Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHPA:scaffold_632474992478281105514e-65
PHIF:NW_003303697.13976203979401093064e-32
PHSO:scaffold_127964312796715952731e-27
PHRA:scaffold_56158473158763972545e-25
PLHA:NW_020189861.1185105118513501002113e-19
PHKE:scaffold_986322663498912033e-18
PHCA:scaffold_8497851981501001991e-17
HYAP:scaffold_59158813159088921813e-15
PYIR:scaffold_810424510448181820.073
PYUU:scaffold_2030559585620081750.73
PYVX:scaffold_2753917409961731.1
PHCA:scaffold_60317823194965721.5
SAPA:scaffold_5213179331649693.7
SAPA:scaffold_4114388814402549685.2
APAS:scaffold_54419514210959678.4
PYUU:scaffold_198752846952859442678.6
SADI:scaffold_1334608478763669.5
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PPTG_24025

Length=110
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  216        4e-65
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  122        4e-32
PHSO:scaffold_1                                                       109        1e-27
PHRA:scaffold_56                                                      102        5e-25
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  85.9       3e-19
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  82.8       3e-18
PHCA:scaffold_84 PHYCAscaffold_84                                     81.3       1e-17
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  74.3       3e-15
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  36.2       0.073
PYUU:scaffold_2030 scf1117875582030 dna:supercontig supercontig:p...  33.5       0.73 
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  32.7       1.1  
PHCA:scaffold_60 PHYCAscaffold_60                                     32.3       1.5  
SAPA:scaffold_521 supercont2.521 dna:supercontig supercontig:ASM1...  31.2       3.7  
SAPA:scaffold_41 supercont2.41 dna:supercontig supercontig:ASM151...  30.8       5.2  
APAS:scaffold_54 supercont1.54 dna:supercontig supercontig:Apha_a...  30.4       8.4  
PYUU:scaffold_1987 scf1117875581987 dna:supercontig supercontig:p...  30.4       8.6  
SADI:scaffold_133 supercont1.133 dna:supercontig supercontig:Sap_...  30.0       9.5  

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +2

Query  1       MLPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEG  60
               MLPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEG
Sbjct  247499  MLPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEG  247678

Query  61      ASVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC  110
               ASVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC
Sbjct  247679  ASVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC  247828

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 122 bits (306),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +3

Query  2       LPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGA  61
               LP CD  AEE QK+VT  HK    A PHKGRR VL G  + PK   DV+LG T PLLE  
Sbjct  397620  LPDCDTRAEEGQKLVTPTHKY--CAAPHKGRRHVLSGPRIGPKMSGDVILGRT*PLLESV  397793

Query  62      SVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC  110
               +V +RV LK Y+VRVQHLHGR HLSGL E R  LPSS+V+R HGR +SC
Sbjct  397794  TVFKRVGLKGYAVRVQHLHGRCHLSGLHEGRARLPSSDVKRSHGRAQSC  397940

>PHSO:scaffold_1
Length=13391543

 Score = 109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  6        DAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGASVLE  65
                D  AEE Q+VV +AH+RRRVA PHKGRR VL GLGV  K G +V L   EP+LEG SVLE
Sbjct  2796431  DTRAEEGQQVVAAAHERRRVAAPHKGRRHVLYGLGVGSKAGGEVALRDAEPVLEGVSVLE  2796610

Query  66       RVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEV  100
                RV L+ ++VRVQHLHGRRHL GL E R    ++ +
Sbjct  2796611  RVRLEGHAVRVQHLHGRRHLRGLHEGRACTDNAWI  2796715

>PHRA:scaffold_56
Length=334739

 Score = 102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -3

Query  5       CDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGASVL  64
               CD+  EE Q+VV SAH+R  VA P+K RR V  GLG+ PK    V  G  +PLLEG +VL
Sbjct  158763  CDS*PEEGQQVVASAHERCGVAAPNKRRRHVRIGLGICPKARGKVRFGLAQPLLEGVAVL  158584

Query  65      ERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVE  101
               ERV L+ +++RVQHLHGR H   LDERRT  P+ +VE
Sbjct  158583  ERVHLEGHALRVQHLHGRHHFPSLDERRTCPPTGDVE  158473

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +3

Query  3        PRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGAS  62
                P CDA +++  KVVT+AHKRR VA PHK RR +L  LG S K  + V LG  +P  +   
Sbjct  1851051  PYCDARSKKK*KVVTAAHKRRGVAAPHKRRRYMLHCLGFSTKADSKVPLGCFKPYPKFFP  1851230

Query  63       VLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVER  102
                VL+    +  +VR+ HLHG  +L  LD+ RTSLPSSEVER
Sbjct  1851231  VLK*KDFEGQAVRI*HLHGGDYLPRLDKGRTSLPSSEVER  1851350

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +1

Query  3      PRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGAS  62
              P  +AGAE+ Q+VV + HK   +A PHK RR V   LGV PK    ++LG   PLLE  S
Sbjct  63226  PDSNAGAEKRQQVVAATHKFDGIAAPHKWRRHVRHCLGVRPKVHDKMILGRA*PLLESVS  63405

Query  63     VLERVSLKAYSVRVQHLHGRRHLSGLDERRT  93
              VLE V L+ + VR+QHLH R HL  L E RT
Sbjct  63406  VLEGVCLEGHFVRIQHLHSRSHLPSLREGRT  63498

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = +3

Query  2      LPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGA  61
              +P  D  +E  Q +V S H+   VA P++  R VL GLG+  +     +LG T+P+LEG 
Sbjct  97851  VPHSDTRSEISQ*IVASTHESCGVAAPYERGRHVLRGLGIDSEARGKFVLGLTKPVLEGF  98030

Query  62     SVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVE  101
              SVL+R+  K +SV V+HLHG  H S  DE RT LP+ +VE
Sbjct  98031  SVLKRMEFKCHSVGVEHLHGCSHFSSFDEGRTCLPAGDVE  98150

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 74.3 bits (181),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -3

Query  2       LPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGA  61
               +P  DA  E  Q++V +AHKRR V  P+K  R V    GV  K    V +   EPLLEG 
Sbjct  159088  IPDSDARPENRQQIVAAAHKRRGVTDPYKR*RHVRRSFGVKSKLCDKVFIRRAEPLLEGV  158909

Query  62      SVLERVSLKAYSVRVQHLHGRRHLSGLDERRT  93
               SVLERV L++++  + H+HG  HL  L ER T
Sbjct  158908  SVLERVRLESHTAWIHHVHGGSHLLSLHERGT  158813

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 36.2 bits (82),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 4/81 (5%)
 Frame = -1

Query  9       AEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVL--LGGTEPLLEGASVLER  66
               +E+ ++VVT+A +  RV  PH+ R  V   L +  +T  ++L      EPL E  +V + 
Sbjct  104481  SEQRERVVTAADEAARV-RPHERR*LVGQRLRIRTETLRELLNRAARREPLAERLAVRKL  104305

Query  67      VSLKAYSVRVQHLHGRRHLSG  87
               V LK + VRVQH H RRH  G
Sbjct  104304  VELKVHDVRVQHAH-RRHDIG  104245

>PYUU:scaffold_2030 scf1117875582030 dna:supercontig supercontig:pug:scf1117875582030:1:300584:1 
REF
Length=300584

 Score = 33.5 bits (75),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 33/81 (41%), Gaps = 2/81 (2%)
 Frame = +2

Query  5      CDAGAEECQKVVTSAHKRRRVATP--HKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGAS  62
              CD G   C++V     +R  V  P  H  RRDVLC +        D   G  +PL+  + 
Sbjct  55958  CDVGDARCRQVRNIFRRRADVYNPWPHVPRRDVLCQVPERGLCRFDCKTGHPDPLVASSR  56137

Query  63     VLERVSLKAYSVRVQHLHGRR  83
                 RV       R   LH RR
Sbjct  56138  RYPRVHDGPRGHRSHVLHARR  56200

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 32.7 bits (73),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 32/61 (52%), Gaps = 0/61 (0%)
 Frame = -3

Query  9     AEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGASVLERVS  68
             AE  Q+ V  A KRRRVA PH+ RR V     + P+   + L    EP  EG +V E V 
Sbjct  4099  AEPVQQRVAPADKRRRVARPHERRRHVRDSRRLVPERRGEGLARRREPRAEGVAVREPVD  3920

Query  69    L  69
             L
Sbjct  3919  L  3917

>PHCA:scaffold_60 PHYCAscaffold_60
Length=366873

 Score = 32.3 bits (72),  Expect = 1.5, Method: Composition-based stats.
 Identities = 18/65 (28%), Positives = 31/65 (48%), Gaps = 13/65 (20%)
 Frame = +3

Query  14     KVVTSAHKR----RRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGASVLERVSL  69
              +V  + ++R    R V  PH           VSP TG  ++     PL+ G  +LE+++ 
Sbjct  31782  EVTVTQYRRINPVRSVHLPH---------FEVSPVTGPSIIWFSPSPLIGGTELLEKIAF  31934

Query  70     KAYSV  74
              K Y++
Sbjct  31935  KCYTI  31949

>SAPA:scaffold_521 supercont2.521 dna:supercontig supercontig:ASM15154v2:supercont2.521:1:5986:1 
REF
Length=5986

 Score = 31.2 bits (69),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
 Frame = +2

Query  39    LGVSPKTGTDVLLGGTEPLLEGASVLERVSLKAYSVRVQHLHGRRHLSG  87
             LGV P+T  DV LGG  P  +GA  + RV  ++ +V    L  RR L  
Sbjct  3179  LGVGPETFKDVALGG--PTKDGADAVHRV-FRSVAVEANDLFVRRGLEA  3316

>SAPA:scaffold_41 supercont2.41 dna:supercontig supercontig:ASM15154v2:supercont2.41:1:291970:1 
REF
Length=291970

 Score = 30.8 bits (68),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
 Frame = +2

Query  39      LGVSPKTGTDVLLGGTEPLLEGASVLERVSLKAYSVRVQHLHGRRHLSG  87
               LGV P+T  DV LGG  P  +GA  + RV  ++ +V    L  RR L  
Sbjct  143888  LGVGPETFEDVALGG--PTKDGADAVHRV-FRSVAVEANDLFVRRGLEA  144025

>APAS:scaffold_54 supercont1.54 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.54:1:437387:1 
REF
Length=437387

 Score = 30.4 bits (67),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 30/59 (51%), Gaps = 11/59 (19%)
 Frame = +2

Query  3      PRCDAGAEECQKVVTSAHKRRRVATP----HKGRRDV-LCGLGVSPKTGTDVLLGGTEP  56
              P+ D   EEC++V    H  +RV  P    HKGRRD  +C     P  GT   +GG +P
Sbjct  41951  PKQDHQCEECKRV----HATQRVHLPAQGHHKGRRDPKVCEY--DPVVGTPPPVGGQQP  42109

>PYUU:scaffold_1987 scf1117875581987 dna:supercontig supercontig:pug:scf1117875581987:1:709757:1 
REF
Length=709757

 Score = 30.4 bits (67),  Expect = 8.6, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (48%), Gaps = 0/42 (0%)
 Frame = -3

Query  69      LKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC  110
               L  Y +RVQH    RHLS  D  R +L    V+     VR C
Sbjct  528594  LTNYQLRVQHESETRHLSDADATRIALMRVHVKFFKNYVRWC  528469

>SADI:scaffold_133 supercont1.133 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.133:1:102676:1 
REF
Length=102676

 Score = 30.0 bits (66),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 25/63 (40%), Gaps = 3/63 (5%)
 Frame = -3

Query  6     DAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEGASVLE  65
             D     C+   T  H+RRR    H  RRD+  G   S    T   L G  P    A+ L 
Sbjct  4787  DGATRPCR---TYTHQRRRSGVLHAWRRDLGSGTMTSNNQYTISTLRGYRPWSSNAATLS  4617

Query  66    RVS  68
             R S
Sbjct  4616  RPS  4608

Lambda      K        H        a         alpha
   0.318    0.134    0.399    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10676481400

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40