--ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVC  165
              N   + +P    +  +T+G+  DGPCEIW D TL  + +NC   +P+      Y  S C
Sbjct  6283  TNGTARDLPDTVQWDKLTTGH--DGPCEIWCDETLVFSDQNCAVNYPDDPAVFPYDKSKC  6110

Query  166   GESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
               +  ++  WL +        WQVF NC  L+ +
Sbjct  6109  EGASMLTAIWLAL----HSPPWQVFTNCAPLTGA  6020

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 74/182 (41%), Gaps = 32/182 (18%)
 Frame = -3

Query  235   HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGY--------------LDANGF  280
             H  + LP PT+   G  N   P   ++  N   T D + Y               +A+ +
Sbjct  6547  HSKMSLPLPTWVYTGGTN--SPSGTIDSSNVLPTPDGMSYSTDPLSNTEAYWTAFNASKY  6374

Query  281   DSLRAF------MDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYT-HDGPCEV  333
              SL+        +  DSLY    +A   CG++  +   + +PD +      T HDGPCE+
Sbjct  6373  TSLKELAFETQVVQTDSLY---GTATKECGYSWTNGTARDLPDTVQWDKLTTGHDGPCEI  6203

Query  334   WLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             W D+T V    NC  +       +  D S C G+  L   WL +        WQV+  C 
Sbjct  6202  WCDETLVFSDQNCAVNYPDDPAVFPYDKSKCEGASMLTAIWLALHSPP----WQVFTNCA  6035

Query  392   PI  393
             P+
Sbjct  6034  PL  6029

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 64/155 (41%), Gaps = 14/155 (9%)
 Frame = -1

Query  249   GKDNRWKPLAFLEGQNF----STTDDFVGYLDANGFDSLRAFMDDDSLYSVNAS---ADF  301
             G D R   LA  E          T+ +    +A+ + SL  F D        A+   A  
Sbjct  4635  GVDRRRDVLARAERHVLLDXXXXTEAYWTAFNASNYTSLLQFADATQEVQTMATFGTATK  4456

Query  302   RCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLD  358
              CGF+  +   + +P  +       +H+GPCEVW DDTRV +  NC      S      D
Sbjct  4455  ECGFSLANGTARALPAEVEWNQLTSSHEGPCEVWCDDTRVFEDWNCAVDYTTSPAKLPYD  4276

Query  359   YSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              S C G+  L   WL +  L     WQVY  C P+
Sbjct  4275  ASKCEGAKMLTSIWLALHALP----WQVYTNCAPL  4183

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 75/170 (44%), Gaps = 20/170 (12%)
 Frame = -3

Query  32    SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
             +G   GQ  L  P     DGM Y+  P+  L  +   TA    T+ + +  A     M  
Sbjct  1822  AGTIAGQTYLPCP-----DGMSYQTDPL--LNTEAYWTAFNESTYTSLKDLADQTMEMQT  1664

Query  92    DGLYSVTEEGLFDCGLTFPNTETQPIP--TNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
                +    +   +CG +  N   + +P     +  T+G+  DGPCE+W D+TLA    NC
Sbjct  1663  LSPFGTATK---ECGFSLANGTARALPEYVEWNQFTTGH--DGPCEVWCDDTLAFQDDNC  1499

Query  150   HTEFPEGHHTIDYSV--CGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
                +P+    + Y +  C  +  ++ +W+ +        WQV+ NC+ L+
Sbjct  1498  AVNYPDDPAKLPYDISKCTGASMLTSYWIALH----GLPWQVYINCVPLN  1361

 Score = 46.2 bits (108),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 65/172 (38%), Gaps = 24/172 (14%)
 Frame = -2

Query  32    SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
             SGL EG   L  P     DGM Y   P  Y       TA        E  Y +L+ L+  
Sbjct  3347  SGLIEGDTYLPVP-----DGMSYSTDP--YDNTLAYWTAFN------ESSYTSLKDLVLA  3207

Query  92    DGLYSVTEEGLF-----DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAG  146
                      G F     +CG +  +   + +P    +     +  GPCE+W D+TL    
Sbjct  3206  TQELQTDSTGTFGTATAECGYSLADGTARDLPEYVEWNQLTSSHQGPCEVWCDDTLVFEN  3027

Query  147   RNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              NC   +      + Y  S C  +  ++ +W+ +        WQV+ NC  L
Sbjct  3026  WNCAYTYTADPAQLPYDASKCEGASMLTSYWIAL----HGLPWQVYTNCAPL  2883

 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 42/96 (44%), Gaps = 6/96 (6%)
 Frame = -1

Query  104   DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--D  161
             +CG +  N   + +P    +     + +GPCE+W D+T      NC  ++      +  D
Sbjct  4455  ECGFSLANGTARALPAEVEWNQLTSSHEGPCEVWCDDTRVFEDWNCAVDYTTSPAKLPYD  4276

Query  162   YSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
              S C  +  ++  WL +        WQV+ NC  LS
Sbjct  4275  ASKCEGAKMLTSIWLALH----ALPWQVYTNCAPLS  4180

 Score = 43.5 bits (101),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 56/123 (46%), Gaps = 20/123 (16%)
 Frame = -3

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNF--------------STTDDFVGYLDANG  279
             H +++ P PT+ V    N   P+  ++G  +              S T+ +    +A+ 
Sbjct  367  GHGVMLEPYPTWPVGYYINY--PMGLIQGDTYLPIPDGMTYSSDPLSNTEAYWTAFNASK  194

Query  280  FDSLRAFMDDDSLY---SVNASADFRCGFTDPDAAPQPIPDGIMRST-GYTHDGPCEVWL  335
            + SL+ F+    +    SV  +A   CGF+  +   + +P  +  +  G +H GPCEVW 
Sbjct  193  YTSLKDFVTQTEVLESQSVFGTATKECGFSLANGTARDLPTAVQWTGFGDSHHGPCEVWC  14

Query  336  DDT  338
            DDT
Sbjct  13   DDT  5

 Score = 42.7 bits (99),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 5/95 (5%)
 Frame = -3

Query  48   VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGL  107
            + DGM Y   P++  E     TA  A  + + + + T   +++   ++    +   +CG 
Sbjct  271  IPDGMTYSSDPLSNTE--AYWTAFNASKYTSLKDFVTQTEVLESQSVFGTATK---ECGF  107

Query  108  TFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTL  142
            +  N   + +PT   +   G +  GPCE+W D+TL
Sbjct  106  SLANGTARDLPTAVQWTGFGDSHHGPCEVWCDDTL  2

>PHPA:scaffold_19 NW_008649005.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.19, whole genome shotgun 
sequence
Length=1020763

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 7/71 (10%)
 Frame = +2

Query  326    THDGPCEVWLDDTRVLQHDNCHEVISG---KTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
              +H GPCEVW+DDT V   D+C          +   D+S C+G CTL +YWL +       
Sbjct  49610  SHHGPCEVWIDDTMVDHQDDCVAAYGTGYPASVKADFSKCSGDCTLRFYWLALHEP----  49777

Query  383    SWQVYKACVPI  393
              +WQ+YK CVPI
Sbjct  49778  NWQIYKQCVPI  49810

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (45%), Gaps = 34/134 (25%)
 Frame = +2

Query  77     LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SF  123
               A  GY++LR ++D         + + DC  T   T+  P+  +G              F
Sbjct  49457  FANAGYSSLRDMLD---------QQVTDCANT--RTDVSPVDVSGLSVMNWQNDQEQKGF  49603

Query  124    ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKY  180
              I S +   GPCE+WID+T+     +C   +  G+      D+S C   C + ++WL +  
Sbjct  49604  IDSHH---GPCEVWIDDTMVDHQDDCVAAYGTGYPASVKADFSKCSGDCTLRFYWLAL--  49768

Query  181    QGERYSWQVFKNCI  194
                   +WQ++K C+
Sbjct  49769  --HEPNWQIYKQCV  49804

>PYAP:scaffold_209 pag1_scaffold_209 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_209:1:44730:1 
REF
Length=44730

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 78/186 (42%), Gaps = 41/186 (22%)
 Frame = +1

Query  234   AHQLVILPAPTY-------TVEGKDNRWKPLAFLEGQNF-----STTDDFVGYLDANGFD  281
             AH  ++ PA  +          G  N +   A   G+ F     +  + F      + + 
Sbjct  2248  AHGYLVQPAAKFKPNVMTTNYNGIINAYSLPAPFAGKKFNDNPTANANTFTAAFKQSSYK  2427

Query  282   SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----------THDGP  330
             S++A MD    Y  +      CG T  + +P  I    MRS  +           +H GP
Sbjct  2428  SIKALMDK---YVPD------CGNTLMNGSP--INVSGMRSVKWANDQERVGFIKSHSGP  2574

Query  331   CEVWLDDTRVLQH-DNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
             CEVW+D+  V Q   NC E  +    +L  DYS C G C L +YWL +       +WQ+Y
Sbjct  2575  CEVWIDNKMVFQELGNCVEKYTSYPAELPVDYSVCKGKCQLTFYWLALHEP----NWQIY  2742

Query  388   KACVPI  393
             K C PI
Sbjct  2743  KQCAPI  2760

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 61/134 (46%), Gaps = 36/134 (27%)
 Frame = +1

Query  77    LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SF  123
               +  Y +++ALMD         + + DCG T  N    PI  +G              F
Sbjct  2407  FKQSSYKSIKALMD---------KYVPDCGNTLMNGS--PINVSGMRSVKWANDQERVGF  2553

Query  124   ITSGYTLDGPCEIWIDNTLALAGR-NC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIK  179
             I S     GPCE+WIDN +      NC   +T +P     +DYSVC   C+++++WL + 
Sbjct  2554  IKSH---SGPCEVWIDNKMVFQELGNCVEKYTSYP-AELPVDYSVCKGKCQLTFYWLAL-  2718

Query  180   YQGERYSWQVFKNC  193
                   +WQ++K C
Sbjct  2719  ---HEPNWQIYKQC  2751

>SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM15154v2:supercont2.19:1:569072:1 
REF
Length=569072

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 60/129 (47%), Gaps = 25/129 (19%)
 Frame = +3

Query  74      QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSG  127
               + + A+  Y TLRAL+D  G          DCG T  N   + IP+NG           G
Sbjct  464601  KAFKAQSKYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQNPDTGEG  464753

Query  128     YTLD--GPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCG-ESCRVSWFWLGIKYQ  181
               + L   GPCE+W+DN       +C T F   P  +  +DYS CG + C + ++W+ +   
Sbjct  464754  FILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIAL---  464924

Query  182     GERYSWQVF  190
                    WQV+
Sbjct  464925  -HSPRWQVY  464948

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 67/149 (45%), Gaps = 35/149 (23%)
 Frame = +3

Query  74      QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-----------S  122
               + + A+  + TLR ++D  G          DCG T  N   + IPTNG            
Sbjct  459294  KAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNPDTGEG  459446

Query  123     FITSGYTLDGPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCGES-CRVSWFWLGI  178
               FI S     GPCE+WIDN       +C T F   P  +  +DYS CG + C + ++WL +
Sbjct  459447  FIPSHT---GPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLAL  459617

Query  179     KYQGERYSWQVFKN----CINLSASALVT  203
                       WQV+      C+ + A+AL +
Sbjct  459618  ----HEPMWQVYSTFSMLCVCMEANALSS  459692

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 75/183 (41%), Gaps = 41/183 (22%)
 Frame = +1

Query  30      LDSGLGEGQVVLYPPPFFVVDGMDYR-------GSPVAYLEQQGVHTAIEAQTWLAERGY  82
               L SG G   +V  PP  F  D M  +         P  + +    + A   + + A+  +
Sbjct  448378  LISGHG---IVSNPPAEFRSDVMRTKYVATIQANLPGKFDDSPQNNVANFNKAFKAQSQF  448548

Query  83      ATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGS-----------FITSGYTLD  131
                TLR ++D  G          DCG T  N   + IP NG            FI S     
Sbjct  448549  KTLRDMLDPHGP---------DCGFTLTNVARKAIPGNGQMTWKNPDTGEGFIPSH---K  448692

Query  132     GPCEIWIDNTLALAGRNCHTEFPEGHHT---IDYSVC-GESCRVSWFWLGIKYQGERYSW  187
               GPCEIWIDN       +C T FP+       +DYS C G+ C + ++W+ +        W
Sbjct  448693  GPCEIWIDNERVFQNDDCATSFPQSPEVNLPVDYSKCRGDGCMLRFYWIAL----HEPQW  448860

Query  188     QVF  190
               QV+
Sbjct  448861  QVY  448869

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 83/198 (42%), Gaps = 53/198 (27%)
 Frame = +3

Query  30      LDSGLGEGQVVLYPPPFFVVDGM--DYRGSPVAYL-----EQQGVHTAIEAQTWLAERGY  82
               L SG G   +V  PP  F  D M   Y  +  A+L     +   V+ A   + + A+  +
Sbjct  457332  LASGHG---IVSNPPAEFRSDVMRTKYVATIQAFLPGKFDDSPQVNVANFNKAFKAQSQF  457502

Query  83      ATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGS-----------FITSGYTLD  131
                TLR ++D  G          DCG T  N   + IP++G            FI S    +
Sbjct  457503  KTLRDMLDPHGP---------DCGYTLTNVAKKAIPSDGKMTWQNPDTGEGFIPSHTVPN  457655

Query  132     ---------------GPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVC-GESCRVS  172
                              GPCE+W+DN       +C T F   P  H  +DYS C G+ C + 
Sbjct  457656  YIHERIAYSSSTHW*GPCEVWLDNKRVFQNDDCPTNFADKPAAHLPVDYSSCTGDGCMLR  457835

Query  173     WFWLGIKYQGERYSWQVF  190
               ++W+ + +Q E   WQV+
Sbjct  457836  FYWIAL-HQPE---WQVY  457877

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 66/146 (45%), Gaps = 27/146 (18%)
 Frame = +3

Query  258     AFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFR---CGFTDPDAAPQP  314
               AFL G+       F G    N  +  +AF       ++ A  D     CG T  + A + 
Sbjct  464544  AFLPGK-------FNGSPQNNAANFNKAFKAQSKYKTLRALLDQHGPDCGNTLTNVARKE  464702

Query  315     IP-DGIMR----STG----YTHDGPCEVWLDDTRVLQHDNCHEVISGK---TYDLDYSAC  362
               IP +G M      TG     +H GPCEVWLD+ RV Q+D+C      K      +DYS+C
Sbjct  464703  IPSNGKMTFQNPDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSC  464882

Query  363     NGS-CTLYWYWLGVRYLKQVYSWQVY  387
                   C L +YW+ +   +    WQVY
Sbjct  464883  GAKGCMLRFYWIALHSPR----WQVY  464948

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 60/149 (40%), Gaps = 42/149 (28%)
 Frame = -1

Query  74      QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-----------S  122
               + + A+  + TLR ++D  G          DCG T  N   + IPTNG            
Sbjct  451106  KAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNPDTGEG  450954

Query  123     FITSGYTLD--------------GPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVC  165
               F+ S                   GPCE+WID+       +C T F   P  +  IDYS C
Sbjct  450953  FVPSHTVCKQWPWAGNAYEM*Y*GPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSC  450774

Query  166     -GESCRVSWFWLGIKYQGERYSWQVFKNC  193
                G+ C + ++WL +        WQV+  C
Sbjct  450773  SGDGCMLRFYWLAL----HEPMWQVYSTC  450699

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 51/98 (52%), Gaps = 17/98 (17%)
 Frame = +3

Query  303     CGFTDPDAAPQPIP-DGIMR----STGY----THDGPCEVWLDDTRVLQHDNCHEVISGK  353
               CG T  + A + IP +G+M      TG     +H GPCEVW+D+ RV Q+D+C      K
Sbjct  459360  CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAK  459539

Query  354     ---TYDLDYSACNGS-CTLYWYWLGVRYLKQVYSWQVY  387
                     +DYS+C  + C L +YWL +        WQVY
Sbjct  459540  PAANLPVDYSSCGANGCMLRFYWLALHEPM----WQVY  459641

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 50/98 (51%), Gaps = 17/98 (17%)
 Frame = +1

Query  303     CGFTDPDAAPQPIP-DGIMR----STGY----THDGPCEVWLDDTRVLQHDNCHEVISGK  353
               CGFT  + A + IP +G M      TG     +H GPCE+W+D+ RV Q+D+C       
Sbjct  448588  CGFTLTNVARKAIPGNGQMTWKNPDTGEGFIPSHKGPCEIWIDNERVFQNDDCATSFPQS  448767

Query  354     ---TYDLDYSACNG-SCTLYWYWLGVRYLKQVYSWQVY  387
                     +DYS C G  C L +YW+ +   +    WQVY
Sbjct  448768  PEVNLPVDYSKCRGDGCMLRFYWIALHEPQ----WQVY  448869

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 45/88 (51%), Gaps = 8/88 (9%)
 Frame = +3

Query  304     GFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT---YDLDYS  360
               GF      P  I + I  S+     GPCEVWLD+ RV Q+D+C    + K      +DYS
Sbjct  457626  GFIPSHTVPNYIHERIAYSSSTHW*GPCEVWLDNKRVFQNDDCPTNFADKPAAHLPVDYS  457805

Query  361     ACNGS-CTLYWYWLGVRYLKQVYSWQVY  387
               +C G  C L +YW+ +   +    WQVY
Sbjct  457806  SCTGDGCMLRFYWIALHQPE----WQVY  457877

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -1

Query  329     GPCEVWLDDTRVLQHDNCHEVISGK---TYDLDYSACNGS-CTLYWYWLGVRYLKQVYSW  384
               GPCEVW+DD RV Q+D+C      K      +DYS+C+G  C L +YWL +        W
Sbjct  450884  GPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLALHEPM----W  450717

Query  385     QVYKACV  391
               QVY  C 
Sbjct  450716  QVYSTCA  450696

>PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.9, whole genome shotgun 
sequence
Length=1651025

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 58/121 (48%), Gaps = 10/121 (8%)
 Frame = +1

Query  275     LDANGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHDGPCE  332
               L   G  SL A +  +  LYS +   D  CG T   ++A   +P   +  TG+TH GPCE
Sbjct  538327  LPTKGGGSLGALIAKNQKLYSSDVDPD--CGLTTFKESARSKLPASQLEYTGFTHPGPCE  538500

Query  333     VWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKAC  390
               VW DDT+VL   +C     G    + Y  S C  +  L  YWL V   +    WQVY  C
Sbjct  538501  VWCDDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVHGEQ----WQVYSDC  538668

Query  391     V  391
               V
Sbjct  538669  V  538671

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 12/126 (10%)
 Frame = +2

Query  271     FVGYLDANGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTGYTHD  328
               F       G+DSL  F+  +  LYS +   D  CG+T   D+A   +P+  +  TG+TH 
Sbjct  509234  FKDTFPTKGYDSLGQFIAKNQELYSSDIDPD--CGWTIYKDSARSELPEAQLEYTGFTHP  509407

Query  329     GPCEVWLDDTRVLQHDNC---HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
               GPCE+W DDT++L   +C   +  I  K    D S C  +  L  YW+G+  +     WQ
Sbjct  509408  GPCEIWCDDTKLLFDYDCWTKYPAIPAKI-PYDKSKCADANRLTIYWIGIHGVP----WQ  509572

Query  386     VYKACV  391
               +Y  CV
Sbjct  509573  IYTDCV  509590

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 60/129 (47%), Gaps = 10/129 (8%)
 Frame = +2

Query  267     TTDDFVGYLDANGFDSLRAFM-DDDSLYSVNASADFRCGFTD-PDAAPQPIPDGIMRSTG  324
               T + F       G+DSL AF+  +  LYS     D  CG T   D+A   +P   +  TG
Sbjct  523973  TLNFFKATFPTKGYDSLGAFIAKNQELYSSKTDPD--CGLTVYKDSARSELPASQLEYTG  524146

Query  325     YTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
               +TH GPCEVW DDT+VL   +C          + Y  S C  +  L  YWL +       
Sbjct  524147  FTHTGPCEVWCDDTKVLFDYDCQTKYPDIPAKIPYDESKCANANRLTIYWLAL----HGD  524314

Query  383     SWQVYKACV  391
                WQVY  CV
Sbjct  524315  PWQVYTDCV  524341

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 75/153 (49%), Gaps = 19/153 (12%)
 Frame = +1

Query  46      FFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALM-DDDGLYSVTEEGLFD  104
               F  +DG  Y   P       G    ++A   L  +G  +L AL+  +  LYS   +   D
Sbjct  538258  FGEIDGGKYGYGPT------GAINILKAN--LPTKGGGSLGALIAKNQKLYSSDVD--PD  538407

Query  105     CGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY-  162
               CGLT F  +    +P +     +G+T  GPCE+W D+T  L   +C T+FP     I Y 
Sbjct  538408  CGLTTFKESARSKLPAS-QLEYTGFTHPGPCEVWCDDTKVLFDYDCQTKFPGSPSKIPYD  538584

Query  163     -SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                S C  + R++ +WL +   GE+  WQV+ +C+
Sbjct  538585  ESKCANANRLTIYWLAV--HGEQ--WQVYSDCV  538671

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 65/119 (55%), Gaps = 11/119 (9%)
 Frame = +2

Query  80      RGYATLRALM-DDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIW  137
               +GY +L A +  +  LYS   +   DCGLT + ++    +P +     +G+T  GPCE+W
Sbjct  524006  KGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPAS-QLEYTGFTHTGPCEVW  524176

Query  138     IDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
                D+T  L   +C T++P+    I Y  S C  + R++ +WL +   G+   WQV+ +C+
Sbjct  524177  CDDTKVLFDYDCQTKYPDIPAKIPYDESKCANANRLTIYWLAL--HGD--PWQVYTDCV  524341

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 6/99 (6%)
 Frame = +2

Query  104     DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY-  162
               DCG T      +          +G+T  GPCEIW D+T  L   +C T++P     I Y 
Sbjct  509324  DCGWTIYKDSARSELPEAQLEYTGFTHPGPCEIWCDDTKLLFDYDCWTKYPAIPAKIPYD  509503

Query  163     -SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                S C ++ R++ +W+GI        WQ++ +C+ L   +
Sbjct  509504  KSKCADANRLTIYWIGI----HGVPWQIYTDCVWLKGGS  509608

 Score = 37.7 bits (86),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +3

Query  313     QPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDN  345
               + IP   +  TG+TH GPCEV  DDT+VL   N
Sbjct  522288  RTIPSTNLMHTGFTHPGPCEVCCDDTKVLIEYN  522386

>SAPA:scaffold_32 supercont2.32 dna:supercontig supercontig:ASM15154v2:supercont2.32:1:360474:1 
REF
Length=360474

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 62/132 (47%), Gaps = 31/132 (23%)
 Frame = -2

Query  74      QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGS-----------  122
               + + A+  Y TLR L+D  G          DCG T PN   + IP++G            
Sbjct  116951  KAFAAQTQYKTLRDLLDLHGP---------DCGNTLPNVAAKAIPSDGKMTWKNPDTGEG  116799

Query  123     FITSGYTLDGPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCGES-CRVSWFWLGI  178
               FI S     GPCEIW+D+T      +C T F   PE    +DY+ CG + C + ++WL +
Sbjct  116798  FIPSH---TGPCEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLAL  116628

Query  179     KYQGERYSWQVF  190
                    +  WQV+
Sbjct  116627  ----HQPQWQVY  116604

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 49/98 (50%), Gaps = 17/98 (17%)
 Frame = -2

Query  303     CGFTDPDAAPQPIP-DGIMR----STGY----THDGPCEVWLDDTRVLQHDNCHEVISGK  353
               CG T P+ A + IP DG M      TG     +H GPCE+WLD TRV Q+++C       
Sbjct  116885  CGNTLPNVAAKAIPSDGKMTWKNPDTGEGFIPSHTGPCEIWLDSTRVFQNNDCATNFPAA  116706

Query  354     T---YDLDYSACN-GSCTLYWYWLGVRYLKQVYSWQVY  387
                     +DY+ C    C L +YWL +   +    WQVY
Sbjct  116705  PEARLPVDYTKCGPNGCLLRFYWLALHQPQ----WQVY  116604

>PHKE:scaffold_884 scf_22126_884.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_884.1_contig_1:1:6277:1 
REF
Length=6277

 Score = 53.9 bits (128),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 40/73 (55%), Gaps = 12/73 (16%)
 Frame = -2

Query  329   GPCEVWLDDTRVLQHDNCHEVI------SGKTYDL--DYSACNGSCTLYWYWLGVRYLKQ  380
             GPCEV++DD  VL  DNC +        SGK  ++  DYS+CNG C L +YWLG     Q
Sbjct  3858  GPCEVYIDDKLVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGF----Q  3691

Query  381   VYSWQVYKACVPI  393
                WQ Y   + I
Sbjct  3690  NEQWQSYGKLMRI  3652

 Score = 32.3 bits (72),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 43/103 (42%), Gaps = 17/103 (17%)
 Frame = -1

Query  234   AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNF---STTDDFVGYLDANGFDSLRAFMDDD  290
             AH  + +P PT+      + W  L      N+    +  D VG       +   +  D  
Sbjct  4219  AHGALKVPEPTFEQGASHSNWVTLV----DNYWDIGSGGDQVGKFKTMATEKGMSVKD--  4058

Query  291   SLYSVNASADFRCGFTDPDAAPQPIP-DGIM-----RSTGYTH  327
                 ++   D +CGFT  DA PQP+P DG +      + G+TH
Sbjct  4057  --VILDMVKDKKCGFTRADADPQPVPSDGKLVWRGSGNNGFTH  3935

 Score = 55.1 bits (131),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 12/73 (16%)
 Frame = -2

Query  132   GPCEIWIDNTLALAGRNCHTEFPEG--------HHTIDYSVCGESCRVSWFWLGIKYQGE  183
             GPCE++ID+ L L G NC  E+P G          TIDYS C   C +S++WLG  +Q E
Sbjct  3858  GPCEVYIDDKLVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLG--FQNE  3685

Query  184   RYSWQVFKNCINL  196
             +  WQ +   + +
Sbjct  3684  Q--WQSYGKLMRI  3652

 Score = 26.2 bits (56),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 16/28 (57%), Gaps = 0/28 (0%)
 Frame = -1

Query  105   CGLTFPNTETQPIPTNGSFITSGYTLDG  132
             CG T  + + QP+P++G  +  G   +G
Sbjct  4027  CGFTRADADPQPVPSDGKLVWRGSGNNG  3944

>PYAP:scaffold_744 pag1_scaffold_744 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_744:1:14808:1 
REF
Length=14808

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 13/126 (10%)
 Frame = +3

Query  277   ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAA-PQPIPDGIM----RSTGYT--HDG  329
             ++ + +LR F+  +    V++     CG T  D+  PQP+P+ I+       G+T  H+G
Sbjct  4506  SSSYKTLREFVLKNQRLEVSSVITPECGRTKSDSGNPQPLPEMIVWQHGEGEGFTPSHEG  4685

Query  330   PCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVY  387
             PCE+W D+TRV    NC          L Y  S C G   L   WL +   +    WQVY
Sbjct  4686  PCEIWCDETRVFHEANCARTYPQAPAMLPYDRSRCVGKNRLQLLWLALHEPR----WQVY  4853

Query  388   KACVPI  393
               C  +
Sbjct  4854  VNCASV  4871

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 53/126 (42%), Gaps = 16/126 (13%)
 Frame = +3

Query  82    YATLRALMDDDGLYSVTEEGLFDCGLTFPNT-ETQPIPT-------NGSFITSGYTLDGP  133
             Y TLR  +  +    V+     +CG T  ++   QP+P         G   T  +  +GP
Sbjct  4515  YKTLREFVLKNQRLEVSSVITPECGRTKSDSGNPQPLPEMIVWQHGEGEGFTPSH--EGP  4688

Query  134   CEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFK  191
             CEIW D T      NC   +P+    + Y  S C    R+   WL +        WQV+ 
Sbjct  4689  CEIWCDETRVFHEANCARTYPQAPAMLPYDRSRCVGKNRLQLLWLAL----HEPRWQVYV  4856

Query  192   NCINLS  197
             NC +++
Sbjct  4857  NCASVA  4874

>PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_206.1:1:61978:1 
REF
Length=61978

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 57/130 (44%), Gaps = 15/130 (12%)
 Frame = +2

Query  271   FVGYLDANGFDSLRAFMDDDSLYSVNASADFR----CGFTDPDAAPQPIPDGIMRSTGYT  326
             F       G+ SLR  +D       N   D       G T  +        G + S    
Sbjct  3110  FTSSFANAGYSSLRDMLDQQVTDCANTRTDVSPVDVSGLTTMNWQNDQEQKGFIDS----  3277

Query  327   HDGPCEVWLDDTRVLQHDNCHEVISG---KTYDLDYSACNGSCTLYWYWLGVRYLKQVYS  383
             H GPCEVW+DDT V   D+C          + + D+S C+G CTL +YW+ +       +
Sbjct  3278  HHGPCEVWIDDTLVDHQDDCVATYGSGYPASVNADFSKCSGDCTLRFYWIALHEP----N  3445

Query  384   WQVYKACVPI  393
             WQ+YK CVP+
Sbjct  3446  WQIYKQCVPV  3475

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (45%), Gaps = 34/134 (25%)
 Frame = +2

Query  77    LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-------------SF  123
              A  GY++LR ++D         + + DC  T   T+  P+  +G              F
Sbjct  3122  FANAGYSSLRDMLD---------QQVTDCANT--RTDVSPVDVSGLTTMNWQNDQEQKGF  3268

Query  124   ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHH---TIDYSVCGESCRVSWFWLGIKY  180
             I S +   GPCE+WID+TL     +C   +  G+      D+S C   C + ++W+ +  
Sbjct  3269  IDSHH---GPCEVWIDDTLVDHQDDCVATYGSGYPASVNADFSKCSGDCTLRFYWIAL--  3433

Query  181   QGERYSWQVFKNCI  194
                  +WQ++K C+
Sbjct  3434  --HEPNWQIYKQCV  3469

>PYIR:scaffold_152 pir_scaffold_152 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_152:1:48504:1 
REF
Length=48504

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 8/118 (7%)
 Frame = +2

Query  81     GYATLRAL-MDDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEIWI  138
              GY +LR L + +  +Y  + +   +CGLT     +   +P +G+   SG+T  GPCE+W 
Sbjct  47816  GYTSLRDLILANQDMYDESTDK--ECGLTTLDEAKRTTMPASGNITFSGFTHPGPCELWC  47989

Query  139    DNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              D+       NC   +P+G    D + C  + R   FW+G+        WQV+ NC+ L
Sbjct  47990  DDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVHGS----PWQVYTNCVYL  48151

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (46%), Gaps = 9/129 (7%)
 Frame = +2

Query  266    STTDDFVGYLDANGFDSLR-AFMDDDSLYSVNASADFRCGFTDPDAAPQPI--PDGIMRS  322
              +T   FV     +G+ SLR   + +  +Y  + S D  CG T  D A +      G +  
Sbjct  47777  ATVKYFVMNFPTSGYTSLRDLILANQDMY--DESTDKECGLTTLDEAKRTTMPASGNITF  47950

Query  323    TGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
              +G+TH GPCE+W DD ++   +NC           D + C G+     +W+GV       
Sbjct  47951  SGFTHPGPCELWCDDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGV----HGS  48118

Query  383    SWQVYKACV  391
               WQVY  CV
Sbjct  48119  PWQVYTNCV  48145

>PHPA: