Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PYAR:scaffold_2991971150977129420.0
PYAP:scaffold_162246022659666720730.0
PYUU:scaffold_20371312606131443262715630.0
PYIR:scaffold_8953389686151115460.0
PHPA:scaffold_6325588725795071314201e-172
PYIW:scaffold_9635233658545314102e-171
PHCA:scaffold_8410510510717771113953e-169
PHIF:NW_003303697.143590543798371213944e-169
PHSO:scaffold_12804769280688972913847e-168
PHKE:scaffold_98722497398258613821e-167
PHRA:scaffold_5614450014602651013601e-164
PLHA:NW_020189861.11838843184037851213011e-156
HYAP:scaffold_5919146719300551412753e-153
PYVX:scaffold_13231442271042611523e-139
ALCA:scaffold_6224203257235088454e-96
ALLA:FR82421522168237065168243e-93
SAPA:scaffold_244298614311804545323e-55
SADI:scaffold_41718021731154625067e-52
PHCA:scaffold_282791222804324521442e-07
PYVX:scaffold_6749084104184621432e-07
PHRA:scaffold_2646345468841801253e-05
PYAP:scaffold_55419660201271571218e-05
PYIW:scaffold_20520876213851731201e-04
PHIF:NW_003303706.11530651537542301201e-04
PHKE:scaffold_386783185142281191e-04
PYIR:scaffold_3274346749031951154e-04
PHPA:scaffold_244232244245314541155e-04
PYAR:scaffold_13927917283121341100.002
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PYAR_13571

Length=666
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  1137       0.0   
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  803        0.0   
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  606        0.0   
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  600        0.0   
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  551        1e-172
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  547        2e-171
PHCA:scaffold_84 PHYCAscaffold_84                                     541        3e-169
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  541        4e-169
PHSO:scaffold_1                                                       537        7e-168
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  536        1e-167
PHRA:scaffold_56                                                      528        1e-164
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  505        1e-156
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  495        3e-153
PYVX:scaffold_1323 pve_scaffold_1323 dna:supercontig supercontig:...  448        3e-139
ALCA:scaffold_62 AcNc2_CONTIG_62_length_96346 dna:supercontig sup...  330        4e-96 
ALLA:FR824215 dna:supercontig supercontig:ENA1:FR824215:1:55297:1...  322        3e-93 
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  209        3e-55 
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  199        7e-52 
PHCA:scaffold_28 PHYCAscaffold_28                                     60.1       2e-07 
PYVX:scaffold_674 pve_scaffold_674 dna:supercontig supercontig:pv...  59.7       2e-07 
PHRA:scaffold_26                                                      52.8       3e-05 
PYAP:scaffold_554 pag1_scaffold_554 dna:supercontig supercontig:p...  51.2       8e-05 
PYIW:scaffold_205 piw_scaffold_205 dna:supercontig supercontig:pi...  50.8       1e-04 
PHIF:NW_003303706.1 Phytophthora infestans T30-4 supercont1.53 ge...  50.8       1e-04 
PHKE:scaffold_386 scf_22126_386.1 dna:supercontig supercontig:Phy...  50.4       1e-04 
PYIR:scaffold_32 pir_scaffold_32 dna:supercontig supercontig:pir_...  48.9       4e-04 
PHPA:scaffold_24 NW_008649010.1 Phytophthora parasitica INRA-310 ...  48.9       5e-04 
PYAR:scaffold_139 par_scaffold_139 dna:supercontig supercontig:pa...  47.0       0.002 

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/771 (86%), Positives = 660/771 (86%), Gaps = 105/771 (14%)
 Frame = +2

Query  1      MLVPEDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTssamsydddndsmysgyssdRS  60
              MLVPEDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTSSAMSYDDDNDSMYSGYSSDRS
Sbjct  9197   MLVPEDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTSSAMSYDDDNDSMYSGYSSDRS  9376

Query  61     TATTPSNARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmpttaa--------  112
              TATTPSNARTTENLRATGLETLNELEEEPVDRSTARYIGEQGDFTPMPTTAA        
Sbjct  9377   TATTPSNARTTENLRATGLETLNELEEEPVDRSTARYIGEQGDFTPMPTTAAPAYTPMPV  9556

Query  113    -------------------------------paytpmpaIRREMMNEMHTSRYDVLKEVT  141
                                                  M AIRREMMNEMHTSRYDVLKEVT
Sbjct  9557   RSTTAAANYNXXXXXXXXXXXXXXXXXXXXXXXXXXMQAIRREMMNEMHTSRYDVLKEVT  9736

Query  142    MLKGTITQL---------------------------------------IETMARRTTTVA  162
              MLKGTITQL                                       IETMARRTTTVA
Sbjct  9737   MLKGTITQLVSILQQSGXXXXXXXXXXXXXXXXXXXXXXXXPELSPDQIETMARRTTTVA  9916

Query  163    SKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEV  222
              SKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEV
Sbjct  9917   SKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEV  10096

Query  223    QVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT--------------  268
              QVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT              
Sbjct  10097  QVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKTVAXXXXXXXXXXXX  10276

Query  269    -------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEET  315
                           HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEET
Sbjct  10277  AISDRFHEHVVAQHFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEET  10456

Query  316    DVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGF  375
              DVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGF
Sbjct  10457  DVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGF  10636

Query  376    LITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKS  435
              LITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKS
Sbjct  10637  LITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKS  10816

Query  436    CGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRK  495
              CGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRK
Sbjct  10817  CGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRK  10996

Query  496    ALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSAL  555
              ALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSAL
Sbjct  10997  ALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSAL  11176

Query  556    FDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaseratttsrspaspe  615
              FDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGTPASERATTTSRSPASPE
Sbjct  11177  FDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGTPASERATTTSRSPASPE  11356

Query  616    sssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKRTTTSAF  666
              SSSSTASSDRSSGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKRTTTSAF
Sbjct  11357  SSSSTASSDRSSGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKRTTTSAF  11509

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/667 (64%), Positives = 496/667 (74%), Gaps = 69/667 (10%)
 Frame = -3

Query  62     ATTPSNARTTENLRATGletlneleeePVDRSTARYIG------------EQGDFtpmpt  109
              + T S  R T +LRATGLETLNE+EEE VDRSTARY+G              GD   +  
Sbjct  26596  SATNSGLRGT-DLRATGLETLNEMEEEVVDRSTARYVGPGVTPTTPAAVIRAGDADLLRA  26420

Query  110    taapaytpmpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLI------------------  151
                      M AI+REMMNEMH +RYDVLKEVTMLKGTI QL+                  
Sbjct  26419  ELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAA  26240

Query  152    -----------------ETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAP  194
                               E ++R+TTTV SK TKERITTTR+D +PP+LR+TS RLTQLAP
Sbjct  26239  MGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTREDQIPPVLRSTSSRLTQLAP  26060

Query  195    VDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSD  254
              VDDSALSTPL QEQID++FPL+DFSAEVQ+Q+RIR+ G+REW FDRVQEWLDSRFNVG+D
Sbjct  26059  VDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGAD  25880

Query  255    VLLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLP  297
              V+LAMVGDAG+GKT                 HFCKF+RK KSSPRNVLLS+VNQLT++LP
Sbjct  25879  VVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLP  25700

Query  298    TFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYND  357
               FKSQLARLNLKYVLEETDV AL+RKVL+DPL +LEEPLT KFV+ D +DQC    GYND
Sbjct  25699  MFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYND  25520

Query  358    LLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVA  417
              L DFLS ++PECP WLGFL+++KPSPEFA  VPV+S+LDFSA+NA Y+NDT  L+ DI A
Sbjct  25519  LQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAA  25340

Query  418    IFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIY  477
              +F   DQA+A QILKTKS GNYSYLEFT+QA+SNPGME   G VPVDVLHDLPQSLYEIY
Sbjct  25339  VFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIY  25160

Query  478    EEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAF  537
              EEIFEDKFGKGRTR+WRKALPVLQLIFTAASGPYAQITEQ++MDSLSY KD+VRMLRRAF
Sbjct  25159  EEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAF  24980

Query  538    IDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHG  597
              IDIISIRHGTY IVSSA++DWLTD QRKGE Y +DV L+VKVLR+VLRGEKL +PGT+  
Sbjct  24979  IDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKLNMPGTSSS  24800

Query  598    tpaseratttsrspaspesssstassdrssGGGKTRVTSMTT---PPKRHEPNMAPREKP  654
                +     + S +  S  S+SS+  S   S    T  T  ++   P K HEPN+ P  KP
Sbjct  24799  GTSERSTMSRSGASISTSSTSSSDRSSGGSNNHSTPSTRTSSSSYPAKLHEPNLNP-SKP  24623

Query  655    VGILKRT  661
              VGILK T
Sbjct  24622  VGILKNT  24602

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/627 (51%), Positives = 414/627 (66%), Gaps = 64/627 (10%)
 Frame = -2

Query  5        EDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTssamsydddndsmysgyssdRSTATT  64
                +D ED FY     N G  I+ RS     + R+T+S   +   +           RST+  
Sbjct  1314432  DDVEDMFY-----NGGGGIT-RSTSDYTTGRTTSSMRDANGMN-----------RSTSLR  1314304

Query  65       PSNA-RTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmpttaapaytpmpaIRR  123
                 ++  RTTE LR T L  LNE E  P    T        +   +          M  IRR
Sbjct  1314303  VTDVYRTTEQLRNTNLMPLNEDEVLPAAMRTTTGAAGGSEADALRAELVEMKQEMQTIRR  1314124

Query  124      EMMNEMHTSRYDVLKEVTMLKGTITQLI----------------------------ETMA  155
                EMMNEMH +RYDVLKE+TMLKGTI QL+                            +T+ 
Sbjct  1314123  EMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTIT  1313944

Query  156      RRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPL  215
                R T    SK+TK+R+       +P ++R T+ RLTQLAPV D ALSTPL Q QID++FPL
Sbjct  1313943  RTTAVHTSKATKDRLAAREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPL  1313764

Query  216      LDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-------  268
                +DFSA++Q+ A+  D  +REWAF+R Q+W+DSRFNVG D LLA+VGD G+GK+       
Sbjct  1313763  VDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALC  1313584

Query  269      ----------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVL  318
                          H CKF+RK KSSPRNVLLS+VNQL A LP FK+QLARLNLKYVLEETD L
Sbjct  1313583  DRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPL  1313404

Query  319      ALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGFLIT  378
                 LARKVLVDPL +LEEPLTAK +L+DG+DQC  +   NDLLDFL+ ++PE P+WLG  IT
Sbjct  1313403  VLARKVLVDPLCALEEPLTAKVLLVDGIDQCK-SKDRNDLLDFLAAIIPEFPTWLGIFIT  1313227

Query  379      TKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGN  438
                +KPSPE   K+ +TSLLDFS KNA Y+NDT +L+ DI+  F  +D ++A  ILK KS GN
Sbjct  1313226  SKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGN  1313047

Query  439      YSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALP  498
                +++L+FT+QA+S+PGME   G VP+DVLHDLP+S+YEIY+EIFEDKFGKG  RLW+K  P
Sbjct  1313046  FTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQP  1312867

Query  499      VLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDW  558
                +L LI TAASGPYA ITE+   +  S ++DD+RM+RRAF DII +RHGTY + +SA+++W
Sbjct  1312866  LLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEW  1312687

Query  559      LTDPQRKGEPYHVDVTLHVKVLRRVLR  585
                L DPQR GE ++V+++  + +LRR+ R
Sbjct  1312686  LVDPQRSGEQFYVNISASMDILRRLHR  1312606

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/511 (58%), Positives = 370/511 (72%), Gaps = 51/511 (10%)
 Frame = +1

Query  121    IRREMMNEMHTSRYDVLKEVTMLKGTITQLI-----------------------------  151
              IRREMMNEMH +RYDVLKE+TMLKGTI QL+                             
Sbjct  95338  IRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSD  95517

Query  152    --ETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQI  209
                +T++R T    SK+TKER   TR+D  P L+RA+S RLTQLAPV D ALSTPL Q QI
Sbjct  95518  ELDTISRTTALYTSKATKER-RATREDSAPVLVRASS-RLTQLAPVADDALSTPLLQHQI  95691

Query  210    DELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-  268
              DE+FPL++ S E+Q  A+  D  +REWA +R QEW+DSRFNVG D LLA+VGD G+GK+ 
Sbjct  95692  DEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKST  95871

Query  269    ----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVL  312
                              H C F+RK KSSPRNVLLS+VNQL + LP FK+QLARLNLKYVL
Sbjct  95872  LTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVL  96051

Query  313    EETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSW  372
              EETD L LARKVLVDPL +LEEPLTAK  + DG+DQC  + G NDLLDFL+V++PE P+W
Sbjct  96052  EETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK-SKGRNDLLDFLAVIIPELPTW  96228

Query  373    LGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILK  432
              +G  IT+KPSPE   K+ +TSLLDFSAKN  Y+NDT +L+ DI+  F  +D   A +ILK
Sbjct  96229  VGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILK  96408

Query  433    TKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRL  492
               KS GN+++L+FT+QA+S+PGME   G +P+DVLHDLP+S+YEIYEEIFEDKFGKGR+R+
Sbjct  96409  RKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRI  96588

Query  493    WRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVS  552
              W+K  P+L+LI TAASGPYA ITE    +  S +K+D+R +RRAF+DII++ HGTY I +
Sbjct  96589  WKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIET  96768

Query  553    SALFDWLTDPQRKGEPYHVDVTLHVKVLRRV  583
              SALF+WL DPQR GE ++VDV+  + +LR++
Sbjct  96769  SALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  96861

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 551 bits (1420),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 311/713 (44%), Positives = 441/713 (62%), Gaps = 79/713 (11%)
 Frame = -1

Query  3       VPEDAEDTFYTRGRENNGTDI-SVRSDYQIPSARSTTssamsydddndsmysgyssdRST  61
               V +D E+ FY R   N  +D+   R+  QI +   T S+     + ++      S  + +
Sbjct  257950  VTDDVEEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFS  257771

Query  62      ATTPSN--ARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmp--ttaapaytp  117
                TTPSN  A T  N  +T              R+ +      GDF      +        
Sbjct  257770  TTTPSNYAASTPGNFSSTYHGFNTVHSTTGTSRAVS------GDFELERLRSEVLEVKEE  257609

Query  118     mpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET------------------------  153
               + AIRRE+MNE+H +RYDVLKE+ +LKG I QL  T                        
Sbjct  257608  VKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSAEER  257429

Query  154     --MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQ  208
                 + R+T+T  S++T++R+  +R ++    PP  RA SVRLTQLAPV D+ALSTPL+ +Q
Sbjct  257428  AALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARA-SVRLTQLAPVADNALSTPLSPQQ  257252

Query  209     IDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT  268
               I+E+FPL+DF++E+   AR    GTR WA  RV+EWLD+RFNVG+D LLA+VG+ GTGK+
Sbjct  257251  INEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKS  257072

Query  269     -----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYV  311
                                H C+F+RK KSSPRNVLLS+V+QL   LP+FK+QLARLNLKYV
Sbjct  257071  AFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYV  256892

Query  312     LEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECP  370
               LEE D   LA KVLVDPL ++EEP+ A F+L+DG+DQC    NG N+LL+F + V+P+ P
Sbjct  256891  LEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLP  256712

Query  371     SWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQI  430
               SW+GFLI++KPS + A+++PV+S+LDFSAKN A+V D + ++ DI   F  +D A+A ++
Sbjct  256711  SWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKV  256532

Query  431     LKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKG  488
               LK KS GN++YLEFT+QA+S+PGM A   +G+VP++VLH+LP++LY+IY EIFEDKFG+G
Sbjct  256531  LKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQG  256352

Query  489     RTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTY  548
               R R+W KA P+LQLI  AA+GPY+ +TE+   +   +  +D+RMLRR+F+D+++++HG Y
Sbjct  256351  RARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAY  256172

Query  549     HIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaserattts  608
                I SSAL  WL+DP R  E ++  +   ++ LR++ R               S   +++ 
Sbjct  256171  RIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRR--------------VSSSGSSSG  256034

Query  609     rspaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKRT  661
                S +S +  ++  +S R     KT   + T    RHEP   P  KPVGILKR 
Sbjct  256033  HSGSSSDGKATHRASSRVKTSSKTHQRAHT----RHEPRANPDFKPVGILKRN  255887

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 547 bits (1410),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 257/453 (57%), Positives = 337/453 (74%), Gaps = 19/453 (4%)
 Frame = +1

Query  148   TQLIETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQE  207
             T  I T++R T    SK+TK+R   TRD+   P+L   S RLTQLAPV D ALSTPL Q 
Sbjct  5233  TDEINTISRTTALFTSKATKDR-RATRDESSSPMLVRASSRLTQLAPVADEALSTPLLQH  5409

Query  208   QIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGK  267
             QIDE+FPL++ S E+   +R  D  +REWA +R QEW+DSRFNVG D LLA+VG+ G+GK
Sbjct  5410  QIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGK  5589

Query  268   T-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKY  310
             +                 H C F+RK KSSPRNVLLS+VNQ+ + LP FK+QLARLNLKY
Sbjct  5590  STLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKY  5769

Query  311   VLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECP  370
             VLEE+D + LARK+LVDPL +LEEP+TAK  ++DGLDQC  + G NDLLDFL+V++PE P
Sbjct  5770  VLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK-SRGRNDLLDFLAVIIPELP  5946

Query  371   SWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQI  430
             +W+G  IT+KPSPE   ++ ++SLLDFSAKN  Y+NDT +++ DI+  F  +D   A +I
Sbjct  5947  TWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREI  6126

Query  431   LKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRT  490
             LK KS GN+++L+FT+QA+S+PGME   G +P+DVLHDLP+S+YEIYEEIFEDKFGKGR 
Sbjct  6127  LKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRN  6306

Query  491   RLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHI  550
             R+W+K  P+L+LI TAASGPYA ITE    +  + +K+D+R +RR+F+DII +RHGTY I
Sbjct  6307  RIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRI  6486

Query  551   VSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRV  583
              +SALF+WL DPQR GE ++VDV+  +  LR++
Sbjct  6487  ENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  6585

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  121   IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETM  154
             IRREMMNEMH +RYDVLKEVTMLKGTI QL+  +
Sbjct  4897  IRREMMNEMHVTRYDVLKEVTMLKGTILQLVTAL  4998

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 541 bits (1395),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 312/711 (44%), Positives = 441/711 (62%), Gaps = 73/711 (10%)
 Frame = -3

Query  3       VPEDAEDTFYTRG--RENNGTDI-SVRSDYQIPSARSTTssamsydddndsmysgyssdR  59
               V +D E+ FY R   R    +++   R+  QI     T S+         +     S  +
Sbjct  107177  VTDDVEEMFYGRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQ  106998

Query  60      STATTPSN--ARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmpttaapaytp  117
                +ATTPSN  A T  N+   G  T +          T+R I E  +   + +        
Sbjct  106997  FSATTPSNYAASTPGNV---GNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEE  106827

Query  118     mpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET------------------------  153
               + AIRRE+MNE+H +RYDVLKE+T+LKG I QL                           
Sbjct  106826  VKAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPLSAEERA  106647

Query  154     -MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQI  209
                + R+T+T  S +T++R+  +R ++    PP  RA SVRLTQLAPV D+ALSTPL+ +QI
Sbjct  106646  ALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARA-SVRLTQLAPVADNALSTPLSSQQI  106470

Query  210     DELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-  268
               +E+FPL+DF++++   AR    G+R WA  RV+EWLD+RFNVG+D LLA+VG+ GTGK+ 
Sbjct  106469  NEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSA  106290

Query  269     ----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVL  312
                               H C+F+RK KSSPRNVLLS+V+QL   LP FK+QLARLNLKYVL
Sbjct  106289  FLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVL  106110

Query  313     EETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPS  371
               EE D + LA KVLVDPL ++EEP+ A F+L+DG+DQC    NG N+LL F + V+P+ PS
Sbjct  106109  EEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPS  105930

Query  372     WLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQIL  431
               W+GFL+++KPS + A+++PV+S+LDFSAKN A+V D + L+ DI   F  +D A+A ++L
Sbjct  105929  WIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVL  105750

Query  432     KTKSCGNYSYLEFTRQAMSNPGMEA--PQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGR  489
               K KS GN++YLEFT+QA+S+PGM A   +G+VP+ VLH+LP++LY+IY EIFEDKFG+GR
Sbjct  105749  KHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGR  105570

Query  490     TRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYH  549
                R+W KA P+LQL+  AASGPY+ +TE+   +      +D+RMLRR+F+D+++++HG+Y 
Sbjct  105569  ARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYR  105390

Query  550     IVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaseratttsr  609
               I SSAL  WL+DP R  E ++  +   +  LR++ R              +S  + + S 
Sbjct  105389  IESSALCAWLSDPARSEEQFYFSIDDALHALRKMRR-----------NVSSSGHSHSGSS  105243

Query  610     spaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKR  660
               S +S    +S+ +S R +   K++  S T    RHEP   P  KPVGILKR
Sbjct  105242  SDSSATHHTSSRASSRVTASSKSQQRSHT----RHEPRTNP-GKPVGILKR  105105

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 541 bits (1394),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 305/712 (43%), Positives = 443/712 (62%), Gaps = 73/712 (10%)
 Frame = -3

Query  3       VPEDAEDTFYTRGRENNGTDI-SVRSDYQIPSARSTTssamsydddndsmysgyssdRST  61
               V +D E+ FY R   N  +D+   R+  Q+     T S+     + ++      S  + +
Sbjct  437983  VTDDVEEMFYGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFS  437804

Query  62      ATTPSN--ARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmp--ttaapaytp  117
               ATTPSN  A T     +T            + R+ +      GDF      +        
Sbjct  437803  ATTPSNYAASTPGKFTSTHQGLNTAQTTTGMSRAVS------GDFELERLRSEVLEVKEE  437642

Query  118     mpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET------------------------  153
               + AIRRE+MNE+H +RYDVLKE+ +LKG I QL  T                        
Sbjct  437641  VKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDER  437462

Query  154     --MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQ  208
                 + R+T+T  S++T++R+  +R ++    PP  RA SVRLTQLAPV D+ALSTPL  +Q
Sbjct  437461  AALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARA-SVRLTQLAPVADNALSTPLNPQQ  437285

Query  209     IDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT  268
               I+E+FPL+D ++E+   AR    GTR WA  RV+EWLD+R+N+G+D LLA+VG+ GTGK+
Sbjct  437284  INEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKS  437105

Query  269     -----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYV  311
                                H C+F+RK KSSPRNVLLS+V+QL  +LP+FK+QLARLNLKYV
Sbjct  437104  TFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYV  436925

Query  312     LEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV-ANGYNDLLDFLSVVVPECP  370
               LEE D   LA KVLVDPL ++EEP+ A F+L+DG+DQC V +NG N+LL+  + V+P+ P
Sbjct  436924  LEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLP  436745

Query  371     SWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQI  430
               SW+GFL+++KPS + A+++PV+S+LDFSAKN A+V D + L+ DI   F  +D A+A ++
Sbjct  436744  SWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKV  436565

Query  431     LKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKG  488
               LK KS GN++YLEFT+QA+S+PG+ A   +G+VP++VLH+LP++LY+IY EIFEDKFG+G
Sbjct  436564  LKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQG  436385

Query  489     RTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTY  548
               R R+W KA P+LQL+  AA+GPY+ +TE+   +  +   +D+RMLRR+F+D++S++HG+Y
Sbjct  436384  RARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSY  436205

Query  549     HIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaserattts  608
                I SSAL  WL+DP R  E ++  V   +  LR++ R              +S  ++  S
Sbjct  436204  RIESSALCAWLSDPARSEEQFYFSVDDALLALRKIRR------------VGSSSSSSGHS  436061

Query  609     rspaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKR  660
                + +  +++ +  +S R S   KT   +      R+EP  +P  KPVGILKR
Sbjct  436060  GNSSDGKAAKNGHASSRPSNRVKTSSKTHQRAHTRYEPRTSPDYKPVGILKR  435905

>PHSO:scaffold_1
Length=13391543

 Score = 537 bits (1384),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 309/729 (42%), Positives = 437/729 (60%), Gaps = 90/729 (12%)
 Frame = -1

Query  3        VPEDAEDTFYTRGRENNGTDISVRSDYQIPSARST----------Tssamsydddndsmy  52
                V +D ED FY R   NN +  S  SD  +P  R+T          ++     +  + +  
Sbjct  2806889  VTDDVEDMFYGR---NNRSTASAASD--VPQYRTTEQLRDTHLTLSALHEDAETPSATNN  2806725

Query  53       sgyssdRSTATTPSN--ARTTENLRATGletlneleeePVDR-------STARYIGEQGD  103
                   S  + + TTPSN  A T  N      +  N  +     R       +    + E+G+
Sbjct  2806724  LSSSFSQFSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGE  2806545

Query  104      FtpmpttaapaytpmpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET----------  153
                   +          + AIRRE+MNE+H +RYDVLKE+ +LKG + QL             
Sbjct  2806544  LERLRAEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSS  2806365

Query  154      ----------------MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAP  194
                                + R+T+T  S +T+ER+  +R ++    PP  RA SVRLTQLAP
Sbjct  2806364  TDSSSLDPLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARA-SVRLTQLAP  2806188

Query  195      VDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSD  254
                V D ALSTPLT +QI+E+FPL+DF++E+   AR    G+R WA  RV+EWLDSRFN GSD
Sbjct  2806187  VADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSD  2806008

Query  255      VLLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLP  297
                +LLA+VG+ GTGK+                 H C+F+RK KS+PRNVLLS+V+Q+    P
Sbjct  2806007  ILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYP  2805828

Query  298      TFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV-ANGYN  356
                 FK+QLARLNLKYVLEE D + LA KVLVDPL +LEEP+ A F+++DG+DQC   A G N
Sbjct  2805827  PFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRN  2805648

Query  357      DLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIV  416
                +LL+F + ++P+ P+W+GFL+++KPS + A+++PV+S+LDFSA+N A+V D A L+ DI 
Sbjct  2805647  ELLEFFAQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIA  2805468

Query  417      AIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLY  474
                  F  +D   A  +LK KS GN++YLEFT+QA+S+PGM A   +G+VP+ VL+DLP++LY
Sbjct  2805467  RNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLY  2805288

Query  475      EIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLR  534
                +IY EIFEDKFG+GR R+W KA P+LQL+  AASGPY+ +TE+   +  +   +D+RMLR
Sbjct  2805287  DIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLR  2805108

Query  535      RAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGT  594
                R+F+D++++RHG+Y I SSAL  WL+DP R  E ++  +   ++ LR++ R         
Sbjct  2805107  RSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSG----  2804940

Query  595      AHGtpaseratttsrspaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKP  654
                         ++  S S +   +S+ T S   S G  K+   S      +HEP   P  KP
Sbjct  2804939  --------SSSGHSGSSSDGTTSAPTLSRTTSRGATKSHHRSHV----KHEPRANPDYKP  2804796

Query  655      VGILKRTTT  663
                VGILKR TT
Sbjct  2804795  VGILKRGTT  2804769

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 98/465 (21%), Positives = 179/465 (38%), Gaps = 92/465 (20%)
 Frame = +2

Query  198     SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDV  255
               SAL   L  E Q   LF LL  F+ + Q+         REW F+R Q+W+     + +  
Sbjct  491075  SALEGTLDHEGQQARLFSLLAPFNFQRQISQLTERFIGREWLFERFQQWVQGSTTLSTST  491254

Query  256     ---------LLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVN  290
                        +  +VG  G+GKT                HF + E +   + R  +LS+  
Sbjct  491255  QTGELINRRVFWLVGQIGSGKTSVAAQMVQTCPEIAAFHFARQEDEQTHNARRCVLSLAY  491434

Query  291     QLTATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLD  347
               QLT  LP +   L +   L+ ++     + L  ++L+ PL ++  P T K   +L+DG++
Sbjct  491435  QLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLIGPLNAIARPTTYKSLVLLIDGIE  491614

Query  348     QC------------GVANGYND---LLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVT  392
                              ++ G  D   L+  L  +    P W+  ++ ++  P    K+   
Sbjct  491615  WLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRLPDWVRVVVLSREDPPVLSKLHAF  491794

Query  393     SLLDFSAKNAAYVND-----------TAVLLRDIVAIFPTEDQAD------------ATQ  429
                  D    +  + ND           + + L ++     +E   D              +
Sbjct  491795  EPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFAKASEQAVDVPANNHEFGLEQVVE  491974

Query  430     ILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFG---  486
               ++  +S G + Y     QA++       +G + +  L +LP  +    ++ F   F    
Sbjct  491975  LIARRSEGLFLYAVNVVQAIT-------EGRLRLHELAELPVGMGAYLQQFFASHFSDHD  492133

Query  487     --KGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIR  544
                 K R R      PVL+ +  AA  P    T   V++   Y + D   +  +   I +  
Sbjct  492134  MYKQRVR------PVLE-VLCAAYEPLPLATLARVLEWDVYEQRDASSVLGSLFCIEAGY  492292

Query  545     HGTYHIV---SSALFDWLTDPQRKGEPYHVDV-TLHVKVLRRVLR  585
                    ++    S++ DW+ D    G+ + VDV + H ++ R  +R
Sbjct  492293  DANSQLLRPFHSSVLDWIQDSNSSGD-FFVDVASGHERLGRWAVR  492424

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 536 bits (1382),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 277/586 (47%), Positives = 392/586 (67%), Gaps = 54/586 (9%)
 Frame = -3

Query  121    IRREMMNEMHTSRYDVLKEVTMLKGTITQLIET------------------------MAR  156
              IRRE+MNE+H +RYDVLKE+T+LKG + QL                           + R
Sbjct  73982  IRREVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGSVSPSTSSSSDPLSAEDRAALTR  73803

Query  157    RTTTVASKSTKERITTTRDDM--VPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFP  214
                + + SK+TK+R+  +R ++  VPP     SVRLTQLAPV D+ALSTPL  +QI+E+FP
Sbjct  73802  VPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFP  73623

Query  215    LLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT------  268
              L+DF++E+   AR    GTR WA  RV+EWLD+RFNVG+D +LA+VGD GTGK+      
Sbjct  73622  LIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTV  73443

Query  269    -----------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDV  317
                         H C+F+RK KS+PRNVLLS V+QL   LP FK+QLARLNLKYVLEE+D 
Sbjct  73442  AQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDP  73263

Query  318    LALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPSWLGFL  376
                LA KV VDPL ++EEP+ A F+L++GLDQC    NG N+LL+FLS ++P+ PSW+GF+
Sbjct  73262  FLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFM  73083

Query  377    ITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSC  436
              I++KP  +FA+++PV+S+LDFSAKN A+V+D + L+ DI   F  ED A+A ++LK KS 
Sbjct  73082  ISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSG  72903

Query  437    GNYSYLEFTRQAMSNPGME--APQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWR  494
              GN++YLEFT+QA+S+PGM   + +G+VP++VL DLPQSL++IY EIFEDKFG+GR R+W 
Sbjct  72902  GNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWA  72723

Query  495    KALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSA  554
              KA P+LQLI  AA+GPY+ +TE    +   +  +D+RMLRR+F+D++ ++HG Y + SSA
Sbjct  72722  KAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSA  72543

Query  555    LFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaseratttsrspasp  614
              L  WL+DP R  E +++ V   +  LR++ R         ++   +   ++++  S  S 
Sbjct  72542  LCSWLSDPARSEEQFYLSVDDALTALRKLRRSRSS----GSNSDHSHSGSSSSDGSVPST  72375

Query  615    esssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKR  660
               S + + ++   +   K+   + T    RHEP + P  KP+GILKR
Sbjct  72374  TSHTPSRATSSRAASSKSHQRAHT----RHEPRVNPEFKPMGILKR  72249

>PHRA:scaffold_56
Length=334739

 Score = 528 bits (1360),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 257/510 (50%), Positives = 355/510 (70%), Gaps = 51/510 (10%)
 Frame = +2

Query  121     IRREMMNEMHTSRYDVLKEVTMLKGTITQLIET---------------------------  153
               IRRE+MNE+H +RYDVLKE+ +LKG I QL  T                           
Sbjct  144500  IRREVMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAA  144679

Query  154     MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQID  210
               + R+T+T  S +T+ER+  +R ++    PP  RA SVRLTQLAPV D+ALSTPLT +QI+
Sbjct  144680  LTRQTSTKTSSATRERLAASRANIHKTPPPAARA-SVRLTQLAPVADNALSTPLTPQQIN  144856

Query  211     ELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT--  268
               ++FPL+DF++E+   AR    G+R WA  RV+EWLD+RFNVG D LLA+VG+ GTGK+  
Sbjct  144857  DMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAF  145036

Query  269     ---------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLE  313
                              H C+F+RK KSSPRNVLLS+V+QL  +LP FK+QLARLNLKYVLE
Sbjct  145037  LGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLE  145216

Query  314     ETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPSW  372
               E D   LA KVLVDPL ++EEP+ A F+L+DG+DQC     G N+LL+F + V+P  PSW
Sbjct  145217  EADPFVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSW  145396

Query  373     LGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILK  432
               +GF++++KPS + A+++PV+S+LDFSAKN A+V+D + L+ D+   F   D A+A ++LK
Sbjct  145397  VGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLK  145576

Query  433     TKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRT  490
                KS GN++YLEFT+QA+S+PGM A   +G+VP+ VLH+LP++LY+IY EIFEDKFG+GR 
Sbjct  145577  QKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRA  145756

Query  491     RLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHI  550
               R+W KA P+LQLI  AA+GPY+ +TE+      +   +D+RMLR +F+D++++RHG Y I
Sbjct  145757  RVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRI  145936

Query  551     VSSALFDWLTDPQRKGEPYHVDVTLHVKVL  580
                SSAL  WL+DP R  E ++  +   ++ L
Sbjct  145937  ESSALCGWLSDPARSEEQFYFAIDDAIQAL  146026

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 505 bits (1301),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 249/512 (49%), Positives = 343/512 (67%), Gaps = 49/512 (10%)
 Frame = +2

Query  121      IRREMMNEMHTSRYDVLKEVTMLKGTITQLIE---------------------------T  153
                IRRE+MNE+H +RYDVLKE+T+LKG I QL                              
Sbjct  1838843  IRREVMNELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAA  1839022

Query  154      MARRTTTVASKSTKERITTTR--DDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDE  211
                + R+T T  S++T++R+   R   +  PP     S RLTQLAPV D ALSTPL  +QI+E
Sbjct  1839023  LTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINE  1839202

Query  212      LFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT---  268
                 FPL+DF++E+   AR    G+R WA  R+QEWLD+RF++G+D LLA+VG+ G+GK+   
Sbjct  1839203  SFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFC  1839382

Query  269      --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEE  314
                              H C+F+RK KS PRNVLLS+V+QL   LP FK+QLARLNL+YVLEE
Sbjct  1839383  GTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEE  1839562

Query  315      TDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV-ANGYNDLLDFLSVVVPECPSWL  373
                TD   LA KVL+DPL +LEEP  + F+L+DG+DQC   +NG N+LL+F+S ++   PSW+
Sbjct  1839563  TDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWV  1839742

Query  374      GFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKT  433
                GFL+++KPS + A+ +PV+S+LDFSAKN A+V D + L+ DI   F  +D  +A ++L  
Sbjct  1839743  GFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTK  1839922

Query  434      KSCGNYSYLEFTRQAMSNPGME--APQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTR  491
                KS GN++YLEFT+QA+S+PGM   +  G VP+ VL +LP++LY+IY EIFEDKFG+G  R
Sbjct  1839923  KSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHAR  1840102

Query  492      LWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIV  551
                 W KA P+LQLI  AA+GPY+ +TE+     L    DD+RMLRR+F+DI++++HG Y I 
Sbjct  1840103  AWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKHGAYRIE  1840282

Query  552      SSALFDWLTDPQRKGEPYHVDVTLHVKVLRRV  583
                SSAL  WL+DP R  E ++  +   +  LR++
Sbjct  1840283  SSALCAWLSDPVRSEEQFYFSIEDALLALRKM  1840378

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 495 bits (1275),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 244/514 (47%), Positives = 345/514 (67%), Gaps = 49/514 (10%)
 Frame = -1

Query  121     IRREMMNEMHTSRYDVLKEVTMLKGTITQLIET---------------------------  153
               IR+ ++NE+H +RYDVLKE+ +LKG I QL  T                           
Sbjct  193005  IRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGA  192826

Query  154     MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQID  210
               + R+T+T+ S +T++R+  +R +     PP  RA SVRLTQLAPV DSALSTPL+  Q++
Sbjct  192825  LTRQTSTMTSSATRDRLAASRVNTYKPPPPAARA-SVRLTQLAPVADSALSTPLSSVQMN  192649

Query  211     ELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT--  268
               +LFPL+DF+ E+   AR    G+R WA  R +EWL+SRF  G D LLA+VG+ G+GK+  
Sbjct  192648  DLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAF  192469

Query  269     ---------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLE  313
                              H C+F+RKGKSSPRNVLLSVV+QL   LP FK+QLARLNLKYVLE
Sbjct  192468  CGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLE  192289

Query  314     ETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPSW  372
               E D + LA KVLVDPL +LE+P+   F+L+DG+DQC V   G N+LL+FL+ ++P+ PSW
Sbjct  192288  EADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSW  192109

Query  373     LGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILK  432
               LG ++++KPS + A+++PV+S+LDFSAKN A+V D + L+ +I   F  ED  +A ++LK
Sbjct  192108  LGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLK  191929

Query  433     TKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRL  492
                KS GN++YLEFT+QA+S     + +G V +DVL +LP++LY+IY EIFEDKFG GR R+
Sbjct  191928  HKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARV  191749

Query  493     WRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVS  552
               W KA  VLQL   A +GPY+ +TE+   +      +D+R+LRR+F+D+++++HG Y I +
Sbjct  191748  WSKAEQVLQLAIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIEN  191569

Query  553     SALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRG  586
               SAL  WL DP R  E ++ ++   ++ LR++ R 
Sbjct  191568  SALCAWLCDPARAEEQFYFNIDDALQALRKMRRA  191467

>PYVX:scaffold_1323 pve_scaffold_1323 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1323:1:4715:1 
REF
Length=4715

 Score = 448 bits (1152),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 232/426 (54%), Positives = 294/426 (69%), Gaps = 25/426 (6%)
 Frame = -2

Query  180   PLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFD  239
             P  RA S RLTQLAPVDD+ALS PL  EQ+DELFPL+D S ++   AR R  GTR+WA  
Sbjct  2710  PAARA-SARLTQLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATA  2534

Query  240   RVQEWLDSRFNVGSDVLLAMVGDAGTGK-----------------THFCKFERKGKSSPR  282
             RVQEWLDSRFNVG D LL +VG  GTGK                 THFCKF+RK KS+PR
Sbjct  2533  RVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPR  2354

Query  283   NVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVL  342
              VLLS+V Q+ A LP FK QLARLNLKYVLEE DV  LA KVL+DPLA+ EEP+TAK ++
Sbjct  2353  VVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLV  2174

Query  343   LDGLDQCGVANG---YNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSA  399
             LDGLDQC  +      N+LL+FL+ VVP+ PSWLG L+++KP+PE A ++  TSLLDFS 
Sbjct  2173  LDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSG  1994

Query  400   KNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQG  459
             KN  +V D   L+ DI A F     A+A ++L+TK+ GN++YL+FTRQA+S+PG++   G
Sbjct  1993  KNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGLD--DG  1820

Query  460   SVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLW--RKALPVLQLIFTAASGPYAQITEQ  517
              + +D+LHDLP+SLYEIY EIFEDKFG+GR RLW                 GPY+ + E 
Sbjct  1819  ELELDMLHDLPESLYEIYLEIFEDKFGRGRNRLWXXXXXXXXXXXXXXXXXGPYSLVRED  1640

Query  518   HVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHV  577
                + L Y+ DD+R+++R+F+DII++R G Y I SSALF+WL+DP R GE +  D    V
Sbjct  1639  AARELLGYSSDDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGV  1460

Query  578   KVLRRV  583
               LRR+
Sbjct  1459  DELRRL  1442

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = -3

Query  69    RTTENLRATGletlneleeeP-------VDRSTARYIGEQGDFtpmpttaapaytpmpaI  121
             RTTE LR+TGLE L E    P       V  ++  +    G    +    A       AI
Sbjct  3201  RTTEQLRSTGLEPLAEDRVLPPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAI  3022

Query  122   RREMMNEMHTSRYDVLKEVTMLKG  145
             RRE+MNE+H  RYDVLKEVT+LKG
Sbjct  3021  RREVMNELHVLRYDVLKEVTVLKG  2950

>ALCA:scaffold_62 AcNc2_CONTIG_62_length_96346 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_62_length_96346:1:96346:1 
REF
Length=96346

 Score = 330 bits (845),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 177/508 (35%), Positives = 288/508 (57%), Gaps = 48/508 (9%)
 Frame = -1

Query  121    IRREMMNEMHTSRYDVLKEVTMLKGTITQL-----------IETMARRTTTVASKS----  165
              +R+E++  +  +RYD+LKE+  LKG +  +           I  +   T   ++ S    
Sbjct  25723  VRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANGSACSEGAD  25544

Query  166    ---------TKERITTTRD-DMVPPLLRATSV----RLTQLAPVDDSALSTPLTQEQIDE  211
                       T +R T   D   +  L+  +S+     L  L  +D++ LS PL++++IDE
Sbjct  25543  DNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEANLSKPLSKDEIDE  25364

Query  212    LFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT---  268
              +FPL+D S +V+  A     GTR WA D + +W+ S F  G++ +L +VG+ G GK+   
Sbjct  25363  MFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLA  25184

Query  269    --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEE  314
                            HF +F+RK  SS R+V+LS+V+Q  + L  +K QL RLNL+Y+L E
Sbjct  25183  GYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYILAE  25004

Query  315    TDVLALARKVLVDPLASL-EEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWL  373
              ++ L +A K+L+DPL ++ E   T  FVL DG+DQC V N  NDLL+ LS +    PSW+
Sbjct  25003  SNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSHITERFPSWI  24824

Query  374    GFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKT  433
              GF++T+K  P FA ++   S++     N  ++ D+ +L+ +++  F  +   +A  IL  
Sbjct  24823  GFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDILMR  24644

Query  434    KSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLW  493
              KS GN  YL+F  +A+S+P +   Q  + +DVL +LP+S+ EI   IF+DKFG+G  R+W
Sbjct  24643  KSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVW  24464

Query  494    RKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSS  553
              + A P+L++I  AA+GPY  + E  +       +++ RM+ RAF DII      Y I++S
Sbjct  24463  KNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGYRIINS  24284

Query  554    ALFDWLTDPQRKGEPYHVDVTLHVKVLR  581
              +L+DWL   +++ + +H++     K LR
Sbjct  24283  SLYDWLV-VEKRSQHFHLNPQAVFKFLR  24203

>ALLA:FR824215 dna:supercontig supercontig:ENA1:FR824215:1:55297:1 
REF
Length=55297

 Score = 322 bits (824),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 173/516 (34%), Positives = 289/516 (56%), Gaps = 55/516 (11%)
 Frame = -2

Query  121    IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMAR-----------RTTTVASKS----  165
              +R+E++  + ++RYD++KE+  L+G +T +   + +              T A+K+    
Sbjct  23706  VRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTAFSE  23527

Query  166    ------------TKERITTTRD-----DMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQ  208
                          T ER T   D       V   L       +   P+D+S LS PL +++
Sbjct  23526  SAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFSTSVPLDESQLSKPLDKDE  23347

Query  209    IDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT  268
               DE+FP +D  ++++  A     GTR WA DRV+EW++S F   +D +L ++G+ G+GK+
Sbjct  23346  FDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTIIGEGGSGKS  23167

Query  269    -----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYV  311
                               HFC+F+RK +SS R+V+LS+V+Q  +  P +K QL  LNL+Y+
Sbjct  23166  TLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASKNPLYKRQLTCLNLRYI  22987

Query  312    LEETDVLALARKVLVDPLASLEEPL---TAKFVLLDGLDQCGVANGYNDLLDFLSVVVPE  368
              L+E++ L +A K+L++PL ++  P+   T  FVL DG+DQC V N  NDLLD +S +   
Sbjct  22986  LKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLVENESNDLLDLISHITQR  22813

Query  369    CPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADAT  428
               PS +GF++T+K SP F  K    S++    +N  ++ND+ +L+ + +  F  +   +A 
Sbjct  22812  FPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEPKHTNEAC  22633

Query  429    QILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKG  488
               IL  KS GN  YL+FT +A+S+P +   +  + +DVL +LP S+ +I+  IFEDKFG+G
Sbjct  22632  DILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQG  22453

Query  489    RTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTY  548
                R+W+   P+L+ I  AA+G +  + E+ +       K++ RM++R+F DII      Y
Sbjct  22452  HQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGY  22273

Query  549    HIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVL  584
               I++S+LF WL   + + + +++D    +K L  VL
Sbjct  22272  RIITSSLFAWLI-VENRSQHFYIDPKAGIKFLL*VL  22168

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 209 bits (532),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 132/454 (29%), Positives = 236/454 (52%), Gaps = 38/454 (8%)
 Frame = -2

Query  153     TMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDEL  212
               T+ R +   +SK ++E    +R+        +   R +   P+ D AL+ P  +  +++ 
Sbjct  431180  TVVRESIRASSKLSRESSKLSRESSKISRESSKLFRESTRQPIKDQALTQPW-ENVLNQH  431004

Query  213     FPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT----  268
                P L+     Q  A      TR WA ++  +W           +L +VG AG GK+    
Sbjct  431003  LPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLS  430836

Query  269     -------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEET  315
                            HF +++ +  +S   +L+S+ +Q++  LP F+ QL RLNL Y+++E 
Sbjct  430835  HLVSNYPEQIMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEP  430662

Query  316     DVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGF  375
               D + LA K+L++PL S+  PL ++ ++LD +D+     G N L+  L+ V  E PSW+ F
Sbjct  430661  DPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTN-LISLLADVALEFPSWVLF  430485

Query  376     LITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKS  435
               L++++P     + +P   +L F  ++  +  D  + ++ ++     +D+ +   +LK KS
Sbjct  430484  LLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDK-NILFLLKAKS  430308

Query  436     CGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRK  495
                G++ YL+F  QA +    E   G     ++ +LP++LYEIY+++FE+K+GKGR R+W+K
Sbjct  430307  QGSFLYLQFVDQAFAMIHSEIDAG-----MILELPKTLYEIYDQVFEEKYGKGRRRVWQK  430143

Query  496     ALPVLQLIFTAASGPYAQ-----ITEQHVMDSLSYAKDDVRMLRRAFIDIISIRH--GTY  548
                 PVL+ I  AA+  + +     +TE  V       + D+ ++ R+F DI+++    G Y
Sbjct  430142  VQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVY  429963

Query  549     HIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRR  582
                + S  LFD+L D  R  E  H++V   V  L +
Sbjct  429962  RLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  429861

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  121     IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTTTVAS  163
               IRR++M E+HT++YD+LKE+TML+G + QL++ M ++    A+
Sbjct  431483  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAAT  431355

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 199 bits (506),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 130/462 (28%), Positives = 240/462 (52%), Gaps = 48/462 (10%)
 Frame = +1

Query  136     VLKEVTMLKGTITQLIETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPV  195
               V +E T     +++    ++R ++ ++ +S+K    +++      LL   S R     P+
Sbjct  171802  VFRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSK------LLFRESTR----QPI  171951

Query  196     DDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDV  255
                D AL+ P  +  +++  P L+     Q  A      TR WA ++  +W           
Sbjct  171952  KDQALTQPW-ENVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESR  172116

Query  256     LLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPT  298
               +L +VG AG GK+                 HF +++ +   +P  +L+S+ +Q++  LP 
Sbjct  172117  VLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKLPD  172290

Query  299     FKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDL  358
               ++ QL RLNL Y+++E D + LA K+L++PL S+  PL ++ ++LD +D+     G N L
Sbjct  172291  YQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGAN-L  172467

Query  359     LDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAI  418
               +  L+ V  E PSW+ FL++++      + +P   +L F  ++  +  D  + ++ ++  
Sbjct  172468  ISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDK  172647

Query  419     FPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYE  478
                  +D+ +   +LK KS G++ YL+F  QA S    E   G     ++ +LP++L+EIY+
Sbjct  172648  HGLDDK-NILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAG-----MILELPKTLHEIYD  172809

Query  479     EIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQ-----ITEQHVMDSLSYAKDDVRML  533
               ++FE+K+GKGR R+W+K   VL+ I  AA+  + +     +TE  V       + D+ ++
Sbjct  172810  QVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALI  172989

Query  534     RRAFIDIISIRH--GTYHIVSSALFDWLTDPQRKGEPYHVDV  573
                R+F DI+++    G Y + S  LFD+L D  R  E  H++V
Sbjct  172990  ARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINV  173115

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  121     IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTT  159
               IRR++M E+HT++YD+LKE+TML+G + QL++ M +++T
Sbjct  171490  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQST  171606

>PHCA:scaffold_28 PHYCAscaffold_28
Length=757753

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 101/452 (22%), Positives = 173/452 (38%), Gaps = 90/452 (20%)
 Frame = -1

Query  198     SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRF------  249
               SAL   L  E Q   LF LL  F+ + Q+         REW F+  Q W+          
Sbjct  280432  SALEGTLDHEGQQARLFSLLAPFNFQHQISKLTEHFAGREWLFEHFQRWVQGSSMSTSSE  280253

Query  250     ---NVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVN  290
                   + +  +  +VG  G+GK+                HF + E +   S R  +LS+  
Sbjct  280252  STRELYNQRMFWVVGQIGSGKSSVAACMVHSCPEIAAFHFARQEDEQTHSARRCILSLAY  280073

Query  291     QLTATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLD  347
               QLT  LP +   L +   L+ ++     + L   +L+ PL ++  P   K   +L+DG++
Sbjct  280072  QLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNAIARPTKYKSLVLLIDGVE  279893

Query  348     QC--------------GVANGYND---LLDFLSVVVPECPSWLGFLITTKPSPEFAQKV-  389
                                   G ND   L+  L  ++   P W+  ++ ++  P    K+ 
Sbjct  279892  WLIPRPASSSLPPLSGNSWKGSNDEECLVSMLPSLISRLPEWVRVVLLSREDPPVLSKLH  279713

Query  390     ----PVTSLLDFSAKNAA----YVNDTAVLL--------RDIVAIFPTEDQA---DATQI  430
                   P  ++  F  +N      YV+ +   L        +  V I P+  +     A ++
Sbjct  279712  AFVPPDITIEQFQQQNDQDIRRYVHHSLSKLHFSDDDFEKASVGIEPSSHRCGMDQAVEL  279533

Query  431     LKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFG----  486
               +  +S G + Y     QA+S       +G + ++ L +LP  +    ++ F   F     
Sbjct  279532  IARRSEGLFLYAVNVVQAIS-------EGRLHLNELAELPVGMGAYLQQFFASHFSDHDM  279374

Query  487     -KGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRH  545
                K R R      PVL+ +  AA  P    T   V++   Y + D      +   I +   
Sbjct  279373  YKHRVR------PVLE-VCCAAYEPLPLATLARVLEWDVYEQRDAGETLGSLFSIEAGND  279215

Query  546     GTYHIV---SSALFDWLTDPQRKGEPYHVDVT  574
                   I+    S++ DW+ D    G  + VDVT
Sbjct  279214  PESQILRPFHSSVLDWVQDSNSSG-VFFVDVT  279122

>PYVX:scaffold_674 pve_scaffold_674 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_674:1:16178:1 
REF
Length=16178

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 94/462 (20%), Positives = 174/462 (38%), Gaps = 89/462 (19%)
 Frame = -1

Query  186    SVRLTQLAPVDDSALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQE  243
              + R  QLA    +AL   L  E Q   LF LL  FS + Q+         R+W F RVQ+
Sbjct  10418  AARKDQLA----TALRGQLDHEGQQARLFSLLSPFSFQQQISKLTYRFTGRDWLFKRVQQ  10251

Query  244    WLDSRFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLS  287
              W++   +     +  + G  G+GKT                HF   E       R  +LS
Sbjct  10250  WINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTFPEIAAFHFALQEDDQTHIARRCVLS  10071

Query  288    VVNQLTATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGL  346
              +  QLT  LP +   L +R  L+ ++  +    L   +LV+PL +++ P     +L+DGL
Sbjct  10070  LAYQLTTQLPEYGVFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRPAKPLILLIDGL  9891

Query  347    DQCGVANGY-----------------NDLLDFLSVVVPECPSWLGFLITTKPSPEFAQK-  388
               +C V+                      L+  L  +V   PSW+  ++ ++   +   + 
Sbjct  9890   -ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLSREDHDVMTRL  9714

Query  389    ---VPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGN------Y  439
                 +P   +  F+ +N   +           A+ P +  AD  +    ++ G        
Sbjct  9713   QTYIPSVVIDHFAQENECDIKKFVG-----SALAPKKSLADIVEAATAETSGRSRLTTLA  9549

Query  440    SYLEFTRQAMSNPGMEAPQ------------------------GSVPVDVLHDLPQSLYE  475
               ++ F R   + PG    Q                        G V ++ L  LP  +  
Sbjct  9548   RHVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGIEEGRVALNELDKLPTGMGG  9369

Query  476    IYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRR  535
                 + F+  F     +   +  P L+++  A    Y  +T   +   L +   + R +  
Sbjct  9368   CLRQFFDSHFDDNTYKTTIR--PALEVLCAA----YEPLTMDALAKVLEWDIYEQREVVA  9207

Query  536    AFIDIISIRHGTYHI--VSSALFDWLTDPQRKGEPYHVDVTL  575
               F  ++ +  G   +    S++ +W+ + +  G  ++ DV++
Sbjct  9206   TFGSLLYVAEGDNFVRPFHSSVLEWVQNSRAAGR-FYADVSI  9084

>PHRA:scaffold_26
Length=535347

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 78/180 (43%), Gaps = 30/180 (17%)
 Frame = -1

Query  198    SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRF------  249
              SAL   L  E Q   LF LL  F+ + Q+         REW F++ Q W+          
Sbjct  46884  SALEGTLDHEGQQARLFSLLAPFNFQRQISQLTERFIGREWLFEQFQWWVQGSSLSNSST  46705

Query  250    ---NVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVN  290
                  V +  +  +VG  G+GKT                HF + E +   SPR  +LS+  
Sbjct  46704  TTREVSNQRVFWVVGQIGSGKTSVAARMVQSCPEIAAFHFARQEDEQTHSPRRCVLSLAY  46525

Query  291    QLTATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLD  347
              QLT  LP +   L +   L+ ++       L   +L+ PL+++  P T K   +L+DG++
Sbjct  46524  QLTTQLPEYAHYLQSHEPLEEMVPVASFTELVTHLLIGPLSAIARPTTYKSLVLLIDGVE  46345

>PYAP:scaffold_554 pag1_scaffold_554 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_554:1:21860:1 
REF
Length=21860

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 21/157 (13%)
 Frame = -3

Query  212    LFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT--  268
              LF LL  FS ++Q+    +    R W  + +++W+++    GS V   + G  G+GKT  
Sbjct  20127  LFSLLSPFSFQLQISQLTQRFTGRAWLLESIRQWINTPVTSGSKVFW-VTGQIGSGKTSV  19951

Query  269    --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLN-LKYVLE  313
                            HF   +       R  +LS+  QLT  LP +   L   + L+ ++ 
Sbjct  19950  AARMVQLMPEIAAFHFALQDDDQTQLARRCVLSLAYQLTTQLPEYAVFLQTGDPLEEIVP  19771

Query  314    ETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLDQ  348
               + V AL   +LV+PL ++  P + K   +L+DGL+ 
Sbjct  19770  VSSVQALLTHLLVNPLNAIARPKSDKPVVLLIDGLEH  19660

>PYIW:scaffold_205 piw_scaffold_205 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_205:1:24899:1 
REF
Length=24899

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 78/173 (45%), Gaps = 25/173 (14%)
 Frame = +2

Query  198    SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDV  255
              +AL   L  E Q   LF +L   S + Q+         REW F +++ W+ S     +  
Sbjct  20876  TALKGKLDHEGQQTRLFSILSPLSFQQQISKLTSRFAGREWLFAQLESWIASP---SAAQ  21046

Query  256    LLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTF  299
              +  + G  G+GKT                HF   E +   + R  +LS+  QLT  LP +
Sbjct  21047  VFWVTGQIGSGKTALAARMVQLIPEIAAFHFALQEDEQTQNARRCVLSLAYQLTTQLPQY  21226

Query  300    KSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK---FVLLDGLDQ  348
               S L +R  L+ ++  ++   L  ++LV+PL  +  P TA     +L+DGL+ 
Sbjct  21227  ASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARPQTATKPLVLLIDGLEH  21385

>PHIF:NW_003303706.1 Phytophthora infestans T30-4 supercont1.53 
genomic scaffold, whole genome shotgun sequence
Length=932874

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 94/230 (41%), Gaps = 38/230 (17%)
 Frame = -3

Query  198     SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLD----SRFNV  251
               SAL   L  E Q   LF LL  FS + Q+         REW F   Q W+     S   +
Sbjct  153754  SALEGTLDHEGQQTRLFSLLSPFSFQRQISHLTETFVGREWLFQLFQRWVQGSAASTREL  153575

Query  252     GSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLTAT  295
                +  +  ++G  G+GK+                HF   E +   + R  +LS+  QLT  
Sbjct  153574  SNQRVFWVIGQIGSGKSSVAACMVQACPEIAAFHFATQEDEQTHNARRCVLSLAYQLTTQ  153395

Query  296     LPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLD-----  347
               LP +   L +   L+ ++     + L   +L+ PL ++  P   K   +L+DG++     
Sbjct  153394  LPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNAIARPSKYKSLVLLIDGVEWLLPA  153215

Query  348     QCGVANGYN--------DLLDFLSVVVPECPSWLGFLITTKPSPEFAQKV  389
                C   NG +         L+  L ++V   P W+  ++ ++  P    K+
Sbjct  153214  SCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIVLLSREEPPVLSKL  153065

>PHKE:scaffold_386 scf_22126_386.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_386.1:1:33848:1 
REF
Length=33848

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/228 (24%), Positives = 89/228 (39%), Gaps = 52/228 (23%)
 Frame = +1

Query  208   QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNV--------------G  252
             Q   LF LL  FS + Q+         REW F+  Q W++   ++              G
Sbjct  7831  QQTRLFSLLAPFSFQRQISQLTERFVGREWLFNIFQRWVEGFPSIGSSSSSSSTTSRELG  8010

Query  253   SDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLTATL  296
             S  +  +VG  G GKT                HF + E +   + R  +LS+  QLT  L
Sbjct  8011  SQRVFWVVGQIGAGKTSVAARLVQSCPEIAAFHFAQQEDEQTHNARRCVLSLAYQLTTQL  8190

Query  297   PTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGY  355
             P +   L +   L+ ++       L   +LV PL ++  P  +  +L+DGL+    A+  
Sbjct  8191  PEYAHYLQSHEPLEEMVPVASFPELVTNLLVGPLNAIARPSKSLVLLIDGLEWLIPASSS  8370

Query  356   ND--------------------LLDFLSVVVPECPSWLGFLITTKPSP  383
             +                     L+  L  +VP  P W+ F++ ++  P
Sbjct  8371  SSPPSLSSLSMSSWKESKEEECLVSMLPSLVPRLPEWVRFVLLSREDP  8514

>PYIR:scaffold_32 pir_scaffold_32 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_32:1:78258:1 
REF
Length=78258

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 88/195 (45%), Gaps = 30/195 (15%)
 Frame = +3

Query  186    SVRLTQLAPVDDSALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQE  243
              S+R  QL     +AL   L  E Q   LF +L   S + Q+         REW F +++ 
Sbjct  74346  SIRKDQLV----TALKGKLDHEGQQARLFSILSPLSFQQQISKLTSRFAGREWLFMQLEN  74513

Query  244    WLDSRFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLS  287
              W+ S     +  +  + G  G+GKT                HF   E +   + R  +LS
Sbjct  74514  WIASP---TATQVFWVTGQIGSGKTALAARMVQVIPEIAAFHFALQEDEQTQNARRCVLS  74684

Query  288    VVNQLTATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLD  344
              +  QLT  LP +   L +R  L+ ++  ++   L  ++LV+PL  +  P + K   +L+D
Sbjct  74685  LAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARPQSTKPLVLLID  74864

Query  345    GLDQCGVANGYNDLL  359
              GL+   +++G N  L
Sbjct  74865  GLEH--LSSGKNSQL  74903

>PHPA:scaffold_24 NW_008649010.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.24, whole genome shotgun 
sequence
Length=888348

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 98/454 (22%), Positives = 171/454 (38%), Gaps = 96/454 (21%)
 Frame = +2

Query  198     SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWL------DSRF  249
               SAL   L  E Q   LF LL  F+ + Q+     +   REW F++ Q W+       S  
Sbjct  423224  SALEGTLDHEGQQARLFSLLAPFNFQRQISHLTENFIGREWLFEQFQRWVQGSAASSSTR  423403

Query  250     NVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLT  293
                + +  +  +VG  G+GKT                H    E +   + R  +LS+  QLT
Sbjct  423404  ELSNQRVFWVVGQIGSGKTSVAACMVQSCPEIAAFHLATQEDEQTHNARRCILSLAYQLT  423583

Query  294     ATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLDQCG  350
                 LP +   L +   L+ ++     + L   +L+ PL ++  P   K   +L+DG++   
Sbjct  423584  TQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLTAIARPSKYKSLVLLIDGVEWLI  423763

Query  351     VANGYNDLLDF-----------------LSVVVPECPSWLGFLITTKPSPEFAQKV----  389
                A+  + +  F                 L ++V   P W+  ++ ++  P    K+    
Sbjct  423764  PASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLPEWVRIVLLSREEPPVLSKLRAFD  423943

Query  390     -PVTSLLDFSAKNAA----YVND-------TAVLLRDIVAIFPTEDQAD-------ATQI  430
                P  ++  F  +N      Y+N        + V      A   T+   +         ++
Sbjct  423944  PPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEKAAAQIGTDSGNNHEFGMEQVVEL  424123

Query  431     LKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFG----  486
               +  +S G + Y     QA+S       +G + +  L +LP  +    ++ F   F     
Sbjct  424124  IARRSEGLFLYAVNVVQAIS-------EGRLHLHELAELPVGMGAYLQQFFASHFADHDM  424282

Query  487     -KGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRH  545
                K R R      PVL+ +  AA  P    T   V++   Y + D   +      + SI  
Sbjct  424283  YKHRVR------PVLE-VCCAAYEPLPVATIARVLEWDVYEQRDAATV---LGSLFSIEA  424432

Query  546     G------TYHIVSSALFDWLTDPQRKGEPYHVDV  573
               G      T     +++ DW+ D    G  + VDV
Sbjct  424433  GNDPETQTLRPFHTSVLDWVRDSSSSG-VFFVDV  424531

>PYAR:scaffold_139 par_scaffold_139 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_139:1:29266:1 
REF
Length=29266

 Score = 47.0 bits (110),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 60/134 (45%), Gaps = 21/134 (16%)
 Frame = +2

Query  234    REWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKG  277
              R W F+ +++W+D+  N  S  +  + G  G GKT                HF   E   
Sbjct  27917  RAWLFETIRDWIDAPHN--SSKVFWVTGQIGAGKTSVAAKMVQTIPEIAAFHFALQEDDQ  28090

Query  278    KSSPRNVLLSVVNQLTATLPTFKSQLARLN-LKYVLEETDVLALARKVLVDPLASLEEPL  336
                  R  +LS+  QLT  LP +   L     L+ ++  + V +L   +L+ PL ++  P 
Sbjct  28091  TQLARRCVLSLAYQLTTQLPAYAVFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPK  28270

Query  337    TAK--FVLLDGLDQ  348
              + K   +L+DGL+ 
Sbjct  28271  SDKPLILLIDGLEH  28312

Lambda      K        H        a         alpha
   0.318    0.133    0.382    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 225979041704

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40