Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHPA:scaffold_6325087125192335117090.0
PHIF:NW_003303697.143090543195735115970.0
PHSO:scaffold_12799766280080935114830.0
PHRA:scaffold_5615021115125735114750.0
PHCA:scaffold_8410026710131935114720.0
PLHA:NW_020189861.11844377184541135114112e-176
PHKE:scaffold_98671456819735113822e-172
PYVX:scaffold_275154722182346952e-84
PYAP:scaffold_16220074206972196051e-83
PYUU:scaffold_2037130791813083431455188e-83
PYAR:scaffold_2916051165511785021e-66
PYIW:scaffold_96310491114173185823e-65
PYIR:scaffold_81013741018261514946e-56
ALLA:FR82410411308119162144351e-45
ALCA:scaffold_90858989631284013e-41
APAS:scaffold_127075497084573122855e-26
SAPA:scaffold_243945663949041202602e-23
SADI:scaffold_42040862044211172474e-21
APIN:scaffold_203997224000541182251e-19
PYAR:scaffold_2744363539491241516e-09
PHRA:scaffold_13064799650771151364e-07
PYUU:scaffold_20076874176876951151355e-07
HYAP:scaffold_842731712734491161355e-07
PYIW:scaffold_452132716591321346e-07
ALCA:scaffold_7870306706261251321e-06
PHSO:scaffold_8252771125279891151312e-06
PYIR:scaffold_755848488191321302e-06
PHCA:scaffold_133421653424641181284e-06
PHPA:scaffold_891005741008461091275e-06
PHIF:NW_003303587.154941552071071266e-06
PHKE:scaffold_26215984162621151231e-05
ALLA:FR82410366848671681251222e-05
PYVX:scaffold_518520355051191212e-05
APAS:scaffold_138595408598391191213e-05
SAPA:scaffold_2067059674061381151e-04
SADI:scaffold_52215030215155441151e-04
APIN:scaffold_17898337901231191151e-04
PYAP:scaffold_12339125394241191132e-04
PYAP:scaffold_1374095741055351133e-04
PYAR:scaffold_112420072102341114e-04
HYAP:scaffold_797365540171351060.002
PHKE:scaffold_206526756471411060.002
PHPA:scaffold_11460130605161471060.002
PYUU:scaffold_123951639520101421050.002
PYIR:scaffold_23118901192211131050.002
PHRA:scaffold_731851621855661531050.002
PYIR:scaffold_316929896301291020.006
HYAP:scaffold_111953781195479341020.006
PHIF:NW_003303669.13701133704991471010.008
PHCA:scaffold_201296901300761471000.009
PHSO:scaffold_49711889715771481000.010
PYAP:scaffold_21220888212801491000.010
PYIR:scaffold_88241312421729990.011
PHSO:scaffold_223100742310436135990.014
PYUU:scaffold_202331354331363832980.016
APIN:scaffold_378081978104683980.017
PYIW:scaffold_4522565234229980.018
PLHA:NW_020189964.1880323880679133970.021
PHIF:NW_003303740.122690732269336111960.027
PHRA:scaffold_47980680168135960.030
ALCA:scaffold_1611153911162529950.041
PHIF:NW_003303698.1681509681820118950.043
PHPA:scaffold_5694361694672118940.044
PYAR:scaffold_2221325713532110940.046
PHCA:scaffold_1069910899419118940.048
ALLA:FR824067835688365429940.056
PYVX:scaffold_3785146535576930.068
PYIW:scaffold_38855505825110930.070
ALLA:FR824088103597103872110920.076
SADI:scaffold_1206412206684109920.080
PHKE:scaffold_129535065358025920.080
ALLA:FR824075487454884944920.084
APIN:scaffold_1187652087673879920.092
PHRA:scaffold_27488774894824920.097
SADI:scaffold_3742172742474119910.10
PHPA:scaffold_3257848657856025910.12
ALCA:scaffold_12166046879110910.12
PHPA:scaffold_71543419154352337910.13
PHCA:scaffold_1810753810764237900.14
PYIW:scaffold_649153881549237900.14
PYVX:scaffold_12542645433524900.14
APAS:scaffold_5939623939898110900.14
PHIF:NW_003303691.136411336418424900.14
PYVX:scaffold_51342213715116900.15
APAS:scaffold_25221782234857900.15
PHPA:scaffold_4230401330415956900.16
PHRA:scaffold_3837789737800137900.16
HYAP:scaffold_7222699922710337900.16
PHIF:NW_003303756.13548762354886637900.17
SAPA:scaffold_27326772949109890.17
PYVX:scaffold_119016651958114890.18
PHCA:scaffold_21737859173795131890.18
APAS:scaffold_4935978735988234890.18
PLHA:NW_020187174.1307033307413145890.18
SAPA:scaffold_45943159439830890.20
SADI:scaffold_2736590336599834890.21
PHKE:scaffold_69488694899444890.21
PYUU:scaffold_203526286626303962890.22
PHCA:scaffold_984440684455256890.23
APIN:scaffold_8307116307391110880.23
PYAP:scaffold_610185821868334880.23
PYIW:scaffold_12159088923456880.23
ALCA:scaffold_2659548964031880.25
PHKE:scaffold_62641234473146880.26
SAPA:scaffold_1951827651837134880.27
PYUU:scaffold_20341065680106579942880.28
PYIR:scaffold_115562515572937880.28
ALLA:FR8245027653774531880.28
PYAP:scaffold_875436554639880.29
APIN:scaffold_2275876276214126880.29
SAPA:scaffold_2835917836192110870.31
SAPA:scaffold_70163071643847870.32
SAPA:scaffold_3710664510675539870.35
PLHA:NW_020189293.11002284100240342870.37
ALCA:scaffold_34512775136329860.39
PYIR:scaffold_185321812474114860.40
PYAR:scaffold_11163823392737860.42
PYUU:scaffold_200680423580435445860.42
PYAR:scaffold_9511045210787128850.50
PYAP:scaffold_7471308913541167850.51
ALLA:FR824181259082600633860.51
ALLA:FR824176425044260233860.51
PYIW:scaffold_151132503552117850.52
SADI:scaffold_1353737853748839850.53
APIN:scaffold_1248684848695839850.56
SAPA:scaffold_4677465757840850.59
PYVX:scaffold_291294142951233850.63
PYUU:scaffold_1722480514819756850.66
PYAP:scaffold_115416154496133840.79
SADI:scaffold_6926514726523030840.84
SADI:scaffold_1725322125336455840.85
APAS:scaffold_41422026142216351840.86
APAS:scaffold_21220973122108339840.86
ALLA:FR8244715756593562840.86
PHCA:scaffold_27527809528093119840.88
PHKE:scaffold_269175251767156830.92
HYAP:scaffold_99215392163432830.94
PHCA:scaffold_42349768350103124831.0
ALCA:scaffold_559267093098162831.1
ALCA:scaffold_1313686513708373821.3
PHRA:scaffold_16436829437113119821.3
HYAP:scaffold_29315553165034821.4
PHKE:scaffold_581976420051117821.5
SADI:scaffold_157629876654127821.5
HYAP:scaffold_46109870110154119821.5
PYAR:scaffold_1222028212334811.6
PYVX:scaffold_44139871413356811.6
APAS:scaffold_22441048441431136811.6
SADI:scaffold_25488924898433811.6
APAS:scaffold_151066084106618837811.6
APAS:scaffold_18972449739653811.7
SAPA:scaffold_5889578904933811.7
PHPA:scaffold_98619366203132811.7
PHSO:scaffold_33934544393463932802.1
SAPA:scaffold_6503388503738125802.1
PHCA:scaffold_1454790854807558802.1
PYIW:scaffold_784978510108133802.1
PHRA:scaffold_827880679141130802.2
HYAP:scaffold_312100531020558802.4
PHIF:NW_003303710.175602175611632802.4
PHRA:scaffold_66685686866332802.5
PHKE:scaffold_2385279546462802.6
APIN:scaffold_141143919114402337802.7
ALCA:scaffold_25249542509756802.7
PHKE:scaffold_90862038629832792.8
PHIF:NW_003303741.11388027138812234792.9
PHIF:NW_003303755.11389029138912435793.0
PLHA:NW_020187350.176963876973334793.1
PHRA:scaffold_1529454529780116793.1
PLHA:NW_020190023.11843064184315932793.2
PHPA:scaffold_1638270738280234793.5
PHKE:scaffold_2615720315729834783.7
PHRA:scaffold_67569535704834783.7
PHPA:scaffold_5312091912101435783.8
ALCA:scaffold_29171971729534783.9
SAPA:scaffold_4023001223020070784.0
PYVX:scaffold_7221160511952140784.2
SAPA:scaffold_3411344157780784.2
APIN:scaffold_71534495361959784.5
PYAP:scaffold_549187991889434784.5
PYIR:scaffold_12353513361436774.7
PYAR:scaffold_9956868700251774.8
PLHA:NW_020189809.1779623779910117775.0
ALCA:scaffold_49388373898650775.1
PYVX:scaffold_478296845154775.1
PYIW:scaffold_22665099528467775.3
PYAR:scaffold_2672250236342775.4
PYVX:scaffold_35560645621352775.4
HYAP:scaffold_322269942708031775.5
PYIR:scaffold_47543095440733775.6
PYAR:scaffold_28071055126472765.7
PLHA:NW_020187331.1208317208679155775.8
PHCA:scaffold_72709047099932775.9
PHRA:scaffold_366157466172056776.0
APIN:scaffold_59307831308091111776.2
PYVX:scaffold_158154181551334766.3
ALCA:scaffold_464153371551963766.3
PYUU:scaffold_203845769945779434766.4
SADI:scaffold_7214554814570359766.4
PYIW:scaffold_12765585576766766.5
PYUU:scaffold_201131874731884836766.7
PYUU:scaffold_202513873113882632766.9
SAPA:scaffold_716223016238559766.9
PYIW:scaffold_735119471204232767.2
ALCA:scaffold_1109680976631767.2
PLHA:NW_020188201.18285844654767.3
PYVX:scaffold_1800318022271767.6
PYUU:scaffold_20326264162991133768.0
PYIR:scaffold_78480794817432758.4
PHIF:NW_003303737.152895252910152758.5
PHPA:scaffold_25906579080652758.8
APIN:scaffold_5436527236534324758.9
ALLA:FR824244134461353231758.9
PHSO:scaffold_54809230480936748759.2
SAPA:scaffold_1815658577440759.3
ALLA:FR824107265292663034759.4
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PPTG_17127

Length=351
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  662        0.0   
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  619        0.0   
PHSO:scaffold_1                                                       575        0.0   
PHRA:scaffold_56                                                      572        0.0   
PHCA:scaffold_84 PHYCAscaffold_84                                     571        0.0   
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  548        2e-176
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  536        2e-172
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  272        2e-84 
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  237        1e-83 
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  204        8e-83 
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  197        1e-66 
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  228        3e-65 
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  194        6e-56 
ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:...  172        1e-45 
ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig sup...  159        3e-41 
APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_a...  114        5e-26 
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  104        2e-23 
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  99.8       4e-21 
APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_i...  91.3       1e-19 
PYAR:scaffold_2744 par_scaffold_2744 dna:supercontig supercontig:...  62.8       6e-09 
PHRA:scaffold_130                                                     57.0       4e-07 
PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:p...  56.6       5e-07 
HYAP:scaffold_84 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  56.6       5e-07 
PYIW:scaffold_452 piw_scaffold_452 dna:supercontig supercontig:pi...  56.2       6e-07 
ALCA:scaffold_78 AcNc2_CONTIG_78_length_85802 dna:supercontig sup...  55.5       1e-06 
PHSO:scaffold_8                                                       55.1       2e-06 
PYIR:scaffold_755 pir_scaffold_755 dna:supercontig supercontig:pi...  54.7       2e-06 
PHCA:scaffold_13 PHYCAscaffold_13                                     53.9       4e-06 
PHPA:scaffold_89 NW_008649075.1 Phytophthora parasitica INRA-310 ...  53.5       5e-06 
PHIF:NW_003303587.1 Phytophthora infestans T30-4 supercont1.172 g...  53.1       6e-06 
PHKE:scaffold_262 scf_22126_262.1 dna:supercontig supercontig:Phy...  52.0       1e-05 
ALLA:FR824103 dna:supercontig supercontig:ENA1:FR824103:1:105777:...  51.6       2e-05 
PYVX:scaffold_518 pve_scaffold_518 dna:supercontig supercontig:pv...  51.2       2e-05 
APAS:scaffold_13 supercont1.13 dna:supercontig supercontig:Apha_a...  51.2       3e-05 
SAPA:scaffold_20 supercont2.20 dna:supercontig supercontig:ASM151...  48.9       1e-04 
SADI:scaffold_52 supercont1.52 dna:supercontig supercontig:Sap_di...  48.9       1e-04 
APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inv...  48.9       1e-04 
PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:p...  48.1       2e-04 
PYAP:scaffold_137 pag1_scaffold_137 dna:supercontig supercontig:p...  48.1       3e-04 
PYAR:scaffold_1124 par_scaffold_1124 dna:supercontig supercontig:...  47.4       4e-04 
HYAP:scaffold_797 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  45.4       0.002 
PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:Phy...  45.4       0.002 
PHPA:scaffold_114 NW_008649100.1 Phytophthora parasitica INRA-310...  45.4       0.002 
PYUU:scaffold_1239 scf1117875581239 dna:supercontig supercontig:p...  45.1       0.002 
PYIR:scaffold_231 pir_scaffold_231 dna:supercontig supercontig:pi...  45.1       0.002 
PHRA:scaffold_73                                                      45.1       0.002 
PYIR:scaffold_316 pir_scaffold_316 dna:supercontig supercontig:pi...  43.9       0.006 
HYAP:scaffold_1 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1:...  43.9       0.006 
PHIF:NW_003303669.1 Phytophthora infestans T30-4 supercont1.90 ge...  43.5       0.008 
PHCA:scaffold_20 PHYCAscaffold_20                                     43.1       0.009 
PHSO:scaffold_4                                                       43.1       0.010 
PYAP:scaffold_212 pag1_scaffold_212 dna:supercontig supercontig:p...  43.1       0.010 
PYIR:scaffold_88 pir_scaffold_88 dna:supercontig supercontig:pir_...  42.7       0.011 
PHSO:scaffold_2                                                       42.7       0.014 
PYUU:scaffold_2023 scf1117875582023 dna:supercontig supercontig:p...  42.4       0.016 
APIN:scaffold_3 supercont1.3 dna:supercontig supercontig:Apha_inv...  42.4       0.017 
PYIW:scaffold_4 piw_scaffold_4 dna:supercontig supercontig:piw_sc...  42.4       0.018 
PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig:...  42.0       0.021 
PHIF:NW_003303740.1 Phytophthora infestans T30-4 supercont1.19 ge...  41.6       0.027 
PHRA:scaffold_4                                                       41.6       0.030 
ALCA:scaffold_16 AcNc2_CONTIG_16_length_171156 dna:supercontig su...  41.2       0.041 
PHIF:NW_003303698.1 Phytophthora infestans T30-4 supercont1.61 ge...  41.2       0.043 
PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 u...  40.8       0.044 
PYAR:scaffold_222 par_scaffold_222 dna:supercontig supercontig:pa...  40.8       0.046 
PHCA:scaffold_106 PHYCAscaffold_106                                   40.8       0.048 
ALLA:FR824067 dna:supercontig supercontig:ENA1:FR824067:1:183579:...  40.8       0.056 
PYVX:scaffold_378 pve_scaffold_378 dna:supercontig supercontig:pv...  40.4       0.068 
PYIW:scaffold_388 piw_scaffold_388 dna:supercontig supercontig:pi...  40.4       0.070 
ALLA:FR824088 dna:supercontig supercontig:ENA1:FR824088:1:131184:...  40.0       0.076 
SADI:scaffold_1 supercont1.1 dna:supercontig supercontig:Sap_dicl...  40.0       0.080 
PHKE:scaffold_129 scf_22126_129.1 dna:supercontig supercontig:Phy...  40.0       0.080 
ALLA:FR824075 dna:supercontig supercontig:ENA1:FR824075:1:147583:...  40.0       0.084 
APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_i...  40.0       0.092 
PHRA:scaffold_27                                                      40.0       0.097 
SADI:scaffold_3 supercont1.3 dna:supercontig supercontig:Sap_dicl...  39.7       0.10  
PHPA:scaffold_32 NW_008649018.1 Phytophthora parasitica INRA-310 ...  39.7       0.12  
ALCA:scaffold_121 AcNc2_CONTIG_121_length_67320 dna:supercontig s...  39.7       0.12  
PHPA:scaffold_7 NW_008648993.1 Phytophthora parasitica INRA-310 u...  39.7       0.13  
PHCA:scaffold_18 PHYCAscaffold_18                                     39.3       0.14  
PYIW:scaffold_649 piw_scaffold_649 dna:supercontig supercontig:pi...  39.3       0.14  
PYVX:scaffold_12 pve_scaffold_12 dna:supercontig supercontig:pve_...  39.3       0.14  
APAS:scaffold_5 supercont1.5 dna:supercontig supercontig:Apha_ast...  39.3       0.14  
PHIF:NW_003303691.1 Phytophthora infestans T30-4 supercont1.68 ge...  39.3       0.14  
PYVX:scaffold_5 pve_scaffold_5 dna:supercontig supercontig:pve_sc...  39.3       0.15  
APAS:scaffold_25 supercont1.25 dna:supercontig supercontig:Apha_a...  39.3       0.15  
PHPA:scaffold_42 NW_008649028.1 Phytophthora parasitica INRA-310 ...  39.3       0.16  
PHRA:scaffold_38                                                      39.3       0.16  
HYAP:scaffold_72 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  39.3       0.16  
PHIF:NW_003303756.1 Phytophthora infestans T30-4 supercont1.3 gen...  39.3       0.17  
SAPA:scaffold_273 supercont2.273 dna:supercontig supercontig:ASM1...  38.9       0.17  
PYVX:scaffold_1190 pve_scaffold_1190 dna:supercontig supercontig:...  38.9       0.18  
PHCA:scaffold_2 PHYCAscaffold_2                                       38.9       0.18  
APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_a...  38.9       0.18  
PLHA:NW_020187174.1 Plasmopara halstedii genome assembly, contig:...  38.9       0.18  
SAPA:scaffold_45 supercont2.45 dna:supercontig supercontig:ASM151...  38.9       0.20  
SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_di...  38.9       0.21  
PHKE:scaffold_69 scf_22126_69.1 dna:supercontig supercontig:PhyKe...  38.9       0.21  
PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:p...  38.9       0.22  
PHCA:scaffold_9 PHYCAscaffold_9                                       38.9       0.23  
APIN:scaffold_8 supercont1.8 dna:supercontig supercontig:Apha_inv...  38.5       0.23  
PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:p...  38.5       0.23  
PYIW:scaffold_1215 piw_scaffold_1215 dna:supercontig supercontig:...  38.5       0.23  
ALCA:scaffold_265 AcNc2_CONTIG_265_length_35910 dna:supercontig s...  38.5       0.25  
PHKE:scaffold_626 scf_22126_626.1_contig_1 dna:supercontig superc...  38.5       0.26  
SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM151...  38.5       0.27  
PYUU:scaffold_2034 scf1117875582034 dna:supercontig supercontig:p...  38.5       0.28  
PYIR:scaffold_1 pir_scaffold_1 dna:supercontig supercontig:pir_sc...  38.5       0.28  
ALLA:FR824502 dna:supercontig supercontig:ENA1:FR824502:1:15894:1...  38.5       0.28  
PYAP:scaffold_87 pag1_scaffold_87 dna:supercontig supercontig:pag...  38.5       0.29  
APIN:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_inv...  38.5       0.29  
SAPA:scaffold_2 supercont2.2 dna:supercontig supercontig:ASM15154...  38.1       0.31  
SAPA:scaffold_70 supercont2.70 dna:supercontig supercontig:ASM151...  38.1       0.32  
SAPA:scaffold_37 supercont2.37 dna:supercontig supercontig:ASM151...  38.1       0.35  
PLHA:NW_020189293.1 Plasmopara halstedii genome assembly, contig:...  38.1       0.37  
ALCA:scaffold_34 AcNc2_CONTIG_34_length_127434 dna:supercontig su...  37.7       0.39  
PYIR:scaffold_1853 pir_scaffold_1853 dna:supercontig supercontig:...  37.7       0.40  
PYAR:scaffold_1116 par_scaffold_1116 dna:supercontig supercontig:...  37.7       0.42  
PYUU:scaffold_2006 scf1117875582006 dna:supercontig supercontig:p...  37.7       0.42  
PYAR:scaffold_951 par_scaffold_951 dna:supercontig supercontig:pa...  37.4       0.50  
PYAP:scaffold_747 pag1_scaffold_747 dna:supercontig supercontig:p...  37.4       0.51  
ALLA:FR824181 dna:supercontig supercontig:ENA1:FR824181:1:68077:1...  37.7       0.51  
ALLA:FR824176 dna:supercontig supercontig:ENA1:FR824176:1:68905:1...  37.7       0.51  
PYIW:scaffold_1511 piw_scaffold_1511 dna:supercontig supercontig:...  37.4       0.52  
SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_di...  37.4       0.53  
APIN:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_i...  37.4       0.56  
SAPA:scaffold_467 supercont2.467 dna:supercontig supercontig:ASM1...  37.4       0.59  
PYVX:scaffold_291 pve_scaffold_291 dna:supercontig supercontig:pv...  37.4       0.63  
PYUU:scaffold_1722 scf1117875581722 dna:supercontig supercontig:p...  37.4       0.66  
PYAP:scaffold_11 pag1_scaffold_11 dna:supercontig supercontig:pag...  37.0       0.79  
SADI:scaffold_69 supercont1.69 dna:supercontig supercontig:Sap_di...  37.0       0.84  
SADI:scaffold_17 supercont1.17 dna:supercontig supercontig:Sap_di...  37.0       0.85  
APAS:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_ast...  37.0       0.86  
APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_ast...  37.0       0.86  
ALLA:FR824471 dna:supercontig supercontig:ENA1:FR824471:1:18709:1...  37.0       0.86  
PHCA:scaffold_27 PHYCAscaffold_27                                     37.0       0.88  
PHKE:scaffold_269 scf_22126_269.1_contig_1 dna:supercontig superc...  36.6       0.92  
HYAP:scaffold_99 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_9...  36.6       0.94  
PHCA:scaffold_42 PHYCAscaffold_42                                     36.6       1.0   
ALCA:scaffold_55 AcNc2_CONTIG_55_length_103441 dna:supercontig su...  36.6       1.1   
ALCA:scaffold_13 AcNc2_CONTIG_13_length_192192 dna:supercontig su...  36.2       1.3   
PHRA:scaffold_16                                                      36.2       1.3   
HYAP:scaffold_29 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_2...  36.2       1.4   
PHKE:scaffold_58 scf_22126_58.1 dna:supercontig supercontig:PhyKe...  36.2       1.5   
SADI:scaffold_15 supercont1.15 dna:supercontig supercontig:Sap_di...  36.2       1.5   
HYAP:scaffold_46 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_4...  36.2       1.5   
PYAR:scaffold_122 par_scaffold_122 dna:supercontig supercontig:pa...  35.8       1.6   
PYVX:scaffold_44 pve_scaffold_44 dna:supercontig supercontig:pve_...  35.8       1.6   
APAS:scaffold_22 supercont1.22 dna:supercontig supercontig:Apha_a...  35.8       1.6   
SADI:scaffold_25 supercont1.25 dna:supercontig supercontig:Sap_di...  35.8       1.6   
APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_a...  35.8       1.6   
APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_a...  35.8       1.7   
SAPA:scaffold_5 supercont2.5 dna:supercontig supercontig:ASM15154...  35.8       1.7   
PHPA:scaffold_98 NW_008649084.1 Phytophthora parasitica INRA-310 ...  35.8       1.7   
PHSO:scaffold_3                                                       35.4       2.1   
SAPA:scaffold_6 supercont2.6 dna:supercontig supercontig:ASM15154...  35.4       2.1   
PHCA:scaffold_14 PHYCAscaffold_14                                     35.4       2.1   
PYIW:scaffold_784 piw_scaffold_784 dna:supercontig supercontig:pi...  35.4       2.1   
PHRA:scaffold_82                                                      35.4       2.2   
HYAP:scaffold_312 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  35.4       2.4   
PHIF:NW_003303710.1 Phytophthora infestans T30-4 supercont1.49 ge...  35.4       2.4   
PHRA:scaffold_66                                                      35.4       2.5   
PHKE:scaffold_238 scf_22126_238.1_contig_1 dna:supercontig superc...  35.4       2.6   
APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_i...  35.4       2.7   
ALCA:scaffold_25 AcNc2_CONTIG_25_length_153538 dna:supercontig su...  35.4       2.7   
PHKE:scaffold_90 scf_22126_90.1 dna:supercontig supercontig:PhyKe...  35.0       2.8   
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  35.0       2.9   
PHIF:NW_003303755.1 Phytophthora infestans T30-4 supercont1.4 gen...  35.0       3.0   
PLHA:NW_020187350.1 Plasmopara halstedii genome assembly, contig:...  35.0       3.1   
PHRA:scaffold_1                                                       35.0       3.1   
PLHA:NW_020190023.1 Plasmopara halstedii genome assembly, contig:...  35.0       3.2   
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  35.0       3.5   
PHKE:scaffold_26 scf_22126_26.1 dna:supercontig supercontig:PhyKe...  34.7       3.7   
PHRA:scaffold_67                                                      34.7       3.7   
PHPA:scaffold_53 NW_008649039.1 Phytophthora parasitica INRA-310 ...  34.7       3.8   
ALCA:scaffold_29 AcNc2_CONTIG_29_length_140563 dna:supercontig su...  34.7       3.9   
SAPA:scaffold_40 supercont2.40 dna:supercontig supercontig:ASM151...  34.7       4.0   
PYVX:scaffold_722 pve_scaffold_722 dna:supercontig supercontig:pv...  34.7       4.2   
SAPA:scaffold_341 supercont2.341 dna:supercontig supercontig:ASM1...  34.7       4.2   
APIN:scaffold_71 supercont1.71 dna:supercontig supercontig:Apha_i...  34.7       4.5   
PYAP:scaffold_549 pag1_scaffold_549 dna:supercontig supercontig:p...  34.7       4.5   
PYIR:scaffold_1235 pir_scaffold_1235 dna:supercontig supercontig:...  34.3       4.7   
PYAR:scaffold_995 par_scaffold_995 dna:supercontig supercontig:pa...  34.3       4.8   
PLHA:NW_020189809.1 Plasmopara halstedii genome assembly, contig:...  34.3       5.0   
ALCA:scaffold_49 AcNc2_CONTIG_49_length_115235 dna:supercontig su...  34.3       5.1   
PYVX:scaffold_47 pve_scaffold_47 dna:supercontig supercontig:pve_...  34.3       5.1   
PYIW:scaffold_2266 piw_scaffold_2266 dna:supercontig supercontig:...  34.3       5.3   
PYAR:scaffold_267 par_scaffold_267 dna:supercontig supercontig:pa...  34.3       5.4   
PYVX:scaffold_35 pve_scaffold_35 dna:supercontig supercontig:pve_...  34.3       5.4   
HYAP:scaffold_322 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  34.3       5.5   
PYIR:scaffold_47 pir_scaffold_47 dna:supercontig supercontig:pir_...  34.3       5.6   
PYAR:scaffold_2807 par_scaffold_2807 dna:supercontig supercontig:...  33.9       5.7   
PLHA:NW_020187331.1 Plasmopara halstedii genome assembly, contig:...  34.3       5.8   
PHCA:scaffold_72 PHYCAscaffold_72                                     34.3       5.9   
PHRA:scaffold_3                                                       34.3       6.0   
APIN:scaffold_59 supercont1.59 dna:supercontig supercontig:Apha_i...  34.3       6.2   
PYVX:scaffold_158 pve_scaffold_158 dna:supercontig supercontig:pv...  33.9       6.3   
ALCA:scaffold_464 AcNc2_CONTIG_464_length_18313 dna:supercontig s...  33.9       6.3   
PYUU:scaffold_2038 scf1117875582038 dna:supercontig supercontig:p...  33.9       6.4   
SADI:scaffold_72 supercont1.72 dna:supercontig supercontig:Sap_di...  33.9       6.4   
PYIW:scaffold_1276 piw_scaffold_1276 dna:supercontig supercontig:...  33.9       6.5   
PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:p...  33.9       6.7   
PYUU:scaffold_2025 scf1117875582025 dna:supercontig supercontig:p...  33.9       6.9   
SAPA:scaffold_7 supercont2.7 dna:supercontig supercontig:ASM15154...  33.9       6.9   
PYIW:scaffold_735 piw_scaffold_735 dna:supercontig supercontig:pi...  33.9       7.2   
ALCA:scaffold_110 AcNc2_CONTIG_110_length_72385 dna:supercontig s...  33.9       7.2   
PLHA:NW_020188201.1 Plasmopara halstedii genome assembly, contig:...  33.9       7.3   
PYVX:scaffold_1 pve_scaffold_1 dna:supercontig supercontig:pve_sc...  33.9       7.6   
PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:p...  33.9       8.0   
PYIR:scaffold_78 pir_scaffold_78 dna:supercontig supercontig:pir_...  33.5       8.4   
PHIF:NW_003303737.1 Phytophthora infestans T30-4 supercont1.22 ge...  33.5       8.5   
PHPA:scaffold_25 NW_008649011.1 Phytophthora parasitica INRA-310 ...  33.5       8.8   
APIN:scaffold_54 supercont1.54 dna:supercontig supercontig:Apha_i...  33.5       8.9   
ALLA:FR824244 dna:supercontig supercontig:ENA1:FR824244:1:48268:1...  33.5       8.9   
PHSO:scaffold_5                                                       33.5       9.2   
SAPA:scaffold_181 supercont2.181 dna:supercontig supercontig:ASM1...  33.5       9.3   
ALLA:FR824107 dna:supercontig supercontig:ENA1:FR824107:1:102118:...  33.5       9.4   

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/351 (100%), Positives = 351/351 (100%), Gaps = 0/351 (0%)
 Frame = -1

Query  1       MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
               MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC
Sbjct  251923  MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  251744

Query  61      HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
               HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA
Sbjct  251743  HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  251564

Query  121     DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
               DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS
Sbjct  251563  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  251384

Query  181     KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
               KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  251383  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  251204

Query  241     TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
               TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE
Sbjct  251203  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  251024

Query  301     LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
               LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF
Sbjct  251023  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  250871

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/351 (93%), Positives = 336/351 (96%), Gaps = 0/351 (0%)
 Frame = -2

Query  1       MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
               MNILRVPEHG TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC
Sbjct  431957  MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  431778

Query  61      HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
               HPP G+PSAPKG FYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA
Sbjct  431777  HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  431598

Query  121     DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
               DRNKWLEVARNAL  KRQLTRQAIDQSVSP KK LFGFSV+LSPQPAMSPQKQ+QTL+KS
Sbjct  431597  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  431418

Query  181     KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
               KDELLS+ALRELEAAKLVGREACNEIV+QGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  431417  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  431238

Query  241     TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
               TLHLFSDDSRPKSTG SKGSSPQR HQSGGSSP+RLPPA + SSDAG SDLERLAQALGE
Sbjct  431237  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  431058

Query  301     LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
               LEVQAE+LNGEA  SSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF
Sbjct  431057  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  430905

>PHSO:scaffold_1
Length=13391543

 Score = 575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/351 (85%), Positives = 315/351 (90%), Gaps = 3/351 (1%)
 Frame = -3

Query  1        MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
                MNILRVPE G TASGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNL VSYYESRAAC
Sbjct  2800809  MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  2800630

Query  61       HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
                HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAA+KPFGFKMVGHAP+KGYVELDVFV+TL 
Sbjct  2800629  HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  2800450

Query  121      DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
                DRNKWLEVARNALS KRQLTRQAIDQSVSPN+K LFGF+++LSPQP MSPQKQMQTL KS
Sbjct  2800449  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  2800270

Query  181      KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
                +DELLS+ALR++EAAK VGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  2800269  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  2800090

Query  241      TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
                TLHLFSDD        SK SSPQR  QSG   P RLPPA D+ +DAG SDLERLAQALGE
Sbjct  2800089  TLHLFSDD-SRPKASASKASSPQRSQQSG--RPPRLPPAMDSINDAGVSDLERLAQALGE  2799919

Query  301      LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
                LEVQAE+LNGEA   +QQIERIEH L+NVT RVEKQTKQASA L +GPRLF
Sbjct  2799918  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  2799766

 Score = 39.7 bits (91),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
                EGYVTKRGH  ++W++RF  ++G+ +  ++
Sbjct  4067582  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  4067493

 Score = 39.7 bits (91),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21        TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                 T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  10838671  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  10838775

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 27/117 (23%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
                G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L+     
Sbjct  5553311  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR--------KKIKGCMQLN-----  5553180

Query  83       EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                + VV V    +  ADK + F++     +KG+ +L  +  +  +   W+   R+   V
Sbjct  5553179  DGVVSVQHVDIRLADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALRSVRRV  5553024

>PHRA:scaffold_56
Length=334739

 Score = 572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/351 (85%), Positives = 316/351 (90%), Gaps = 2/351 (1%)
 Frame = +1

Query  1       MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
               MNILRVPE G TASGDKARPTSCEGYVTKRGHFRKSWRVRFLV++GSNLQ+SYYESRAAC
Sbjct  150211  MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  150390

Query  61      HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
               HPP  EPSAPKGSFYLSSIEPHEYVVGVMGAA KPFGFKM+GHAPKKGYVELDVFV+T  
Sbjct  150391  HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  150570

Query  121     DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
               DRNKWLEVARNALS KRQLTRQAIDQSVS NKK LFGF V+LSPQP M+PQKQMQTL ++
Sbjct  150571  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  150750

Query  181     KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
               KDELLS ALR++EAAKLVGREACNEIVIQGEKLD IEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  150751  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  150930

Query  241     TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
               TLHLFSDD     +  SKG SPQR  QSGG SPSRLPPA +T +DAG SDLERLAQALGE
Sbjct  150931  TLHLFSDD-SRPKSTASKGHSPQRSQQSGG-SPSRLPPAMETINDAGVSDLERLAQALGE  151104

Query  301     LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
               LEVQAE+LNGEA  S+QQIER+EH L+NVT RVEKQTKQASATL AGP+LF
Sbjct  151105  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  151257

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/351 (84%), Positives = 319/351 (91%), Gaps = 0/351 (0%)
 Frame = -2

Query  1       MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
               MNILRVPE G   SGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  101319  MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  101140

Query  61      HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
               HP TGE S PKGSFYLSSIEPHEYVVGVMGAA KPFGFKMVGHAPKKGYVELDVFV+T+ 
Sbjct  101139  HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  100960

Query  121     DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
               DRNKWLEVARNALS KRQLTRQAIDQSVSPNKK LFGFSV+LSPQPA+SPQKQMQTL K+
Sbjct  100959  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  100780

Query  181     KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
               KD+LLS+ALR++EAAK +GREACNEIVIQGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  100779  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  100600

Query  241     TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
               TLH+FS+DSRPKST  SK +SPQR  QSGGSSP+RL  A ++  D G SDLERLAQALGE
Sbjct  100599  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  100420

Query  301     LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
               LE+QAE+LN EA HS+QQI+ IEHHL+ VT RVEKQTKQASATL AGPRLF
Sbjct  100419  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  100267

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 548 bits (1411),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 284/351 (81%), Positives = 306/351 (87%), Gaps = 6/351 (2%)
 Frame = +1

Query  1        MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
                MNILR+PE G TASGDKA+PTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1844377  MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  1844556

Query  61       HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
                HPP GE + PKGSFYLS+IEPHEYV+GVMGAAD+PFGFKMVGHAP+KG+VELDVFV+T  
Sbjct  1844557  HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  1844736

Query  121      DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
                DRNKWLEVA NAL  KRQLTRQAIDQSVSPNKK LFGFSV  S QP MSPQKQMQTLA S
Sbjct  1844737  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  1844916

Query  181      KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
                K+ LL EALRE+EAAKLVGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  1844917  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  1845096

Query  241      TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
                TLH FSDD+RPK   G         H SG +SPSRL PA + + DAG SDL+RLAQALGE
Sbjct  1845097  TLHFFSDDTRPKVPLGDHP------HHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  1845258

Query  301      LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
                LEVQAE+LN E+ HSSQQIERIEHHL++VT RVEKQTKQA ATLSAGPRLF
Sbjct  1845259  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  1845411

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 53/115 (46%), Gaps = 22/115 (19%)
 Frame = +1

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
                P +C GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  1586851  PVACAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  1586994

Query  80       EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                     V  V     +PFGF  V +     Y    V+ D   +R KW+    NAL+
Sbjct  1586995  --EVLVEDVQKWEGEPFGFMFVTNEQVPYY----VYADNDRERTKWM----NALN  1587129

 Score = 40.0 bits (92),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (45%), Gaps = 29/118 (25%)
 Frame = +1

Query  22       SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAACHPPTGEPSAPKGSFYL  76
                SCEGY+TKRGH   S R+ + V++G++L     Q +Y ++++A                +
Sbjct  1586557  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYTDQQAYRDNQSA----------------M  1586688

Query  77       SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                + +E    V    G A+      + G+          V  DTL ++ KWL   + + +
Sbjct  1586689  AEVEIRS-VASWDGEANGLMFMTVTGNV-------FYVIADTLGEQQKWLSTVKKSTA  1586838

 Score = 40.0 bits (92),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
                CEGY+TKRGH   +W+ R+  + G+ L+  Y+ S
Sbjct  1586275  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YFSS  1586370

 Score = 33.9 bits (76),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = +2

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
                P +  G+V K G   +SW+ RFLV  G+ L  +YY++
Sbjct  1063460  PATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  1063564

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 536 bits (1382),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 278/351 (79%), Positives = 309/351 (88%), Gaps = 0/351 (0%)
 Frame = -1

Query  1      MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
              MNILRVPE G TASGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGS+LQVSY+ESR AC
Sbjct  68197  MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSDLQVSYFESRTAC  68018

Query  61     HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
              HPP GE  A KGSFYLS+I PHEYVVGVMGAADKPFGFKMVGHAP+KGYVELDVFV+TL+
Sbjct  68017  HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  67838

Query  121    DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
              DRNKWLEVARNAL  KRQ+ RQAIDQSVSP KK +FGF ++LSPQP + PQKQ+Q L  +
Sbjct  67837  DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  67658

Query  181    KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
              K+ELL+EALRELEAAK+VGREACNEIV+QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  67657  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  67478

Query  241    TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
              TLHLFSDD+RPKS   S  SSPQR HQS GS+P  LP +  +++DA  SDLERLA ALGE
Sbjct  67477  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  67298

Query  301    LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
              LE+QAE+LNGEA  S+QQI RIE  L+NVT RVEKQTKQASATLSAGPRLF
Sbjct  67297  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  67145

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 272 bits (695),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 176/234 (75%), Gaps = 14/234 (6%)
 Frame = +2

Query  19    RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78
             RPTSCEGYVTKRGHFRKSWRVR+LV+DG++L+V+Y+ES+ A        +A KG FYLSS
Sbjct  1547  RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ----NGAASKGEFYLSS  1714

Query  79    IEPHEYVVGVMGAA---DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
             I+ H YV G MGA    +KPFGFKMVGHAPKKGY ELD+FV+TLAD  KWLEVA NAL  
Sbjct  1715  IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  1894

Query  136   KRQLTRQAI-DQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDellsealrelea  194
                ++R+A  D   S   K+LFGFS         SPQ+Q++ ++ SKDELL +ALRELE 
Sbjct  1895  AAAMSRKAAGDGGGSATTKSLFGFSTT------TSPQQQLKAMSVSKDELLKDALRELEG  2056

Query  195   aKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDD  248
             AKL+GREAC E+V+QGEKLD IE +L  I+ DLD+GDKLLRRLKSP LHL + D
Sbjct  2057  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARD  2218

 Score = 65.1 bits (157),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = +3

Query  269   GGSSPSRLPPAF-----DTSSDAGGSDLERLAQAL--GELEVQAEMLNGEASHSSQQIER  321
             G +  SR PPA       T++   GS           GELE QA +LNGEA  S+QQI R
Sbjct  2304  GATQTSRRPPARCRTTRGTATSCSGSRAXXXXXXXXXGELEAQATLLNGEAVRSTQQIAR  2483

Query  322   IEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
             IE  LT V  RV++QTKQA++ +  G  +F
Sbjct  2484  IEERLTTVNDRVQRQTKQATSGIQRGGNIF  2573

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 237 bits (605),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 160/219 (73%), Gaps = 20/219 (9%)
 Frame = -1

Query  1      MNILRVPEHGTT---------ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQV  51
              MNILR+P   T+         +     +PTSCEGYVTKRGHFRKSWRVRFLV++G++L V
Sbjct  20697  MNILRLPLGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLV  20518

Query  52     SYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111
              SYY+S+          + PKGSFYLSS+E HEY VGV+GA +KPFGFKMVGHAP+KGYVE
Sbjct  20517  SYYDSKEVARTAG---AVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  20347

Query  112    LDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQ  171
              LD+FV+TL D NKWLEV +NAL   ++LTR    ++++P  K+LFGFS      PA SPQ
Sbjct  20346  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSPQ  20191

Query  172    KQMQTLAKSKDellsealreleaaKLVGREACNEIVIQG  210
              +QM+ +  +K+++L +A+ E+E+AKL+GR AC EI IQG
Sbjct  20190  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQG  20074

 Score = 96.3 bits (238),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = -2

Query  211    EKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstggskgsspQRFHQSGG  270
              E+LD I Q+L+ ++ DLD+ DKLLR +K+P LH+FS D+R ++    +     R   S  
Sbjct  20015  ERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAV  19836

Query  271    SSPSRLPPAFDTSSDAGG---SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLT  327
              S  +R     D+    GG   SD+ERLA  LGELE QA +LN EA   + Q+ER+   L 
Sbjct  19835  SEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLA  19656

Query  328    NVTTRVEKQTKQASATLS  345
              +V  RV+ QT++A+A+++
Sbjct  19655  HVNERVKAQTRKANASIA  19602

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 204 bits (518),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 116/145 (80%), Gaps = 4/145 (3%)
 Frame = -1

Query  1        MNILRVPEHGTTASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
                MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQVSY+ESR A
Sbjct  1308343  MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  1308164

Query  60       CHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTL  119
                 H P    + PKGSFY+SS+E HEY +GVMG  +KPFGFK+VGHAP KGY+ELD+FV++L
Sbjct  1308163  AHAPG---TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  1307993

Query  120      ADRNKWLEVARNALSVKRQLTRQAI  144
                 D NKWLEV +NAL   ++LTR+ +
Sbjct  1307992  PDVNKWLEVVQNALDAAKKLTRKGM  1307918

 Score = 127 bits (319),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 130/223 (58%), Gaps = 34/223 (15%)
 Frame = -3

Query  153      KTLFGFSVALSPQPAMSPQKQMQTLAKSKDellsealreleaaKLVGREACNEIVIQG--  210
                K++FGF  ++SPQ       Q++ LA +K+ELL EALRE+E AKL+GREA NEIV QG  
Sbjct  1307822  KSMFGFGASISPQL------QVKKLAATKEELLREALREIEGAKLIGREAVNEIVSQGGT  1307661

Query  211      ----------------------EKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDD  248
                                      EKLD +E DL  ++ DLD  DKLLR LKSP LH+FS+D
Sbjct  1307660  SSFHNQLSASAKTKLLVSIGAVEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSND  1307481

Query  249      srpkstggskgsspQRFHQSGGSSP-SRLPPAFDTSSDAGG---SDLERLAQALGELEVQ  304
                +R K    +  ++      S  +SP S            GG   +DLE LA AL ELE Q
Sbjct  1307480  NRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQ  1307301

Query  305      AEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAG  347
                A ++N EA+ S++QI RIE  LT+V  RV+ QTK+A+AT+ AG
Sbjct  1307300  ANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  1307172

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 197 bits (502),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 138/178 (78%), Gaps = 11/178 (6%)
 Frame = +1

Query  33     FRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAA  92
              FRKSWRVR+LV++G++L VSY++S+     P    ++PKGSFYLSS+E HEYVVGV+GA 
Sbjct  16051  FRKSWRVRYLVLNGADLCVSYFDSKDVARTPG---ASPKGSFYLSSVEKHEYVVGVLGAQ  16221

Query  93     DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNK  152
               KPFGFKMVGHAP+KGYVELD+FV++  D  KWLEV ++AL+  ++LTR  +  + S   
Sbjct  16222  KKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAS--T  16395

Query  153    KTLFGFSVALSPQPAMSPQKQMQTLAKSKDellsealreleaaKLVGREACNEIVIQG  210
              K+LFGFS      PA SPQKQ+Q L+ SK+ELL +A+ E+E+AKL+GREAC EIV+QG
Sbjct  16396  KSLFGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQG  16551

 Score = 79.3 bits (194),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = +3

Query  208    IQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstggskgsspQRFHQ  267
              +  EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K++     S  +   Q
Sbjct  16614  LHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSPVK-SKQ  16790

Query  268    SGGSSPSRLPPAFDTSSDAGG--SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHH  325
              S  SS +R          A G  SD+ERLA  LGELE QA +LN EA   + Q+ER+   
Sbjct  16791  SALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVGDA  16970

Query  326    LTNVTTRVEKQTKQA  340
              L ++  RV+ QTK+A
Sbjct  16971  LAHINERVQNQTKKA  17015

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 192/318 (60%), Gaps = 46/318 (14%)
 Frame = -3

Query  67     PSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
              P+ PKGSF++SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+ELD+FV+TL D NKW+
Sbjct  11417  PATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWV  11238

Query  127    EVARNALSVKRQLTRQ--AIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDel  184
              EV +NAL   ++ TR   A D S + N   +FGFS  +SPQ       Q++ LA +K+EL
Sbjct  11237  EVVQNALDAAKKHTRTPGAADSSTTKN---MFGFSATVSPQL------QVKKLAATKEEL  11085

Query  185    lsealreleaaKLVGREACNEIVIQG--------------------------EKLDTIEQ  218
              L +ALRE+E AKL+GREA ++I  QG                           KL+ IE 
Sbjct  11084  LRDALREIEGAKLIGREAVSDIKGQGGLWS*VAVVCGGYPGSRLITSCW*CPGKLNMIED  10905

Query  219    DLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPP  278
              DL  ++ DLD G KLL  +K P LHLFS+D+R K      GS         G+ PS    
Sbjct  10904  DLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGS  10725

Query  279    AFDTSSDAGG---------SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNV  329
              + +T++ A           SDLERL  ALGELE QA  +N EA  S++QI R+E  LT V
Sbjct  10724  SAETATGAQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAV  10545

Query  330    TTRVEKQTKQASATLSAG  347
                RV+ QTK+A+AT+ AG
Sbjct  10544  NDRVQAQTKKATATMKAG  10491

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 8/59 (14%)
 Frame = -2

Query  1      MNILRVPE------HGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
              MNILRVP+      HG+   GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ +Y
Sbjct  11802  MNILRVPDMKLATSHGS--GGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAY  11632

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 194 bits (494),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 113/151 (75%), Gaps = 10/151 (7%)
 Frame = +1

Query  1       MNILRVPEHGTTASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
               MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQV+YY
Sbjct  101374  MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  101553

Query  55      ESRAACHPPTGEPS----APKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYV  110
               ESR A    +         PKGSFY+SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+
Sbjct  101554  ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  101733

Query  111     ELDVFVDTLADRNKWLEVARNALSVKRQLTR  141
               ELD+FV++L D NKW+EV +NAL   ++ +R
Sbjct  101734  ELDIFVESLGDLNKWVEVVQNALDAAKKRSR  101826

 Score = 47.0 bits (110),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 15/91 (16%)
 Frame = +2

Query  144     IDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDellsealreleaaKLVGREAC  203
               +D S +   KT+FGFS +       SPQ Q++ LA +K++LL +ALRE+E AKL+GREA 
Sbjct  101939  VDNSTT---KTMFGFSAS------ASPQLQVKKLAATKEDLLRDALREIEGAKLIGREAV  102091

Query  204     NEIVIQGEKLDTIEQDLSAIDRDLDFGDKLL  234
               NEIV+QG  L      L+ I R + +   L+
Sbjct  102092  NEIVVQGGAL------LACIIRPIAYCWLLI  102166

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 82/157 (52%), Gaps = 34/157 (22%)
 Frame = +3

Query  211     EKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstggskgsspQRFHQS--  268
               EKLD +E DL  ++ DLD  DKLLR +K P LHLFS D              +R  QS  
Sbjct  102210  EKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGD--------------ERVKQSPH  102347

Query  269     -GGSS-----------------PSRLPPAFDTSSDAGGSDLERLAQALGELEVQAEMLNG  310
                GG+S                  +          +   SDLE+LA ALGELE QA ++N 
Sbjct  102348  TGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRNDALSDLEKLALALGELEEQANLMNA  102527

Query  311     EASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAG  347
               EA  S++QI R+E  LT V  RV+ QTK+A+AT+ AG
Sbjct  102528  EAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAG  102638

>ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:1 
REF
Length=105594

 Score = 172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 131/214 (61%), Gaps = 34/214 (16%)
 Frame = +1

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
              PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QVSYYES+ +      + + PKGSF L S 
Sbjct  11308  PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDS---SKSKNATPKGSFILQSA  11478

Query  80     EPHEYVVGVM---GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
              E HEY +  M      +KPFGFKMVGHAPK+GY+ELDVFVD+ +D ++WL+V  N L   
Sbjct  11479  EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  11658

Query  137    RQLTRQAIDQSVSPNK--------------------KTLFGFSVALSPQPAMSPQKQMQT  176
              + + R+A    ++ NK                    K++ GFS         + ++Q+Q 
Sbjct  11659  KCMAREAF---MAGNKIFSLLRQ*DLTSFFVEMDTTKSVLGFSYI-----GTTSKQQIQV  11814

Query  177    LAKSKDellsealreleaaKLVGREACNEIVIQG  210
              L   K + + EAL+++E AK  G  AC+EIV QG
Sbjct  11815  LKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQG  11916

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  289    SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGP  348
              +D+E+LA AL +LEVQA+++N EA  S++QI RIE  L+ +  R++ QT Q   T S   
Sbjct  12266  NDIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQV-ITSSGKQ  12442

Query  349    RLF  351
               LF
Sbjct  12443  NLF  12451

>ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_90_length_79489:1:79489:1 
REF
Length=79489

 Score = 159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +3

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
             PTSCEGYVTKRGHFRKSWRVR+LV+ G  +QVSYYES+ +        + PKGSF L ++
Sbjct  8589  PTSCEGYVTKRGHFRKSWRVRYLVICGVTMQVSYYESKDS---YKNRNATPKGSFILQNV  8759

Query  80    EPHEYVVGVM---GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
             E HEY +  M      ++PFGFKMVGHAPK+GYVELDVFVD+L++ ++WL+V  N L   
Sbjct  8760  EKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYVELDVFVDSLSNMDQWLDVINNGLKAN  8939

Query  137   RQLTRQAI  144
             +++ R+A 
Sbjct  8940  KRMAREAF  8963

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +3

Query  289   SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGP  348
             +DLE+LA AL ELEVQA+++N EA  S+ QI RIE  L+ +  R++ QT Q  A+ S   
Sbjct  9552  NDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVAS-SGKK  9728

Query  349   RLF  351
              LF
Sbjct  9729  NLF  9737

>APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.12:1:1206637:1 
REF
Length=1206637

 Score = 114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 143/312 (46%), Gaps = 76/312 (24%)
 Frame = -1

Query  2       NILRVPEHGTT-ASGDKARPTSCEGYVTKRG--------------------HFRKSWRVR  40
               NI R  +H T   +  K   TSCEGYVTKRG                    H  KSW+ R
Sbjct  708457  NIARYKQHSTMHVNLSKIHQTSCEGYVTKRGMLVHAVESSVWANKATTTLGHLMKSWKRR  708278

Query  41      FLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKM  100
               ++V++G  L VSYY+S+   +   G P   KGSF LS  E  +  +   GA+ KPFGFK 
Sbjct  708277  YMVLNGDTLLVSYYDSKEI-YTSKGHP---KGSFVLSECEKQD--LSDEGASVKPFGFKF  708116

Query  101     VGHAPKKGYVELDVFVDTLADRNKWLEVARNAL---SVKRQLTRQAIDQSVSPNKKTLFG  157
               +GH P +GY E  V+V++  D+ KWL VA NAL   S  ++   Q I++   P    L  
Sbjct  708115  IGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGP---LLPC  707945

Query  158     FSVALS-PQPAM----------------SPQKQMQTLAKSKDellsealreleaaKLVGR  200
                SV L+ P+  M                S + QM+ + K+  ELL +A+ + + A  +G 
Sbjct  707944  ASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQELLQQAINDAKEADRIGD  707765

Query  201     EACNEIVIQ----------------------GEKLDTIEQDLSAIDRDLDFGDKLLRRLK  238
                  NE+V Q                       + L+  E  +  + R +D  + L R LK
Sbjct  707764  ATVNEMVYQEGRLYHVNMGMECTSVHMMGRPADVLNDAEGTVDTMGRQMDHAEDLGRSLK  707585

Query  239     SPTL----HLFS  246
                P L    HLF+
Sbjct  707584  HPILYKLTHLFT  707549

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 104 bits (260),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 8/120 (7%)
 Frame = -2

Query  31      GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMG  90
               GH  KSWR R++V+DG  L+VSYY+S+        +    KGSF L+ IE H+Y     G
Sbjct  394904  GHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAEIEKHDY--SDEG  394740

Query  91      AADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQA-IDQSVS  149
                  KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NAL   + +T QA +DQ  S
Sbjct  394739  GGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KNVTPQASVDQRAS  394566

 Score = 28.1 bits (61),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 11/11 (100%), Positives = 11/11 (100%), Gaps = 0/11 (0%)
 Frame = -1

Query  21      TSCEGYVTKRG  31
               TSCEGYVTKRG
Sbjct  394983  TSCEGYVTKRG  394951

 Score = 39.7 bits (91),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  283     SSDAGGSDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASA  342
               ++DAG  +L++L++ L  LEV A  ++ E   +++QI+RI+  +     R+ +Q+ +  A
Sbjct  394019  TTDAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  393840

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 7/117 (6%)
 Frame = +2

Query  19      RPTSCEGYVTKR--GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
               RP +    +  R  GH  KSWR R++V+DG  L+VSY++S+        +    KGSF L
Sbjct  204086  RPVAMTDTIAIRMIGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFIL  204256

Query  77      SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               + IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NAL
Sbjct  204257  AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  204421

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 72/155 (46%), Gaps = 23/155 (15%)
 Frame = +1

Query  211     EKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstggskgsspQRFHQSGG  270
               E LD  E ++  +  +LD GD +++++ SP  + FS     K   GS  S   R H    
Sbjct  204727  EMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSARSHLPQT  204906

Query  271     -----------------SSPSRLPPAFDTS------SDAGGSDLERLAQALGELEVQAEM  307
                                +SP+   P+  TS      +DAG  +L++L++ L  LEV A  
Sbjct  204907  PMATILAMTLLRAHCL*NSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANT  205086

Query  308     LNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASA  342
               ++ E   +++QI+RI+  +     RV +Q+ +  A
Sbjct  205087  ISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  205191

 Score = 35.0 bits (79),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = -2

Query  25       GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
                G++ K+G   K+W+ RF+V+   +L   Y+E+      PT +   PKGSF + +IE
Sbjct  1371042  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT--PTLK---PKGSFQVLAIE  1370896

 Score = 33.9 bits (76),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 9/43 (21%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVR-FLVVDGSNLQVSYYE-----SRAAC  60
                EGY+ K+GH  K+WR R F +VD S   ++YY+     SRA C
Sbjct  1238308  EGYLLKQGHVVKNWRRRYFRLVDAS---LAYYDVRTTSSRAFC  1238189

>APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.20:1:1003253:1 
REF
Length=1003253

 Score = 91.3 bits (225),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 7/118 (6%)
 Frame = +2

Query  31      GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMG  90
               GH  K+W+ R++V+ G  L V+YY+S+   +   G    PKGSF LS  E  +  +   G
Sbjct  399722  GHMMKTWKRRYMVLHGDTLLVAYYDSKEI-YKSNG---PPKGSFVLSECEKQD--LSDEG  399883

Query  91      AADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSV  148
                + KPFGFK +GH P +GY E  VFV+T  D+ KWL VA NAL  K    +++I Q +
Sbjct  399884  GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG-KTTSPQKSISQRI  400054

 Score = 28.5 bits (62),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +1

Query  17      KARPTSCEGYVTKRG  31
               K   TSCEGYVTKRG
Sbjct  399631  KIHQTSCEGYVTKRG  399675

 Score = 35.0 bits (79),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (52%), Gaps = 4/79 (5%)
 Frame = +2

Query  1       MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
               M++L +    T++  +K   TSC GY+ KRG    + + R++++  + L   YY++    
Sbjct  941441  MDVLVLDTTNTSSQNNKR--TSCAGYLMKRGEVNVTMQRRYMILQDNEL--VYYKTNPEL  941608

Query  61      HPPTGEPSAPKGSFYLSSI  79
               +        P+GS +L ++
Sbjct  941609  NKGWFGKEKPRGSLHLGNV  941665

>PYAR:scaffold_2744 par_scaffold_2744 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2744:1:4396:1 
REF
Length=4396

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 59/124 (48%), Gaps = 20/124 (16%)
 Frame = +2

Query  13    ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKG  72
             A+ +   P +C GY+TK+GH RKSW+ R+ V+ GS+  VSYY      + P G+P A   
Sbjct  3635  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLA---  3799

Query  73    SFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARN  131
                       E V+  +   D +PFGF  +       Y    V+ D   +R KW+   R 
Sbjct  3800  ----------EVVIEDVQRWDGEPFGFMFMTSEQIPYY----VYADNERERTKWMNALRK  3937

Query  132   ALSV  135
               SV
Sbjct  3938  LTSV  3949

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  23    CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
             CEG++TKRGH   +W++R+ V+ G+ L+
Sbjct  3080  CEGFLTKRGHVFTNWKMRYFVLRGNVLE  3163

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  22    SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
             +CEGY+T+RGH   S R  + V++G++L+
Sbjct  3362  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  3448

>PHRA:scaffold_130
Length=94934

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 22/115 (19%)
 Frame = +2

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
              P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  64799  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLA----------  64942

Query  80     EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                   V  V     +PFGF  + +     Y    V+ D   +RNKW+    NAL+
Sbjct  64943  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWM----NALN  65077

 Score = 41.6 bits (96),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  64223  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  64318

 Score = 39.3 bits (90),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  22     SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
              SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  64505  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  64591

>PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:pug:scf1117875582007:1:931704:1 
REF
Length=931704

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 56/115 (49%), Gaps = 22/115 (19%)
 Frame = -2

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
               P SC GY+TK+GH RKSW+ R+ ++ G NL +SYY      +   G+P        L+ +
Sbjct  687695  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKP--------LAEV  687546

Query  80      EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                    V  V     +PFGF  +        V   V+ D   +RNKW+    NALS
Sbjct  687545  A----VEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWM----NALS  687417

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
               CEG++TKRGH   +W+ R+ V+ G  L+
Sbjct  688271  CEGFLTKRGHVFTNWKTRYFVLRGDVLE  688188

 Score = 38.1 bits (87),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
               SCEGY+T+RGH   S R+ + V++G++L+
Sbjct  687989  SCEGYLTRRGHLVPSQRMAYYVLNGASLR  687903

>HYAP:scaffold_84 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_84:1:283758:1 
REF
Length=283758

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 24/116 (21%)
 Frame = -2

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
               P SC GY+TK+GH RKSW+ R+ ++ G NL +SYY      +   G P A          
Sbjct  273449  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRPLA----------  273306

Query  80      EPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                  E +V  + + D +PFGF  + +     Y    V+ D   +RNKW+    NAL+
Sbjct  273305  ---EVLVEDVQSWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWM----NALN  273171

 Score = 41.2 bits (95),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 51/116 (44%), Gaps = 29/116 (25%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAACHPPTGEPSAPKGSFYL  76
               SCEGY+TKRGH   S R+ + V++G++L     Q +Y E+++A                +
Sbjct  273743  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSAM-----------AEVEI  273597

Query  77      SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
                S+ P E      G  +      + G+          V  DT+ ++ KWL   + +
Sbjct  273596  RSVAPWE------GETNGLMFMTVTGNV-------FYVIADTVGEQQKWLATVKKS  273468

 Score = 40.8 bits (94),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 2/32 (6%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
               CEGY+TKRGH   +W+ R+  + G+ L+  YY
Sbjct  274025  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YY  273936

>PYIW:scaffold_452 piw_scaffold_452 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_452:1:18197:1 
REF
Length=18197

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 60/132 (45%), Gaps = 21/132 (16%)
 Frame = -3

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
             P SC GY+TK+GH RKSW+ R+ ++ G NL ++Y+      +   G+P A          
Sbjct  1659  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKPLA----------  1516

Query  80    EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQL  139
                  V  V     +PFGF  +        V   V+ D   +RNKW+   R   +V  + 
Sbjct  1515  --EVTVEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWMNALRKLTTVAEEP  1354

Query  140   TRQAIDQSVSPN  151
             T   +++   PN
Sbjct  1353  T---VEKKRCPN  1327

 Score = 40.0 bits (92),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 45/104 (43%), Gaps = 23/104 (22%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
             CEG++TKRGH   +W+ R+ V+ G+ L+    E +   +          GS  ++ + P 
Sbjct  2235  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFSGEDKGKRY----------GSVTVAKVAPW  2086

Query  83    EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                    G A   F F      P        V+  + A+R+KWL
Sbjct  2085  S------GEAHG-FMFYTTKQVP------YYVYASSEAERSKWL  1993

 Score = 38.1 bits (87),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 5/42 (12%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
             CEGY+T+RGH   S R+ + V++G++L     Q +Y E+++A
Sbjct  1950  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSA  1825

>ALCA:scaffold_78 AcNc2_CONTIG_78_length_85802 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_78_length_85802:1:85802:1 
REF
Length=85802

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 57/125 (46%), Gaps = 18/125 (14%)
 Frame = +1

Query  6      VPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
              V  H  T + +   P +C GY+TK+GH RKSW+ R+ ++ G N+ +SYY+     +   G
Sbjct  70306  VSNHSNTTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQDYDLANNAKG  70479

Query  66     EPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
              +         L+ ++    V  V     + FGF  +       Y    V+ D   +R KW
Sbjct  70480  KA--------LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKW  70611

Query  126    LEVAR  130
              +   R
Sbjct  70612  MSALR  70626

 Score = 42.4 bits (98),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 46/107 (43%), Gaps = 23/107 (21%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
              EGY+TKRGH   +W+ RF V+ G+ L+  YY S         E +   GS  ++ + P  
Sbjct  69772  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPWS  69921

Query  84     YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                    G A   F F      P        V+  + A++ KWL   R
Sbjct  69922  ------GEA-HGFMFYTTKQIP------YYVYAASEAEKTKWLRALR  70023

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  22     SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
              +CEGY+T+RGH   S RV + V+ G+ L+
Sbjct  70051  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  70137

>PHSO:scaffold_8
Length=3549547

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 53/115 (46%), Gaps = 22/115 (19%)
 Frame = +1

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
                P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  2527711  PVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKPLA----------  2527854

Query  80       EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                     V  V     +PFGF  +        V   V+ D   +RNKW+    NAL+
Sbjct  2527855  --EVLVEDVQKWDGEPFGFMFM----TTEQVPYYVYADNDRERNKWM----NALN  2527989

 Score = 41.2 bits (95),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
                CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  2527135  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  2527230

 Score = 38.5 bits (88),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  22       SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
                SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  2527417  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  2527503

>PYIR:scaffold_755 pir_scaffold_755 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_755:1:16342:1 
REF
Length=16342

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 59/132 (45%), Gaps = 20/132 (15%)
 Frame = -3

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
             P SC GY+TK+GH RKSW+ R+ ++ G NL ++YY      +   G   A          
Sbjct  8819  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRALA----------  8676

Query  80    EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQL  139
                  V  V     +PFGF  +       Y    V+ D   +RNKW+   R   +V  + 
Sbjct  8675  --EVTVEDVQKWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTTVAEEP  8514

Query  140   TRQAIDQSVSPN  151
             T  ++++   PN
Sbjct  8513  T--SLEKKRCPN  8484

 Score = 39.7 bits (91),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
             CEG++TKRGH   +W+ R+ V+ G+ L+
Sbjct  9395  CEGFLTKRGHVFTTWKTRYFVLRGNVLE  9312

 Score = 38.1 bits (87),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = -3

Query  22    SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
             SCEGY+T+RGH   S R+ + V++G++L     Q +Y ++++A
Sbjct  9113  SCEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRDNQSA  8985

>PHCA:scaffold_13 PHYCAscaffold_13
Length=1060349

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 52/118 (44%), Gaps = 18/118 (15%)
 Frame = +3

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
               P SC GY+TK+GH RKSW+ R+ ++ G    +SYY      +   G+P A          
Sbjct  342165  PVSCAGYLTKQGHKRKSWKKRYFILRGHT--ISYYSDYDMANNAKGKPLA----------  342308

Query  80      EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
                    V  V     +PFGF  + +      V   V+ D   +R+KW+      +  +R
Sbjct  342309  --EVMVEDVQKWDGEPFGFMFMTNEQ----VPYYVYADNDRERSKWMNALNKLMQWRR  342464

 Score = 40.8 bits (94),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)
 Frame = +3

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
               CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  341589  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  341684

 Score = 38.1 bits (87),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (46%), Gaps = 19/111 (17%)
 Frame = +3

Query  22      SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
               SCEGY+TKRGH   S R+ + V++G++L+  +Y  + A      +  +      + S+ P
Sbjct  341871  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYR----DNQSAMAEVEIRSVAP  342032

Query  82      HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
                +      G A+      + G+          V  DT+ ++ KWL   + +
Sbjct  342033  WD------GEANGLMFMTVTGNV-------FYVIADTVGEQQKWLATVKKS  342146

>PHPA:scaffold_89 NW_008649075.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.89, whole genome shotgun 
sequence
Length=179567

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 49/109 (45%), Gaps = 18/109 (17%)
 Frame = +2

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
               P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  100574  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  100717

Query  80      EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEV  128
                    V  V     +PFGF  + +      V   V+ D   +R KW+  
Sbjct  100718  --EVLVEDVQKWDGEPFGFMFMTNE----QVPYYVYADNDRERTKWMNA  100846

 Score = 41.6 bits (96),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 23/111 (21%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               CEGY+TKRGH   +W+ R+  + G+ L+  YY S         E S   G+  +  + P 
Sbjct  99998   CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  100147

Query  83      EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                      G A   F F      P        V+  + A+R++WL   ++ +
Sbjct  100148  S------GEAHG-FMFYTTKQIPYY------VYASSEAERSRWLRALKDFM  100261

 Score = 39.3 bits (90),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  22      SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
               SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  100280  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  100366

>PHIF:NW_003303587.1 Phytophthora infestans T30-4 supercont1.172 
genomic scaffold, whole genome shotgun sequence
Length=191572

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 18/107 (17%)
 Frame = -1

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
              P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  55207  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  55064

Query  80     EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                   V  V     +PFGF  + +      V   V+ D   +R KW+
Sbjct  55063  --EVLVEDVQKWDGEPFGFMFMTNE----QVPYYVYADNDRERTKWM  54941

 Score = 41.6 bits (96),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 23/111 (21%)
 Frame = -1

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
              CEGY+TKRGH   +W+ R+  + G+ L+  YY S         E S   G+  +  + P 
Sbjct  55783  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  55634

Query  83     EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                     G A   F F      P        V+  + A+R++WL   ++ +
Sbjct  55633  S------GEAHG-FMFYTTKQIP------YYVYASSEAERSRWLRALKDFM  55520

 Score = 39.3 bits (90),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
              SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  55501  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  55415

>PHKE:scaffold_262 scf_22126_262.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_262.1:1:50665:1 
REF
Length=50665

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 52/115 (45%), Gaps = 22/115 (19%)
 Frame = +3

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
              P +C GY+TK+GH RKSW+ R+ ++ GS   +SYY      +   G+  A          
Sbjct  15984  PVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKALA----------  16127

Query  80     EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                   V  V     +PFGF  +       Y    V+ D   +RNKW+    NAL+
Sbjct  16128  --EVLVEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NALN  16262

 Score = 41.6 bits (96),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 45/104 (43%), Gaps = 23/104 (22%)
 Frame = +3

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
              CEGY+TKRGH   +W+ R+  + G+ L+  YY S         E S   G+  +      
Sbjct  15408  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVMV------  15539

Query  83     EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
              E V    G A   F F      P        V+  + A+R+KWL
Sbjct  15540  EKVATWSGEAHG-FMFYTTKQIPYY------VYASSEAERSKWL  15650

 Score = 38.9 bits (89),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  22     SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
              SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  15690  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  15776

>ALLA:FR824103 dna:supercontig supercontig:ENA1:FR824103:1:105777:1 
REF
Length=105777

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 57/125 (46%), Gaps = 18/125 (14%)
 Frame = -3

Query  6      VPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
              V  H  T + +   P +C GY+TK+GH RKSW+ R+ ++ G N+ +SYY+     +   G
Sbjct  67168  VFNHTNTLTTNVVEPVTCAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQDYDLANHVKG  66995

Query  66     EPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
              +         L+ ++    V  V     + FGF  +       Y    V+ D   +R KW
Sbjct  66994  KA--------LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKW  66863

Query  126    LEVAR  130
              +   R
Sbjct  66862  MSALR  66848

 Score = 40.4 bits (93),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 2/33 (6%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              EGY+TKRGH   +W+ RF V+ G+ L+  YY S
Sbjct  67702  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSS  67610

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -3

Query  22     SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
              +CEGY+T+RGH   S RV + V+ G+ L+
Sbjct  67423  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  67337

>PYVX:scaffold_518 pve_scaffold_518 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_518:1:21302:1 
REF
Length=21302

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 55/119 (46%), Gaps = 18/119 (15%)
 Frame = +1

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
             P +C GY+TK+GH RKSW+ R+ ++ G++  +SY+      +   G+         L+ +
Sbjct  5203  PVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGKA--------LAEV  5352

Query  80    EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQ  138
                  V  V     +PFGF  +       Y    V+ D   +RNKW+   R   +V  +
Sbjct  5353  T----VEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLNAVDEE  5505

 Score = 39.7 bits (91),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)
 Frame = +1

Query  23    CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
             CEGY+TKRGH   +W+ R+  + G+ L+  Y+ S
Sbjct  4624  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  4719

 Score = 38.1 bits (87),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 5/43 (12%)
 Frame = +1

Query  22    SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
             SCEGY+TKRGH   S R+ + V+ G+ L     Q +Y E+++A
Sbjct  4909  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA  5037

>APAS:scaffold_13 supercont1.13 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.13:1:1183921:1 
REF
Length=1183921

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 20/119 (17%)
 Frame = -2

Query  13      ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKG  72
               A+    +P +C G++TK+GH RKSW+ R+ V+ G+ L  +YY    A +   G+P     
Sbjct  859839  ATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKPLG---  859675

Query  73      SFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                         E  V  + A D +P GF  + +     Y    VF D   D+ KWL   R
Sbjct  859674  ----------EVTVREVSAWDGEPSGFMFITNDSVPYY----VFADNDRDQAKWLAALR  859540

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = -3

Query  15      GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
               G   +P +C GY+TK+GH RKSW+ R+ V+ GS L  SYY
Sbjct  855170  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  855057

 Score = 40.0 bits (92),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 11/63 (17%)
 Frame = -1

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPK-GSFYLSSIEP  81
               C GY+TKRGH   +W++R+ V+   +  +SYYE          E  A K G  +L+ + P
Sbjct  855844  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYED---------ESMAKKLGQVHLAKVAP  855695

Query  82      HEY  84
                EY
Sbjct  855694  WEY  855686

 Score = 36.2 bits (82),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 26/44 (59%), Gaps = 3/44 (7%)
 Frame = -3

Query  13      ASGDKARPTS--CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
               AS D + P+     GY+TKRGH   +W+ RF V+     ++SYY
Sbjct  860504  ASMDSSAPSGILASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  860376

 Score = 34.3 bits (77),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)
 Frame = -2

Query  26      YVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
               Y+TKRGH   S+R+R+ V+ GS ++  YY    A
Sbjct  860103  YLTKRGHLVPSYRMRYFVLCGSTIK--YYADETA  860008

>SAPA:scaffold_20 supercont2.20 dna:supercontig supercontig:ASM15154v2:supercont2.20:1:492046:1 
REF
Length=492046

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 61/138 (44%), Gaps = 22/138 (16%)
 Frame = +3

Query  17     KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
              K  P +C G++TK+GH RKSW+ R+ V+ G+ L  SYY    A +   G+         L
Sbjct  67059  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  67208

Query  77     SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
              S +   +  VG        F F  + + P        VF D   D+ KW+   + A+   
Sbjct  67209  SDVSLKD--VGPWDGEACGFMFTTLENVP------YYVFADNERDQAKWMSALKKAVGAD  67364

Query  137    RQLTRQAIDQSVSPNKKT  154
                L  + ID+   P KK 
Sbjct  67365  -TLAIETIDE---PEKKC  67406

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 2/44 (5%)
 Frame = +1

Query  11     TTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
              TT      +P SC GY+TK+GH RKSW+ R+ V+ G  L  +YY
Sbjct  71647  TTNVASAIKPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYY  71772

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 65/154 (42%), Gaps = 30/154 (19%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPK-GSFYLSSIEP  81
              C GY+TKRGH   +W+ RF V+    + + YY           E  A K G  +L  + P
Sbjct  70994  CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYAD---------ESMAKKLGQVHLVKVAP  71143

Query  82     HEYVVGVM---------GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
               EYV             G+ +  FGF M     +  Y    V+ +  A+R KWL   ++ 
Sbjct  71144  WEYVSATTANSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQDL  71311

Query  133    LSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQP  166
                V    T  A D      K+T  GFS  LS +P
Sbjct  71312  YVV----TSNATDCEGYLTKRTP-GFSF-LSSRP  71395

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 27/60 (45%), Gaps = 20/60 (33%)
 Frame = +3

Query  18     ARPTSCEGY------------------VTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
              ARP  CEGY                  +TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  66702  ARPVDCEGYTAPSTTHPPHYSCTSSRYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  66875

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 1/32 (3%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
               GY+TKRGH   +W+ RF  +  S  ++SYY 
Sbjct  66433  SGYLTKRGHVITNWKTRFFALR-SQGRLSYYN  66525

>SADI:scaffold_52 supercont1.52 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.52:1:383575:1 
REF
Length=383575

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = +2

Query  11      TTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
               TT      +P SC GY+TK+GH RKSW+ R+ V+ G+ L  SYY
Sbjct  215030  TTNVASAIKPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY  215155

 Score = 43.1 bits (100),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 55/120 (46%), Gaps = 20/120 (17%)
 Frame = +1

Query  17      KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
               K  P +C G++TK+GH RKSW+ R+ V+ G+ L  SY+    A +   G+  +      +
Sbjct  210508  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANTRLGKALS---EVSV  210672

Query  77      SSIEPHE-YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                 + P +  V G M        F  + + P        VF D   D+ KW+   + A+ +
Sbjct  210673  KDVAPWDGEVCGFM--------FVTLENVP------YYVFADNERDQAKWMTALKKAVGL  210810

 Score = 42.4 bits (98),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 60/153 (39%), Gaps = 28/153 (18%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               C GY+TKRGH   +W+ RF V+    +   Y +                G  +L  + P 
Sbjct  214379  CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADDSMV---------KKLGQVHLVKVAPW  214531

Query  83      EYVVGVMGAA---------DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               EY     G +         +  FGF M     +  Y    V+ +  A+R +WL   ++  
Sbjct  214532  EYFSATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQDLY  214699

Query  134     SVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQP  166
                V    T  A D      K+T  GFS  LS +P
Sbjct  214700  VV----TSNATDCEGYLTKRTP-GFSF-LSSRP  214780

 Score = 40.8 bits (94),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 6/53 (11%)
 Frame = +1

Query  11      TTASGDKA---RPTSCEG-YVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
               +TA G +A   RP+SC   Y+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  210172  STAKGKRACYHRPSSCSCRYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  210324

 Score = 34.7 bits (78),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 1/31 (3%)
 Frame = +3

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
               GY+TKRGH   +W+ RF  +  S  ++SYY 
Sbjct  209895  GYLTKRGHVITNWKTRFFALR-SQGRLSYYN  209984

>APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.1:1:2817317:1 
REF
Length=2817317

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 53/119 (45%), Gaps = 22/119 (18%)
 Frame = -2

Query  15      GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSF  74
               G   +P +C GY+TK+GH RKSW+ R+ V+ G+ L  SYY         T   SA K   
Sbjct  790123  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYY---------TDYESANKQCL  789977

Query  75      YLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                   IE  +   G M       GF          Y    V+ DT  +R KWL VA  AL
Sbjct  789976  AEVGIEDVQVWDGEM------HGFMFTTTEQVMYY----VYADTERERQKWL-VALKAL  789833

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (46%), Gaps = 18/112 (16%)
 Frame = -3

Query  19      RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78
               +P +C G++TK+GH RKSW+ R+ V+ G+ L  +YY    A +      S P G   +  
Sbjct  794850  QPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASN---MRHSRPLGEVTVRE  794686

Query  79      IEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
               +   +          +P GF  V +      V   VF D   D+ KWL   R
Sbjct  794685  VSTWD---------GEPGGFMFVTN----DNVPYYVFADNERDQAKWLTALR  794569

 Score = 43.1 bits (100),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 9/62 (15%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               C GY+TKRGH   +W++RF V+   +  +SYYE  +         S   G  +L+ + P 
Sbjct  790792  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDESM--------SKKLGQVHLAKVAPW  790640

Query  83      EY  84
               EY
Sbjct  790639  EY  790634

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)
 Frame = -3

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
               GY+TKRGH   +W+ RF V+     ++SYY
Sbjct  795474  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  795388

>PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_123:1:61624:1 
REF
Length=61624

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 55/119 (46%), Gaps = 20/119 (17%)
 Frame = -1

Query  13     ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKG  72
              A+ +   P +C GY+TK+GH RKSW+ R+ V+ G++  ++Y+      +   G+  A   
Sbjct  39424  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKALA---  39260

Query  73     SFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                        E +V  +   D +PFGF  +        V   V+ D   +R KW+   R
Sbjct  39259  ----------EVIVEDVQRWDGEPFGFMFM----TSEQVPYYVYADNERERGKWMNALR  39125

 Score = 40.4 bits (93),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 52/119 (44%), Gaps = 23/119 (19%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
              +CEG++TKRGH   +W++R+ V+ G+ L+  Y+           + S   GS  +  + P
Sbjct  39982  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFSG--------DDKSKRYGSVIVEKVAP  39833

Query  82     HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLT  140
                      G A   F F      P        V+  + A+R KWL   R+ +    ++T
Sbjct  39832  WS------GEAHG-FMFYTTKQVPYY------VYASSEAERAKWLRALRDFMVEPEEVT  39695

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
              +CEG++T+RGH   S R  + V++G++L+
Sbjct  39697  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  39611

>PYAP:scaffold_137 pag1_scaffold_137 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_137:1:57116:1 
REF
Length=57116

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 2/35 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
              EGYVTKRGH  ++W++RF  ++G+NL  SYYE++ 
Sbjct  40957  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  41055

>PYAR:scaffold_1124 par_scaffold_1124 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1124:1:10220:1 
REF
Length=10220

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 2/34 (6%)
 Frame = -1

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
             EGYVTKRGH  ++W+ RF  ++G+NL  SYYE++
Sbjct  2102  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENK  2007

>HYAP:scaffold_797 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_797:1:5354:1 
REF
Length=5354

 Score = 45.4 bits (106),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 54/135 (40%), Gaps = 14/135 (10%)
 Frame = +1

Query  16    DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
             D A   S  G++ KRGH RK+W+ R+ V+D S L+   Y + ++C    GE        +
Sbjct  3655  DDAFLDSMSGWLRKRGHVRKNWKARYFVLDKSILR---YYTDSSCTKLKGEV-----LLF  3810

Query  76    LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                   H   V V G  D  F  ++        Y  L +    L DR  W+    +AL  
Sbjct  3811  HPQTRVHYVDVHVAGGRDASFAIQV-----GLDYTLL-LHAAQLCDRENWMYCIEDALLC  3972

Query  136   KRQLTRQAIDQSVSP  150
             +     Q +     P
Sbjct  3973  RDSYYTQGLTSGPGP  4017

>PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_206.1:1:61978:1 
REF
Length=61978

 Score = 45.4 bits (106),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 62/141 (44%), Gaps = 14/141 (10%)
 Frame = -1

Query  10    GTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSA  69
             GT+++ D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    GE   
Sbjct  5647  GTSSAFDDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCAKLKGEV--  5483

Query  70    PKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVA  129
                  +      H   V V    D  F  ++    P+     L +    L DR  W+   
Sbjct  5482  ---LLFHPQTRVHYVDVHVASGRDASFAVQV---GPE---YTLLLQAAQLRDRENWIYCI  5330

Query  130   RNALSVKRQLTRQAIDQSVSP  150
              +AL  +     Q ++++  P
Sbjct  5329  EDALLCRDSYHPQGVNRNPGP  5267

>PHPA:scaffold_114 NW_008649100.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.114, whole genome 
shotgun sequence
Length=97882

 Score = 45.4 bits (106),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 63/147 (43%), Gaps = 26/147 (18%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
              EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S + P  
Sbjct  60130  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIISKVRPEN  60291

Query  84     YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--SVKRQLTR  141
              Y         K  GF +      +G+    +   T  +++ W+E+ + A+   V+   +R
Sbjct  60292  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  60435

Query  142    ------QAIDQSVSPNKKTLFGFSVAL  162
                    +A+    SP +  L GF  A 
Sbjct  60436  LSMEGMEALQMQTSPTQVDLRGFYFAF  60516

>PYUU:scaffold_1239 scf1117875581239 dna:supercontig supercontig:pug:scf1117875581239:1:719819:1 
REF
Length=719819

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 35/142 (25%), Positives = 61/142 (43%), Gaps = 20/142 (14%)
 Frame = -1

Query  11     TTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAP  70
              T ++   A     EGYV K+G +   W  R+LV+DG+ L  +YY ++             
Sbjct  52010  TASTPGVAHEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL----  51849

Query  71     KGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
              +G   +S + P  Y         K  GF +      KG+    +   T  +++ W+E+ +
Sbjct  51848  RGRMIISKVRPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQ  51705

Query  131    NAL--SVKRQLTRQAIDQSVSP  150
               A+   VK  +   ++D  V P
Sbjct  51704  AAIDEGVKHSVNGNSMDSDVVP  51639

>PYIR:scaffold_231 pir_scaffold_231 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_231:1:38748:1 
REF
Length=38748

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (47%), Gaps = 7/113 (6%)
 Frame = -1

Query  23     CEGYVTKRGHFR-KSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
              CEGYV  R HF   +WR RF V++ + L +  Y   +A      E  A +    ++  + 
Sbjct  19221  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL--YPDTSAALSEGREQKALEKHDLIAVKKW  19048

Query  82     HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
              H      +G     FGF++   A   GY+E  V ++   ++ KWL    NA+S
Sbjct  19047  HPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIED--EQTKWLAAITNAVS  18901

>PHRA:scaffold_73
Length=254763

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 36/153 (24%), Positives = 64/153 (42%), Gaps = 26/153 (17%)
 Frame = +2

Query  18      ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
               A     EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S
Sbjct  185162  AHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIIS  185323

Query  78      SIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
                + P  Y         K  GF +      +G+    +   T  +++ W+E+ + A+    
Sbjct  185324  KVRPENY--------GKAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAIEEGV  185467

Query  138     QLTR--------QAIDQSVSPNKKTLFGFSVAL  162
               + T+        +A+    SP +  L GF +A 
Sbjct  185468  RHTQSSMSMEGMEALQMQSSPTQVDLRGFYLAF  185566

>PYIR:scaffold_316 pir_scaffold_316 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_316:1:31968:1 
REF
Length=31968

 Score = 43.9 bits (102),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 56/129 (43%), Gaps = 20/129 (16%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
             EGYV K+G +   W  R+LV+DG+ L  +YY ++             +G   +S + P  
Sbjct  9298  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL----RGRMIISKVRPEN  9459

Query  84    YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--SVKRQLTR  141
             Y         K  GF +      KG+    +   T  +++ W+E+ + A+   VK  L  
Sbjct  9460  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNG  9603

Query  142   QAIDQSVSP  150
              ++D    P
Sbjct  9604  SSVDPETLP  9630

>HYAP:scaffold_1 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1:1:1234263:1 
REF
Length=1234263

 Score = 43.9 bits (102),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  24       EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                EGYVTKRGH  ++W++RF  ++G+ L  + Y  R
Sbjct  1195378  EGYVTKRGHLVRNWKMRFFTLEGNLLSCT*YRDR  1195479

>PHIF:NW_003303669.1 Phytophthora infestans T30-4 supercont1.90 
genomic scaffold, whole genome shotgun sequence
Length=500880

 Score = 43.5 bits (101),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 63/147 (43%), Gaps = 26/147 (18%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   ++ + P  
Sbjct  370499  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIINKVRPEN  370338

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--SVKRQLTR  141
               Y         K  GF +      +G+    +   T  +++ W+E+ + A+   V+   +R
Sbjct  370337  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  370194

Query  142     ------QAIDQSVSPNKKTLFGFSVAL  162
                     +A+    SP +  L GF  A 
Sbjct  370193  LSMEGMEALQLQTSPTQVDLRGFYFAF  370113

>PHCA:scaffold_20 PHYCAscaffold_20
Length=899172

 Score = 43.1 bits (100),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 60/147 (41%), Gaps = 26/147 (18%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S + P  
Sbjct  130076  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIISKVRPEN  129915

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--------SV  135
               Y         K  GF +      +G+    +   T  +++ W+E+ + A+        S 
Sbjct  129914  Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGHSS  129771

Query  136     KRQLTRQAIDQSVSPNKKTLFGFSVAL  162
                     +A+    SP +  L GF  A 
Sbjct  129770  ISAEGMEALQMQTSPTQVDLRGFYFAF  129690

>PHSO:scaffold_4
Length=7609242

 Score = 43.1 bits (100),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 35/148 (24%), Positives = 60/148 (41%), Gaps = 27/148 (18%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S + P  
Sbjct  971188  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIISKVRPEN  971349

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL---------S  134
               Y         K  GF +      +G+    +   T  +++ W+E+ + A+         S
Sbjct  971350  Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGAHS  971493

Query  135     VKRQLTRQAIDQSVSPNKKTLFGFSVAL  162
                      +A+    SP +  L GF  A 
Sbjct  971494  RVSMEGMEALQMQASPTQVDLRGFYFAF  971577

>PYAP:scaffold_212 pag1_scaffold_212 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_212:1:44434:1 
REF
Length=44434

 Score = 43.1 bits (100),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 38/149 (26%), Positives = 62/149 (42%), Gaps = 26/149 (17%)
 Frame = +2

Query  13     ASGDKARPTSC------EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGE  66
              ASG    PT        EGYV K+G +   W  R+LV+DG+ L  +YY ++         
Sbjct  20888  ASGATDAPTGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSGRNL  21061

Query  67     PSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                  +G   +S + P  Y         K  GF +       G+    +   T  +++ W+
Sbjct  21062  ----RGRMIISKVRPENY--------GKAHGFLL----ETMGHKHFHLCCSTELEKDMWV  21193

Query  127    EVARNAL--SVKRQLTRQAIDQSVSPNKK  153
              E+ + A+   VK +L R  I  +   N +
Sbjct  21194  EMMQAAIDEGVKHKLERSLISSADVANAQ  21280

>PYIR:scaffold_88 pir_scaffold_88 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_88:1:55984:1 
REF
Length=55984

 Score = 42.7 bits (99),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGSNLQV  51
               EGYVTKRGH  ++W+ RF  ++G+NL  
Sbjct  24131  WEGYVTKRGHLVRNWKNRFFTLEGNNLSC  24217

>PHSO:scaffold_2
Length=11587142

 Score = 42.7 bits (99),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 55/135 (41%), Gaps = 14/135 (10%)
 Frame = +2

Query  16       DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
                D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    GE        +
Sbjct  2310074  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCSKLKGEV-----LLF  2310229

Query  76       LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                      H   V V G  D  F  ++    P      L +    L DR  W+    +AL  
Sbjct  2310230  HPQTRVHYVDVHVAGGRDASFAIQV---GPD---YTLLLQAAQLRDRENWMYCIEDALLC  2310391

Query  136      KRQLTRQAIDQSVSP  150
                +     Q + +   P
Sbjct  2310392  RDSYHPQGMTEGPEP  2310436

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = +2

Query  25       GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
                G+V K+G   K+W+ RF+V+ G   Q++YY++ A   P        KGSF + ++E
Sbjct  5990327  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVDPTV----KAKGSFQVITVE  5990473

>PYUU:scaffold_2023 scf1117875582023 dna:supercontig supercontig:pug:scf1117875582023:1:1683196:1 
REF
Length=1683196

 Score = 42.4 bits (98),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +1

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
                EGYVTKRGH  ++W+ RF  ++G+NL    +
Sbjct  313543  WEGYVTKRGHLVRNWKNRFFTLEGTNLSCKQW  313638

>APIN:scaffold_3 supercont1.3 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.3:1:3119476:1 
REF
Length=3119476

 Score = 42.4 bits (98),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 8/83 (10%)
 Frame = -3

Query  2       NILRVPEHGTTASGDK-ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
               NI RV      A+  K +      G++ K+G    SW+ RFLV+ G N  +SYY+ +   
Sbjct  781046  NINRVGRRAGAATMQKDSSVNEWRGWIQKQGSVVPSWKKRFLVLSGQN--ISYYD-KDVS  780876

Query  61      HPPTGEPSAPKGSFYLSSIEPHE  83
               +P   E    KGSF L+ ++P++
Sbjct  780875  NPRAKE----KGSFVLAGVQPNK  780819

>PYIW:scaffold_4 piw_scaffold_4 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_4:1:82745:1 
REF
Length=82745

 Score = 42.4 bits (98),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVS  52
              EGYVTKRGH  ++W+ RF  ++G+NL  +
Sbjct  52256  EGYVTKRGHLVRNWKNRFFTLEGNNLSCT  52342

>PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3060, whole genome shotgun sequence
Length=3267112

 Score = 42.0 bits (97),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 55/133 (41%), Gaps = 14/133 (11%)
 Frame = -3

Query  12      TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPK  71
               T++ D A   S  G++ KRGH  K+W+ R+ V+  S L+   Y S A C    GE     
Sbjct  880679  TSAFDDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACCTKLKGEV----  880521

Query  72      GSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARN  131
                  +      H   V V G  D  F  + VG         L +  + L+DR  W+    +
Sbjct  880520  -LLFHPQTCVHYVDVHVTGGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIED  880362

Query  132     ALSVKRQLTRQAI  144
               AL  +     Q +
Sbjct  880361  ALLCRDSYQNQQV  880323

 Score = 39.7 bits (91),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGS  47
               EGYVTKRGH  ++W++RF  ++G+
Sbjct  73982  WEGYVTKRGHLVRNWKMRFFTLEGN  74056

>PHIF:NW_003303740.1 Phytophthora infestans T30-4 supercont1.19 
genomic scaffold, whole genome shotgun sequence
Length=2398068

 Score = 41.6 bits (96),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 23/111 (21%)
 Frame = +2

Query  23       CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
                CEGY+TKRGH   +W+ R+  + G+ L+  YY S         E S   G+  +  + P 
Sbjct  2269073  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  2269222

Query  83       EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                       G A   F F      P        V+  + A+R++WL   ++ +
Sbjct  2269223  S------GEAHG-FMFYTTKQIP------YYVYASSEAERSRWLRALKDFM  2269336

>PHRA:scaffold_4
Length=963095

 Score = 41.6 bits (96),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 54/135 (40%), Gaps = 14/135 (10%)
 Frame = +3

Query  16     DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y +  +C    GE        +
Sbjct  79806  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEV-----LLF  79961

Query  76     LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                    H   V V G  D  F  ++    P+     L +    L DR  W+    +AL  
Sbjct  79962  HPQTRVHYVDVHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDALLC  80123

Query  136    KRQLTRQAIDQSVSP  150
              +     Q +     P
Sbjct  80124  RDSYHPQGMTSGPGP  80168

 Score = 41.6 bits (96),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 54/135 (40%), Gaps = 14/135 (10%)
 Frame = +2

Query  16     DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y +  +C    GE        +
Sbjct  85112  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEV-----LLF  85267

Query  76     LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                    H   V V G  D  F  ++    P+     L +    L DR  W+    +AL  
Sbjct  85268  HPQTRVHYVDVHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDALLC  85429

Query  136    KRQLTRQAIDQSVSP  150
              +     Q +     P
Sbjct  85430  RDSYHPQGMTSGPGP  85474

>ALCA:scaffold_16 AcNc2_CONTIG_16_length_171156 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_16_length_171156:1:171156:1 
REF
Length=171156

 Score = 41.2 bits (95),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVS  52
               EGYVTKRGH  ++W++RF  ++G+ L  +
Sbjct  111625  EGYVTKRGHLVRNWKMRFFTLEGNRLSCT  111539

>PHIF:NW_003303698.1 Phytophthora infestans T30-4 supercont1.61 
genomic scaffold, whole genome shotgun sequence
Length=734189

 Score = 41.2 bits (95),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 50/118 (42%), Gaps = 14/118 (12%)
 Frame = +2

Query  16      DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
               D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    GE        +
Sbjct  681509  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCAKLKGEV-----LLF  681664

Query  76      LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                     H   V V G  D  F  ++        Y  L +    L DR  W+    +AL
Sbjct  681665  HPQTRVHYVDVHVAGGRDASFAIQV-----GPDYTLL-LQAAQLRDRENWMYCIEDAL  681820

>PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.5, whole genome shotgun 
sequence
Length=2147012

 Score = 40.8 bits (94),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 50/118 (42%), Gaps = 14/118 (12%)
 Frame = -2

Query  16      DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
               D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    GE        +
Sbjct  694672  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSCTKLKGEV-----LLF  694517

Query  76      LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                     H   V V G  D  F  ++    P      L +    L DR  W+    +AL
Sbjct  694516  HPQTRVHYVDVHVAGGRDASFAIQV---GPD---YTLLLQAAQLRDRENWMYCIEDAL  694361

>PYAR:scaffold_222 par_scaffold_222 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_222:1:24584:1 
REF
Length=24584

 Score = 40.8 bits (94),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (45%), Gaps = 18/110 (16%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
              EGYV K+G +   W  R+LV+DG+ L  +YY S+             +G   +S + P  
Sbjct  13257  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARSGRNL----RGRMIISKVRPEN  13418

Query  84     YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
              Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  13419  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  13532

>PHCA:scaffold_106 PHYCAscaffold_106
Length=144267

 Score = 40.8 bits (94),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 51/118 (43%), Gaps = 14/118 (12%)
 Frame = +3

Query  16     DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    GE        +
Sbjct  99108  DDAFLDSMSGWLRKRGHVRKNWKARYFVLERSVLR---YYTDSSCTKLKGEV-----LLF  99263

Query  76     LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                    H   V V G  D  F  ++    P+     L +    L DR  W+    +AL
Sbjct  99264  HPQTRVHYVDVHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDAL  99419

>ALLA:FR824067 dna:supercontig supercontig:ENA1:FR824067:1:183579:1 
REF
Length=183579

 Score = 40.8 bits (94),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVS  52
              EGYVTKRGH  ++W++RF  ++G+ L  +
Sbjct  83568  EGYVTKRGHLVRNWKMRFFTLEGNRLSCT  83654

>PYVX:scaffold_378 pve_scaffold_378 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_378:1:27273:1 
REF
Length=27273

 Score = 40.4 bits (93),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 8/76 (11%)
 Frame = +1

Query  6     VPEHGTTASGDKA-RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPT  64
             + E+  T +GD A      EGY+ KRGH   S R R+ V+ G+  +V+Y+    A    +
Sbjct  5146  MAENAVTPAGDDAGSAVLMEGYLVKRGHLMPSMRKRYCVLVGN--KVTYF----ATQDDS  5307

Query  65    GEPSAP-KGSFYLSSI  79
               P+AP  GSF ++++
Sbjct  5308  RNPNAPSNGSFNVATV  5355

>PYIW:scaffold_388 piw_scaffold_388 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_388:1:19611:1 
REF
Length=19611

 Score = 40.4 bits (93),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (45%), Gaps = 18/110 (16%)
 Frame = -2

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
             EGYV K+G +   W  R+LV+DG+ L  +YY ++             +G   +S + P  
Sbjct  5825  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL----RGRMIISKVRPEN  5664

Query  84    YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  5663  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  5550

>ALLA:FR824088 dna:supercontig supercontig:ENA1:FR824088:1:131184:1 
REF
Length=131184

 Score = 40.0 bits (92),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 18/110 (16%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+LV+DG+ L  +YY ++             +G   +  + P  
Sbjct  103872  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  103711

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  103710  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  103597

>SADI:scaffold_1 supercont1.1 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.1:1:1813439:1 
REF
Length=1813439

 Score = 40.0 bits (92),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 24/109 (22%)
 Frame = -1

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
               P +  GYV K+G F K+W+ R++V+    L   YY S  A        + P+G F     
Sbjct  206684  PPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERAT-------TKPRGFF-----  206547

Query  80      EPHEYVVGVMGAADKPFGFKMVGHAPKKGYV------ELDVFVDTLADR  122
                    V G+  A D P G    G   ++         E D + DTL++R
Sbjct  206546  ----RVTGIAYAPDLPHGLIADGTGTRRLKFTLADNDECDAWYDTLSER  206412

>PHKE:scaffold_129 scf_22126_129.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_129.1:1:86867:1 
REF
Length=86867

 Score = 40.0 bits (92),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGS  47
               EGYVTKRGH  ++W++RF  ++G+
Sbjct  53506  WEGYVTKRGHLVRNWKMRFFTLEGN  53580

>ALLA:FR824075 dna:supercontig supercontig:ENA1:FR824075:1:147583:1 
REF
Length=147583

 Score = 40.0 bits (92),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 9/44 (20%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEP  67
              EGYV KRGH  ++W++RF  ++G         +R +C  P  +P
Sbjct  48745  EGYVIKRGHLVRNWKMRFFTLEG---------NRLSCTSPLADP  48849

>APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.11:1:1510989:1 
REF
Length=1510989

 Score = 40.0 bits (92),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (51%), Gaps = 12/79 (15%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI----  79
               EG+V K+GH  ++W+VR+  ++G+ L  SYYE++        +    KG  +L+++    
Sbjct  876520  EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK----EDARKRRFLKGRVHLTTVMLVE  876681

Query  80      --EPHEYVVGVMGAADKPF  96
                   H Y +       KPF
Sbjct  876682  GRSAHGYDLTFTTQESKPF  876738

>PHRA:scaffold_27
Length=538834

 Score = 40.0 bits (92),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  24     EGYVTKRGHFRKSWRVRFLVVDGS  47
              EGYVTKRGH  ++W++RF  ++G+
Sbjct  48948  EGYVTKRGHLVRNWKMRFFTLEGN  48877

>SADI:scaffold_3 supercont1.3 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.3:1:1523884:1 
REF
Length=1523884

 Score = 39.7 bits (91),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (44%), Gaps = 18/119 (15%)
 Frame = -1

Query  15      GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSF  74
               G  A     EGYV K+G +   W  R+LV+DG++L  +YY ++             +G  
Sbjct  742474  GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNL----RGRM  742313

Query  75      YLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                ++ + P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  742312  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  742172

>PHPA:scaffold_32 NW_008649018.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.32, whole genome shotgun 
sequence
Length=687390

 Score = 39.7 bits (91),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGS  47
                EGYVTKRGH  ++W++RF  ++G+
Sbjct  578486  WEGYVTKRGHLVRNWKMRFFTLEGN  578560

>ALCA:scaffold_121 AcNc2_CONTIG_121_length_67320 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_121_length_67320:1:67320:1 
REF
Length=67320

 Score = 39.7 bits (91),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 18/110 (16%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
             EGYV K+G +   W  R+LV+DG+ L  +YY ++             +G   +  + P  
Sbjct  6604  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  6765

Query  84    YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  6766  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  6879

>PHPA:scaffold_7 NW_008648993.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.7, whole genome shotgun 
sequence
Length=2078921

 Score = 39.7 bits (91),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  1543523  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  1543419

>PHCA:scaffold_18 PHYCAscaffold_18
Length=984210

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -2

Query  21      TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  107642  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  107538

>PYIW:scaffold_649 piw_scaffold_649 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_649:1:15641:1 
REF
Length=15641

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
              T  EGYV K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  15492  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  15388

>PYVX:scaffold_12 pve_scaffold_12 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_12:1:106792:1 
REF
Length=106792

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVVDGS  47
              EGYVTKRGH  ++W++RF  ++G+
Sbjct  54264  EGYVTKRGHLVRNWKMRFFTLEGN  54335

>APAS:scaffold_5 supercont1.5 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.5:1:1915940:1 
REF
Length=1915940

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 18/110 (16%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+LV+DG++L  +YY S+      T      +G   ++ + P  
Sbjct  939623  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGTNL----RGRMIITKVLPEN  939784

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               Y         K  GF +       G+    +   T  +++ W+E+ + A+
Sbjct  939785  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  939898

>PHIF:NW_003303691.1 Phytophthora infestans T30-4 supercont1.68 
genomic scaffold, whole genome shotgun sequence
Length=714584

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGS  47
               EGYVTKRGH  ++W++RF  ++G+
Sbjct  364184  EGYVTKRGHLVRNWKMRFFTLEGN  364113

>PYVX:scaffold_5 pve_scaffold_5 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_5:1:126063:1 
REF
Length=126063

 Score = 39.3 bits (90),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 18/116 (16%)
 Frame = -2

Query  18     ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
              A     EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   LS
Sbjct  13715  AHEVHWEGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARSGRNL----RGRMQLS  13554

Query  78     SIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               + P  Y         K  GF +      +G+    +   T  +++ W+E+ + A+
Sbjct  13553  RVRPENY--------GKAHGFLI----ETRGHKSFHLCCTTELEKDMWVEMMQAAI  13422

>APAS:scaffold_25 supercont1.25 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.25:1:849228:1 
REF
Length=849228

 Score = 39.3 bits (90),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 31/57 (54%), Gaps = 1/57 (2%)
 Frame = -3

Query  1      MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGS-NLQVSYYES  56
               N  R+  H TT   D +      G++ K GH RK+W+ RF V+DGS  + +  +ES
Sbjct  22348  YNRHRIYHHNTT*CPDDSNLDRKTGWLYKLGHVRKNWKRRFFVLDGSVRMCIYLFES  22178

>PHPA:scaffold_42 NW_008649028.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.42, whole genome shotgun 
sequence
Length=594358

 Score = 39.3 bits (90),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
               G+V K+G   K+W+ RF+V+ G   Q++YY++      PT +   PKGSF + ++E
Sbjct  304013  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDTSKLV--PTVK---PKGSFQVITVE  304159

 Score = 33.5 bits (75),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 54/134 (40%), Gaps = 34/134 (25%)
 Frame = +3

Query  6       VPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
               V E  +T    +     C G++ K G   KSW+ R+  + GS L  SYY+S         
Sbjct  298437  VEERNSTDLIPRNESQGCVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKS---------  298583

Query  66      EPSAPKGSFYLSSIEPHEYV-----VGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
               E  +   S  + ++EPH  V     V  +G      G K++  A   G            
Sbjct  298584  EKGSLLRSVSVINVEPHPSVSLGLTVSTVG------GRKLIVQAESNG------------  298709

Query  121     DRNKWLEVARNALS  134
               + NKWL   + A++
Sbjct  298710  EFNKWLNAIQEAVA  298751

>PHRA:scaffold_38
Length=442185

 Score = 39.3 bits (90),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  378001  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  377897

>HYAP:scaffold_72 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_72:1:329297:1 
REF
Length=329297

 Score = 39.3 bits (90),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21      TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  226999  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  227103

>PHIF:NW_003303756.1 Phytophthora infestans T30-4 supercont1.3 
genomic scaffold, whole genome shotgun sequence
Length=5458067

 Score = 39.3 bits (90),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -2

Query  21       TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  3548866  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  3548762

 Score = 38.5 bits (88),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
               G+V K+G   K+W+ RF+V+ G   Q++YY++ +  +P       PKGSF + ++E
Sbjct  238426  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLNPTV----KPKGSFQVITVE  238572

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 26/120 (22%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               C G++ K G   KSW+ R+  + GS L  SYY+S         E  +   S  + SIEPH
Sbjct  233927  CVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKS---------EKGSLLRSVSVVSIEPH  234073

Query  83      EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS--VKRQLT  140
                 V           G  +  H+ +K    L +  D+  + ++WL   + A++   +R+LT
Sbjct  234074  PTV---------SLGLVVSTHSGRK----LIMQADSNEEFDRWLSAIQGAVAGENERKLT  234214

>SAPA:scaffold_273 supercont2.273 dna:supercontig supercontig:ASM15154v2:supercont2.273:1:15865:1 
REF
Length=15865

 Score = 38.9 bits (89),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 24/109 (22%)
 Frame = -2

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
             P    GYV K+G F K+W+ RF+V+    L   YY S  A        + P+G F ++S 
Sbjct  2949  PPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAM-------AKPRGFFRVTS-  2800

Query  80    EPHEYVVGVMGAADKPFGFKMVGHAPKKGYV------ELDVFVDTLADR  122
                     V  A D P G    G   ++         E D + DTL++R
Sbjct  2799  --------VAYAPDLPHGLIADGTGTRRLRFTLADSDECDAWYDTLSER  2677

>PYVX:scaffold_1190 pve_scaffold_1190 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1190:1:6005:1 
REF
Length=6005

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (44%), Gaps = 18/114 (16%)
 Frame = -1

Query  22    SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL--SSI  79
             S  G++ K GH RK+W+ R+ V++ S L+    ESR+            KG   L   + 
Sbjct  1958  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL----------KGEVLLFHPAT  1809

Query  80    EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               H   + + G  D  F  + VG      Y  L +  + L+DR  W+    +AL
Sbjct  1808  RVHYVDIHLSGGRDNTFAIQ-VG----SDYTLL-LQAERLSDRENWMYCIEDAL  1665

>PHCA:scaffold_2 PHYCAscaffold_2
Length=1925921

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
                 EGYVTKRGH  ++W+ RF  ++G+ +  ++
Sbjct  1737859  WEGYVTKRGHLVRNWKSRFFTLEGNLVSCTW  1737951

>APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.49:1:457786:1 
REF
Length=457786

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 26/34 (76%), Gaps = 2/34 (6%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               EG+V K+GH  ++W+VR+  ++G+ L  SYYE++
Sbjct  359787  EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  359882

>PLHA:NW_020187174.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_253, whole genome shotgun sequence
Length=912309

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 33/145 (23%), Positives = 63/145 (43%), Gaps = 24/145 (17%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +  + P  
Sbjct  307413  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----MRGRMTVYKVRPEN  307252

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--SVKRQLTR  141
               Y         K  GF +   + K    +  +   T  +++ W+E+   A+    +++ +R
Sbjct  307251  Y--------GKAHGFLLETQSHK----QFHLCCATELEKDMWVEMMHAAVEEGARQRNSR  307108

Query  142     QAIDQ----SVSPNKKTLFGFSVAL  162
                +++      +SP +  L GF  A 
Sbjct  307107  LSVEGMEILQISPTQVDLRGFYFAF  307033

>SAPA:scaffold_45 supercont2.45 dna:supercontig supercontig:ASM15154v2:supercont2.45:1:290975:1 
REF
Length=290975

 Score = 38.9 bits (89),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 2/30 (7%)
 Frame = +1

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
              G++ K GH RKSW+ RF V+DGS LQ  YY
Sbjct  94315  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YY  94398

>SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.27:1:696964:1 
REF
Length=696964

 Score = 38.9 bits (89),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               EG+V+K+GH  ++W++R+  ++ SNL +SYYES+
Sbjct  365903  EGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  365998

>PHKE:scaffold_69 scf_22126_69.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_69.1:1:116444:1 
REF
Length=116444

 Score = 38.9 bits (89),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 2/44 (5%)
 Frame = -2

Query  21     TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPT  64
              T  EGY+ K+GH  +SWR R+ V+ G  +  SYY S+      T
Sbjct  48994  TDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSKEVAKTDT  48869

>PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:pug:scf1117875582035:1:696189:1 
REF
Length=696189

 Score = 38.9 bits (89),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 5/62 (8%)
 Frame = -2

Query  19      RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPS-APKGSFYLS  77
               R    EGY+ KRGH   S R R+ V+      + YY    A H  +  PS AP GSF + 
Sbjct  263039  RQILLEGYLVKRGHLIPSMRKRYCVLLKRGNTLEYY----ATHEDSRNPSVAPHGSFRVD  262872

Query  78      SI  79
               ++
Sbjct  262871  TV  262866

>PHCA:scaffold_9 PHYCAscaffold_9
Length=1114135

 Score = 38.9 bits (89),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
               G+V K+G   K+W+ RF+V+ G   Q++YY++ A  +P T      KGSF + ++E
Sbjct  844406  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVNPTT----KAKGSFQVITVE  844552

>APIN:scaffold_8 supercont1.8 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.8:1:1936381:1 
REF
Length=1936381

 Score = 38.5 bits (88),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 18/110 (16%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+LV+DG++L  +YY S+      TG+    +G   ++ + P  
Sbjct  307391  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEAR--TGK--NLRGRMIITRVLPEN  307230

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               Y         K  GF +       G+    +   T  +++ W+E+ + A+
Sbjct  307229  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  307116

>PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_610:1:19546:1 
REF
Length=19546

 Score = 38.5 bits (88),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = -3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
              T  EGY+ K+GH  +SWR R+ ++ G+     ++
Sbjct  18683  TDWEGYIWKQGHVVRSWRYRYAILSGTTFSCKWW  18582

>PYIW:scaffold_1215 piw_scaffold_1215 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1215:1:10379:1 
REF
Length=10379

 Score = 38.5 bits (88),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 7/56 (13%)
 Frame = -3

Query  25    GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
             G+V K+G   ++W+ RFLV+ G   Q++YY++ A+  P T E    KGSF + ++E
Sbjct  9234  GWVFKQGSLVRNWKKRFLVLRGK--QLTYYDT-ASLTPKTKE----KGSFQVITVE  9088

>ALCA:scaffold_265 AcNc2_CONTIG_265_length_35910 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_265_length_35910:1:35910:1 
REF
Length=35910

 Score = 38.5 bits (88),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +2

Query  21    TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQV  51
             T  EGY+ KRGH  +SWR RF V+ G+ L  
Sbjct  9548  TDWEGYIWKRGHVVRSWRHRFAVLSGTCLSC  9640

>PHKE:scaffold_626 scf_22126_626.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_626.1_contig_1:1:14504:1 
REF
Length=14504

 Score = 38.5 bits (88),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 61/146 (42%), Gaps = 32/146 (22%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
             EG+V K+G +   W  R+L++DG+ L  +YY S+             +G   +  + P  
Sbjct  4123  EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIIVKVRPEN  4284

Query  84    YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQA  143
             Y         K  GF +      +G+    +   T  +++ W+E           + + A
Sbjct  4285  Y--------GKAHGFLI----ETQGHKHFHLCCSTELEKDMWVE-----------MMQAA  4395

Query  144   IDQSV--SPNKKTLFGF-SVALSPQP  166
             I++ V   PN  +L G  ++AL   P
Sbjct  4396  IEEGVRHGPNSMSLEGMDALALQASP  4473

>SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM15154v2:supercont2.19:1:569072:1 
REF
Length=569072

 Score = 38.5 bits (88),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               EG+V+K+GH  ++W++R+  ++ SNL +SYYES+
Sbjct  518276  EGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  518371

>PYUU:scaffold_2034 scf1117875582034 dna:supercontig supercontig:pug:scf1117875582034:1:1169325:1 
REF
Length=1169325

 Score = 38.5 bits (88),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)
 Frame = +2

Query  16       DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                D    T  EGY+ K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  1065680  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  1065799

>PYIR:scaffold_1 pir_scaffold_1 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1:1:175201:1 
REF
Length=175201

 Score = 38.5 bits (88),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               T  EGY+ K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  155625  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  155729

>ALLA:FR824502 dna:supercontig supercontig:ENA1:FR824502:1:15894:1 
REF
Length=15894

 Score = 38.5 bits (88),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -2

Query  21    TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQV  51
             T  EGY+ KRGH  +SWR RF V+ G+ L  
Sbjct  7745  TDWEGYIWKRGHVVRSWRHRFAVLSGTCLSC  7653

>PYAP:scaffold_87 pag1_scaffold_87 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_87:1:70840:1 
REF
Length=70840

 Score = 38.5 bits (88),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +3

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHP  62
             EGY+ K+G   K W+ R+ V DG  L  SYY SR    P
Sbjct  5436  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKP  5546

>APIN:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.2:1:2980645:1 
REF
Length=2980645

 Score = 38.5 bits (88),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 22/126 (17%)
 Frame = -1

Query  24      EGYV-TKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               EG+V  +R HF  +W+  + V+ G  L  + Y++R       G+P++ +   ++      
Sbjct  276214  EGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKREVVFVG-----  276056

Query  83      EYVVGV-MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS-------  134
               ++  GV  G A   F  + +    + G+VE   +VD  AD+ +W++  + A+S       
Sbjct  276055  DWYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQTAVSSLKADQL  275894

Query  135     VKRQLT  140
               V R LT
Sbjct  275893  VTRDLT  275876

>SAPA:scaffold_2 supercont2.2 dna:supercontig supercontig:ASM15154v2:supercont2.2:1:1567649:1 
REF
Length=1567649

 Score = 38.1 bits (87),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 50/110 (45%), Gaps = 18/110 (16%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+LV+DG++L  +YY ++             +G   ++ + P  
Sbjct  835917  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNL----RGRMIITRVLPEN  836078

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  836079  Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  836192

>SAPA:scaffold_70 supercont2.70 dna:supercontig supercontig:ASM15154v2:supercont2.70:1:179816:1 
REF
Length=179816

 Score = 38.1 bits (87),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 3/47 (6%)
 Frame = -2

Query  19     RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
              +P  C GY+ K+G   K+WR R+  +DG + Q+SY ++  A  PP G
Sbjct  16438  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDADGA--PPKG  16307

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 7/55 (13%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
              G+V K+G   KSW+ RFLVV G +  V+YY+   + H P       KGS  L  +
Sbjct  17178  GFVFKQGALIKSWKKRFLVVQGRH--VTYYDR--SVHEPNPR---EKGSLVLVDV  17035

>SAPA:scaffold_37 supercont2.37 dna:supercontig supercontig:ASM15154v2:supercont2.37:1:335642:1 
REF
Length=335642

 Score = 38.1 bits (87),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = +1

Query  21      TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
               T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A
Sbjct  106645  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  106755

>PLHA:NW_020189293.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2386, whole genome shotgun sequence
Length=2296535

 Score = 38.1 bits (87),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 2/42 (5%)
 Frame = -2

Query  16       DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                D    T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  1002403  DDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSK  1002284

>ALCA:scaffold_34 AcNc2_CONTIG_34_length_127434 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_34_length_127434:1:127434:1 
REF
Length=127434

 Score = 37.7 bits (86),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVS  52
              EGYV KRGH  ++W++RF  ++G+ +  +
Sbjct  51363  EGYVIKRGHLVRNWKMRFFTLEGNRVSCT  51277

>PYIR:scaffold_1853 pir_scaffold_1853 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1853:1:4729:1 
REF
Length=4729

 Score = 37.7 bits (86),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 49/114 (43%), Gaps = 18/114 (16%)
 Frame = -3

Query  25    GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL--SSIEPH  82
             G++ K GH RK+W+ R+ V++ S L+    ES A            KG   L   +   H
Sbjct  2474  GWLRKLGHVRKNWKSRYFVLEKSVLRYYADESMARL----------KGEVLLFHPATRVH  2325

Query  83    EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
                + + G  D  F    VG    K Y  L +  D L+DR  W+    +AL  +
Sbjct  2324  YVDIHLSGGKDCTFAIH-VG----KDYALL-LQADQLSDRENWMYCIEDALLCR  2181

>PYAR:scaffold_1116 par_scaffold_1116 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1116:1:10258:1 
REF
Length=10258

 Score = 37.7 bits (86),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21    TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
             T  EGY+ K+GH  ++WR R+ ++ G+    SYY S+
Sbjct  3823  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  3927

>PYUU:scaffold_2006 scf1117875582006 dna:supercontig supercontig:pug:scf1117875582006:1:1270039:1 
REF
Length=1270039

 Score = 37.7 bits (86),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 5/45 (11%)
 Frame = -2

Query  11      TTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
               T+ S    R T   G++ K+GH  KSW+ RF VV+GS   ++Y+E
Sbjct  804354  TSGSDSGTRKT---GWLNKQGHRMKSWKRRFFVVEGST--ITYFE  804235

 Score = 34.3 bits (77),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 59/129 (46%), Gaps = 25/129 (19%)
 Frame = -2

Query  13      ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKG  72
               AS D + P  C G++ K G   K+W++R+  + G+ L  +Y++S              KG
Sbjct  803448  ASLDDSLP-GCSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS-------------DKG  803317

Query  73      SFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
                  L +++    V  V+    K F  ++     +K    L +  DT A+ ++WL     A
Sbjct  803316  PL-LKALK----VCYVLPMRTKKFCLEVTMETGRK----LLIAADTQAEHDRWLAALHQA  803164

Query  133     LSVKRQLTR  141
               +S +++  R
Sbjct  803163  VSAEKEKDR  803137

 Score = 34.3 bits (77),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
               CEG++ KRG    +W+ RF  ++G  LQ
Sbjct  804747  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ  804664

>PYAR:scaffold_951 par_scaffold_951 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_951:1:11721:1 
REF
Length=11721

 Score = 37.4 bits (85),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 56/128 (44%), Gaps = 18/128 (14%)
 Frame = -2

Query  8      EHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEP  67
              +H T +  D     S  G++ K GH RK+W++R+ V++ S L+  YY   A         
Sbjct  10787  DHPTASPFDDTFLDSMCGWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEAM--------  10638

Query  68     SAPKGSFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
              +  KG   L   + + H   + +    D  F  + VG      Y  L +  D ++DR  W
Sbjct  10637  TRLKGEVLLFHPAAQVHYVDIHLSNGRDNTFAIQ-VG----PDYTLL-LEADRVSDRENW  10476

Query  126    LEVARNAL  133
              +    +AL
Sbjct  10475  MYCIEDAL  10452

>PYAP:scaffold_747 pag1_scaffold_747 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_747:1:14717:1 
REF
Length=14717

 Score = 37.4 bits (85),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 71/167 (43%), Gaps = 27/167 (16%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
              G++ K GH RK+W++R+ V+D S L+  YY             +  KG   L       +
Sbjct  13541  GWLRKLGHVRKNWKLRYFVLDKSVLR--YYSDEGM--------TRLKGEVLLFHPATQVH  13392

Query  85     VVGVMGAADKPFGFKM-VGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTR--  141
               V +  +  K   F + VG  P+     L +  + LADR  W+    +AL  +    +  
Sbjct  13391  YVDIHESRGKDHTFAIQVG--PE---YTLLLQAERLADRENWMYCIEDALLCRDSYLQDP  13227

Query  142    ---QAIDQSVS-----PNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
                 Q + +SV+      ++  LF  S   SP   ++P   +   +KS
Sbjct  13226  KRAQDVRESVARRRNFSSESILFSLSTG-SPHDGINPMNMVMLHSKS  13089

>ALLA:FR824181 dna:supercontig supercontig:ENA1:FR824181:1:68077:1 
REF
Length=68077

 Score = 37.7 bits (86),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
              T  EGY+ K+GH  +SWR R+ V+ G+     Y
Sbjct  25908  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCKY  26006

>ALLA:FR824176 dna:supercontig supercontig:ENA1:FR824176:1:68905:1 
REF
Length=68905

 Score = 37.7 bits (86),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = -3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
              T  EGY+ K+GH  +SWR R+ V+ G+     Y
Sbjct  42602  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCKY  42504

>PYIW:scaffold_1511 piw_scaffold_1511 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1511:1:8511:1 
REF
Length=8511

 Score = 37.4 bits (85),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 50/117 (43%), Gaps = 18/117 (15%)
 Frame = +1

Query  22    SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL--SSI  79
             S  G++ K GH RK+W+ R+ V+D S L+    ES A            KG   L   + 
Sbjct  3250  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLARL----------KGEVLLFHPAT  3399

Query  80    EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
               H   + + G  D  F    VG    K Y  L +  + L+DR  W+    +AL  +
Sbjct  3400  RVHYVDIHLSGGKDGTFAIH-VG----KDYALL-LQAEQLSDRENWMYCIEDALLCR  3552

>SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.13:1:908568:1 
REF
Length=908568

 Score = 37.4 bits (85),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = +3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
               T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A
Sbjct  537378  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  537488

>APIN:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.12:1:1527504:1 
REF
Length=1527504

 Score = 37.4 bits (85),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 23/39 (59%), Gaps = 2/39 (5%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHP  62
               EGY+ K+G   K W+ R+ V DG +L  SYY S+    P
Sbjct  486848  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKLEKKP  486958

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 2/35 (6%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
               EGY+ K+G   K W+ R+ V DG +L  SY+ ++A
Sbjct  489917  EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKA  490015

>SAPA:scaffold_467 supercont2.467 dna:supercontig supercontig:ASM15154v2:supercont2.467:1:7718:1 
REF
Length=7718

 Score = 37.4 bits (85),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +1

Query  21    TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
             T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A 
Sbjct  7465  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAA  7578

>PYVX:scaffold_291 pve_scaffold_291 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_291:1:31219:1 
REF
Length=31219

 Score = 37.4 bits (85),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = -1

Query  21     TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
              T  EGY+ K+GH  +SWR R+ V+ G+     +
Sbjct  29512  TDWEGYIWKQGHVVRSWRYRYAVLSGTTFSCKW  29414

>PYUU:scaffold_1722 scf1117875581722 dna:supercontig supercontig:pug:scf1117875581722:1:328448:1 
REF
Length=328448

 Score = 37.4 bits (85),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
              G+V K+G   ++W+ RF+V+ G   Q++YY++ A+  P T E    KGSF + + E
Sbjct  48051  GWVFKQGSLVRNWKKRFMVLRGK--QLTYYDT-ASISPKTKE----KGSFQVITAE  48197

 Score = 36.6 bits (83),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 36/65 (55%), Gaps = 7/65 (11%)
 Frame = +2

Query  1      MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
              M++++ P    + S    +P    G++ K+GH  +SW+ R+ V+ G +LQ  Y+E+    
Sbjct  76295  MDLVKAP---PSLSPSIVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN--ID  76453

Query  61     HPPTG  65
               PP G
Sbjct  76454  KPPRG  76468

>PYAP:scaffold_11 pag1_scaffold_11 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_11:1:137235:1 
REF
Length=137235

 Score = 37.0 bits (84),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 60/133 (45%), Gaps = 21/133 (16%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
              G++ K+G   K+W+ RF+V+ G   Q++YY++     P   E    KGSF + ++E    
Sbjct  54496  GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTE-RISPRVKE----KGSFQVITVEL---  54347

Query  85     VVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQAI  144
                    ++D   G  + G   +     L ++ D+  + N W     +A +        A+
Sbjct  54346  ------SSDIQNGLIVHGRGGRV----LKLYTDSTDNTNGWYHAIMDATNNTGGGGGSAV  54197

Query  145    DQSVSPNKKTLFG  157
              D+ +S    TL G
Sbjct  54196  DR-LSDRYSTLSG  54161

>SADI:scaffold_69 supercont1.69 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.69:1:294325:1 
REF
Length=294325

 Score = 37.0 bits (84),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 2/30 (7%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
               G++ K GH RK+W+ RF V+DGS LQ  YY
Sbjct  265147  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  265230

>SADI:scaffold_17 supercont1.17 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.17:1:803178:1 
REF
Length=803178

 Score = 37.0 bits (84),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 7/55 (13%)
 Frame = -2

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
               G+V K+G   KSW+ RFLVV G +  VSYY+   + H P  +P   KGS  L  +
Sbjct  253364  GFVFKQGSLIKSWKKRFLVVQGRH--VSYYDR--SVHEP--DPR-EKGSLVLGDV  253221

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = -2

Query  19      RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
               +P  C G + K+G   K+WR R+  +DG + Q+SY  S A   PP G
Sbjct  252611  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSY--SDAETEPPKG  252480

>APAS:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.4:1:1887962:1 
REF
Length=1887962

 Score = 37.0 bits (84),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (53%), Gaps = 5/51 (10%)
 Frame = -2

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAP  70
                P   EGY+ KRG +   W    +V+DG  L+VSYY+       P  +P AP
Sbjct  1422163  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYDRLDG---PPAKPHAP  1422026

>APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.2:1:2059303:1 
REF
Length=2059303

 Score = 37.0 bits (84),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 2/39 (5%)
 Frame = +3

Query  24       EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHP  62
                EGY+ K+G   K W+ R+ V DG +L  SYY ++    P
Sbjct  1220973  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTKLEKKP  1221083

 Score = 33.5 bits (75),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 2/33 (6%)
 Frame = +2

Query  24       EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
                EGY+ K+G   K W+ R+ V DG  L  SY+ +
Sbjct  1224350  EGYLQKQGQLLKGWKKRWFVCDGRTL--SYFHT  1224442

>ALLA:FR824471 dna:supercontig supercontig:ENA1:FR824471:1:18709:1 
REF
Length=18709

 Score = 37.0 bits (84),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 36/62 (58%), Gaps = 5/62 (8%)
 Frame = +2

Query  25    GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL---SSIEP  81
             GY+ KRG   KS+R R++ ++G+ L  SYY+ + +        + P+GS  L   +S++P
Sbjct  5756  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTSLQP  5929

Query  82    HE  83
              E
Sbjct  5930  LE  5935

>PHCA:scaffold_27 PHYCAscaffold_27
Length=705730

 Score = 37.0 bits (84),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 57/119 (48%), Gaps = 30/119 (25%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L+     
Sbjct  527809  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKG--------RKKIKGCMQLN-----  527940

Query  83      EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
               + VV V    +  ADK + F++     +KG+ +L  +  +  +   W+   R   SV+R
Sbjct  527941  DGVVSVQHVDIRVADKAYVFQI-----EKGFYKLMCYCCSQFEAELWVSALR---SVRR  528093

>PHKE:scaffold_269 scf_22126_269.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_269.1_contig_1:1:49737:1 
REF
Length=49737

 Score = 36.6 bits (83),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = +2

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
              G+V K+G   K+W+ RF+V+ G   Q++YY++ A   P        KGSF + ++E
Sbjct  17525  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVSPTV----KAKGSFQVITVE  17671

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 53/125 (42%), Gaps = 33/125 (26%)
 Frame = +2

Query  10     GTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSA  69
              GT A G +  P +  G+V K G   +SW+ RFLV  G+ L  +YY++             
Sbjct  15530  GTGAMG-RTDPVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN-------------  15661

Query  70     PKGSFYLSSIEPHEYVVGVMGAA------DKPFGFKMVGHAPKKGYVELDVFVDTLADRN  123
                     +  E H  ++G + AA      D   G  + G   +    +L +F DT A+ +
Sbjct  15662  -------TDEENHAQLLGALTAAHIERLPDITNGLLIHGTEGR----QLKIFTDTKAESD  15808

Query  124    KWLEV  128
              +  E 
Sbjct  15809  RLFEA  15823

>HYAP:scaffold_99 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_99:1:256057:1 
REF
Length=256057

 Score = 36.6 bits (83),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              GY+ K+G F KSWR RF ++      +SYY S
Sbjct  21634  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  21539

>PHCA:scaffold_42 PHYCAscaffold_42
Length=526029

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 56/124 (45%), Gaps = 16/124 (13%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR-AACHPPTGEPSAPKGSFYLSSIEPH  82
               EGY+ KRGH   S R R+ V+ G+ L  SYY +   + +P  G  + P G+F++      
Sbjct  350103  EGYLMKRGHKIPSMRKRYCVLIGNEL--SYYVTHDDSKNPGGGAMTNPLGNFHIE-----  349945

Query  83      EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVF---VDTLADRNKWLEVARNALSVKRQL  139
                    V G        +   HA +    +   F     T  ++ +W++  R  +++ R+ 
Sbjct  349944  -----VAGDWHGKTATQTYEHAMELETTDGKTFFCAAATAKEKQQWVDAFRRGIALARKE  349780

Query  140     TRQA  143
                R+A
Sbjct  349779  QRRA  349768

>ALCA:scaffold_55 AcNc2_CONTIG_55_length_103441 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_55_length_103441:1:103441:1 
REF
Length=103441

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 66/162 (41%), Gaps = 28/162 (17%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
              GY+ K+G F KSWR RF ++      ++YY S+       GE S    S  L +  P   
Sbjct  93098  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKEHL-TKLGEISVDDQSVLLKT--PRNG  92928

Query  85     VVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLAD-RNKWLEVARNALSVKRQLTRQA  143
              +         P  F  V HA +     L +F +   D  N W++  R +  ++ ++ R A
Sbjct  92927  I---------PHCF-TVKHAART----LIMFTEDGEDIMNTWMD--RISRCIRLRIDRNA  92796

Query  144    IDQ--------SVSPNKKTLFGFSVALSPQPAMSPQKQMQTL  177
              I          SV+  +  L   + A+   P   P  + Q +
Sbjct  92795  ITNTIMDREQSSVNSTESALILDTAAIRAHPKTHPSHKHQNV  92670

>ALCA:scaffold_13 AcNc2_CONTIG_13_length_192192 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_13_length_192192:1:192192:1 
REF
Length=192192

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 2/73 (3%)
 Frame = -3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGS--FYLSS  78
               T  EGY+ K+GH  +SWR R+ V+ G+    +    ++     TG+      S    ++ 
Sbjct  137083  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQSVITQLTGDCCVDYSSKEIAMAD  136904

Query  79      IEPHEYVVGVMGA  91
                E +   V V GA
Sbjct  136903  TERYRGRVTVTGA  136865

>PHRA:scaffold_16
Length=604796

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 57/119 (48%), Gaps = 30/119 (25%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L+     
Sbjct  436829  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR--------KKIKGCMQLN-----  436960

Query  83      EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
               + VV V    +  ADK + F++     +KG+ +L  +  +  +   W+   R   SV+R
Sbjct  436961  DGVVSVQHVDVRVADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALR---SVRR  437113

>HYAP:scaffold_29 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_29:1:564789:1 
REF
Length=564789

 Score = 36.2 bits (82),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
              EGYV K+G +   W  R+L++DG  L  +YY S+
Sbjct  31555  EGYVRKKGDWLPRWEERYLILDGPTL--TYYNSK  31650

>PHKE:scaffold_58 scf_22126_58.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_58.1:1:127707:1 
REF
Length=127707

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 55/117 (47%), Gaps = 27/117 (23%)
 Frame = -2

Query  25     GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
              G++TK+GH  KSW+ RF V+  DG+ +   YY+++             KG   L+     
Sbjct  20051  GWLTKQGHMWKSWKTRFFVLFSDGTFV---YYKNKGR--------KKIKGCMQLN-----  19920

Query  83     EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
              + VV +    +  A+KP+ F++     +KG+  L  +  +  +   W+   R+   V
Sbjct  19919  DGVVSIQHVDVRVAEKPYVFQI-----EKGFYRLLCYCCSQFEAELWVTALRSVRRV  19764

>SADI:scaffold_15 supercont1.15 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.15:1:848687:1 
REF
Length=848687

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 50/127 (39%), Gaps = 33/127 (26%)
 Frame = +2

Query  13     ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG-------  65
              A  D A+P   EG +TKR  + K WR R+ V+ G+ L    Y  RA    P G       
Sbjct  76298  AVADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGMIDLSEC  76462

Query  66     ----------------EPSAPKGSFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKK  107
                              E + P+ ++Y+   S E  +  +G +G A   F     G     
Sbjct  76463  LTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---D  76633

Query  108    GYVELDV  114
              GY E DV
Sbjct  76634  GYDEEDV  76654

>HYAP:scaffold_46 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_46:1:421953:1 
REF
Length=421953

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 57/119 (48%), Gaps = 30/119 (25%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L+     
Sbjct  109870  GWLTKQGHLWKSWKTRFFVLFADGT---FAYYKNKGR--------KKIKGCMQLN-----  110001

Query  83      EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
               + VV V    +  A+K + F++     +KG+ +L  +  +  +   W+   R   SV+R
Sbjct  110002  DGVVSVQHVDIRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVAALR---SVRR  110154

>PYAR:scaffold_122 par_scaffold_122 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_122:1:30762:1 
REF
Length=30762

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)
 Frame = -2

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
             EG++ K+G   KSW+ R+ V DG  L  SYY SR
Sbjct  2123  EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR  2028

>PYVX:scaffold_44 pve_scaffold_44 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_44:1:74626:1 
REF
Length=74626

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = +1

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
              G+V K+G   ++W+ RF+V+ G   Q++YY++ A   P        KGSF L ++E
Sbjct  13987  GWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT-ARLTPSV----KAKGSFTLITVE  14133

>APAS:scaffold_22 supercont1.22 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.22:1:940546:1 
REF
Length=940546

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 32/136 (24%), Positives = 52/136 (38%), Gaps = 9/136 (7%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
               EGY+ KR  + K W   + V+ G  L     +  A  HP   +     G F  S     +
Sbjct  441431  EGYLMKRSDWLKHWETYYFVLHGRVLYCYLSDEEAKLHPENSK--IKHGKFTFSDNLILD  441258

Query  84      YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQA  143
                V+ V       F F+       KG  ++ +   T A +  W+ +A + +     L  Q 
Sbjct  441257  EVITVQSRLTYEFVFE-----SDKG-KQIHLRAKTEASKQMWMHMACHGIVDTEMLRNQV  441096

Query  144     IDQSVSPNKK-TLFGF  158
               +    +P +  TL  F
Sbjct  441095  LHMRRTPQRHATLVDF  441048

>SADI:scaffold_25 supercont1.25 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.25:1:683613:1 
REF
Length=683613

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 2/33 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              EGY+ K+G   K W+ R+ V DG +L  SYY S
Sbjct  48892  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  48984

>APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.15:1:1122121:1 
REF
Length=1122121

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                T  EGYV K+GH  ++WR R+ ++ G+    +YY S+
Sbjct  1066084  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  1066188

>APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.18:1:978767:1 
REF
Length=978767

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 9/53 (17%)
 Frame = +2

Query  10     GTTASGDKA---RPTSC----EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
              GTT S   A   R TSC    EG++ K+G   KSW+ R+ VV G++L  +YY+
Sbjct  97244  GTTTSLTSAAFSRRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYK  97396

>SAPA:scaffold_5 supercont2.5 dna:supercontig supercontig:ASM15154v2:supercont2.5:1:1129684:1 
REF
Length=1129684

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 2/33 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              EGY+ K+G   K W+ R+ V DG +L  SYY S
Sbjct  88957  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  89049

>PHPA:scaffold_98 NW_008649084.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.98, whole genome shotgun 
sequence
Length=151830

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              GY+ K+G F KSWR RF ++      + YY S
Sbjct  62031  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  61936

>PHSO:scaffold_3
Length=10773376

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
                GY+ K+G F KSWR RF ++      + YY S
Sbjct  3934639  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  3934544

 Score = 34.7 bits (78),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  2073133  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  2073038

>SAPA:scaffold_6 supercont2.6 dna:supercontig supercontig:ASM15154v2:supercont2.6:1:961754:1 
REF
Length=961754

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 49/125 (39%), Gaps = 33/125 (26%)
 Frame = +3

Query  15      GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG---------  65
                D A+P   EG +TKR  + K WR R+ V+ G+ L    Y  RA    P G         
Sbjct  503388  ADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGVIDLSECLT  503552

Query  66      --------------EPSAPKGSFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGY  109
                             E + P+ ++Y+   S E  +  +G +G A   F     G     GY
Sbjct  503553  VKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTG---DDGY  503723

Query  110     VELDV  114
                E DV
Sbjct  503724  DEEDV  503738

>PHCA:scaffold_14 PHYCAscaffold_14
Length=1100894

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = -1

Query  1       MNILRVPEHGTTASGDKARPTSC-EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               M  L+ PE     S     PT   EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  548075  MIFLKWPERVPVESMPDYDPTYMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  547908

>PYIW:scaffold_784 piw_scaffold_784 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_784:1:14159:1 
REF
Length=14159

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 60/133 (45%), Gaps = 25/133 (19%)
 Frame = -2

Query  16     DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
              D++ P  C GY+ K G   KSW++R+  + G+ L  SY++S           + P     
Sbjct  10108  DESLP-GCSGYLRKEGSTIKSWKLRYFTLTGTTL--SYFKS----------DNGP----L  9980

Query  76     LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
              + +++    V  V     K F  ++   + +K    L V  D+ A+  +WL     A+S+
Sbjct  9979   IKTLK----VCFVHVLRTKKFCLEVTTESGRK----LLVAADSNAEYERWLAALHQAVSL  9824

Query  136    KRQLTRQAIDQSV  148
              ++Q  +    Q +
Sbjct  9823   EKQSKKAGTTQKI  9785

 Score = 35.4 bits (80),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 26/46 (57%), Gaps = 4/46 (9%)
 Frame = -3

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPS  68
              CEG++ KRG    +W+ RF  ++G   Q++Y E+      P GE S
Sbjct  11703  CEGWLYKRGQRSTAWKKRFFTLNG--FQLTYQENPG--DNPKGEGS  11578

>PHRA:scaffold_82
Length=214170

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 60/130 (46%), Gaps = 28/130 (22%)
 Frame = +2

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQ--VSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
              EGY+ KRGH   S R R+ V+ G+ L   V++ +S+   +P  G  +AP G F ++    
Sbjct  78806  EGYLMKRGHKIPSMRKRYCVLLGNELSYFVTHDDSK---NPGGGATTAPLGKFRVA----  78964

Query  82     HEYVVGVMGAADKPFGFKMVGHAPKKGYVELD--------VFVDTLADRNKWLEVARNAL  133
                 VVG        +  K   H+ + G +EL+            T  ++  W++  R  +
Sbjct  78965  ---VVG-------DWHGKTATHSYEHG-MELETSDGKTFFCAASTAKEKQLWVDAIRRGI  79111

Query  134    SVKRQLTRQA  143
              ++ R   R+A
Sbjct  79112  ALARNQQRRA  79141

>HYAP:scaffold_312 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_312:1:30087:1 
REF
Length=30087

 Score = 35.4 bits (80),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (57%), Gaps = 7/58 (12%)
 Frame = +3

Query  23     CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
              C G+V K+G   K+W+ RF+V+     Q++YY +      PT +    KGSF + ++E
Sbjct  10053  CAGWVYKQGSLVKNWKKRFMVL--RERQLTYYNTDIV--TPTVK---AKGSFQVITVE  10205

>PHIF:NW_003303710.1 Phytophthora infestans T30-4 supercont1.49 
genomic scaffold, whole genome shotgun sequence
Length=1170383

 Score = 35.4 bits (80),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
               GY+ K+G F KSWR RF ++      + YY S
Sbjct  756116  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  756021

>PHRA:scaffold_66
Length=301783

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              GY+ K+G F KSWR RF ++      + YY S
Sbjct  68663  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  68568

>PHKE:scaffold_238 scf_22126_238.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_238.1_contig_1:1:54351:1 
REF
Length=54351

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 12/62 (19%)
 Frame = +2

Query  34    RKSWRVRFLVVDGSNLQVSYYESRAACHPPTG-----------EPSAP-KGSFYLSSIEP  81
             ++SW  R+ V+D     +SYY    A H PT             P+ P KGS  +SS +P
Sbjct  5279  KRSWHRRWFVLDRQRGVLSYYRHNPANHIPTASSHGNIVHMADSPAPPGKGSAAVSSSQP  5458

Query  82    HE  83
             HE
Sbjct  5459  HE  5464

>APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.14:1:1185136:1 
REF
Length=1185136

 Score = 35.4 bits (80),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                T  EGYV K+GH  ++WR R+ ++ G+    +YY S+
Sbjct  1143919  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  1144023

>ALCA:scaffold_25 AcNc2_CONTIG_25_length_153538 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_25_length_153538:1:153538:1 
REF
Length=153538

 Score = 35.4 bits (80),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 8/56 (14%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
              G+V K+G   K+W+ RF+V++G+ L+  YY S ++        +  KGS  + S+E
Sbjct  24954  GWVYKQGAIVKTWKRRFMVLNGTELK--YYNSSSSM------KTEEKGSVQILSVE  25097

>PHKE:scaffold_90 scf_22126_90.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_90.1:1:106827:1 
REF
Length=106827

 Score = 35.0 bits (79),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              GY+ K+G F KSWR RF ++      + YY S
Sbjct  86298  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  86203

>PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 
genomic scaffold, whole genome shotgun sequence
Length=2518706

 Score = 35.0 bits (79),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = -2

Query  24       EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
                EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  1388122  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  1388027

>PHIF:NW_003303755.1 Phytophthora infestans T30-4 supercont1.4 
genomic scaffold, whole genome shotgun sequence
Length=5137561

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 5/35 (14%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESR  57
                G++TK+GH  KSW+ RF V+  DG+    +YY+++
Sbjct  1389124  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  1389029

>PLHA:NW_020187350.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_430, whole genome shotgun sequence
Length=1405462

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  769638  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  769733

>PHRA:scaffold_1
Length=1244001

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 55/116 (47%), Gaps = 21/116 (18%)
 Frame = +2

Query  25      GYVTKRG-HFRKSWRVRFLVVDGSNLQVSYYE-------SRAACHPPTGEPSAPKGSFYL  76
               G + KRG  +RK W++RF+ +DG   Q++YYE       + A+C+  T     PK    L
Sbjct  529454  GSLEKRGFRWRKKWKLRFVELDGR--QLAYYEDTGAFCATTASCN-GTKRSCKPKRKVML  529624

Query  77      SSIEPHEYV----VGVMGAAD-KPFGFKMVGHAPKKGY-VELDVFVDTLADRNKWL  126
               ++    E V    V V  A D KP+  +    A K+ + V L   +D L     WL
Sbjct  529625  TADATLEDVDDKTVSVTPALDEKPWMLRARDAATKQRWLVALSDCIDILV----WL  529780

>PLHA:NW_020190023.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3120, whole genome shotgun sequence
Length=2481951

 Score = 35.0 bits (79),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -3

Query  25       GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
                GY+ K+G F KSWR RF ++      + YY S
Sbjct  1843159  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  1843064

>PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.16, whole genome shotgun 
sequence
Length=1156373

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  382707  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  382802

>PHKE:scaffold_26 scf_22126_26.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_26.1:1:190058:1 
REF
Length=190058

 Score = 34.7 bits (78),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  157298  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  157203

>PHRA:scaffold_67
Length=286994

 Score = 34.7 bits (78),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
              EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  56953  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  57048

>PHPA:scaffold_53 NW_008649039.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.53, whole genome shotgun 
sequence
Length=442537

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 5/35 (14%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESR  57
               G++TK+GH  KSW+ RF V+  DG+    +YY+++
Sbjct  120919  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  121014

>ALCA:scaffold_29 AcNc2_CONTIG_29_length_140563 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_29_length_140563:1:140563:1 
REF
Length=140563

 Score = 34.7 bits (78),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = -2

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
              +G++ KRGH +K+W+ RF  V+   LQ  + E+R
Sbjct  17295  DGFLWKRGHLKKNWKKRFFRVENGQLQY-FTENR  17197

>SAPA:scaffold_40 supercont2.40 dna:supercontig supercontig:ASM15154v2:supercont2.40:1:298837:1 
REF
Length=298837

 Score = 34.7 bits (78),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (53%), Gaps = 13/70 (19%)
 Frame = -1

Query  17      KARPTSC------EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAP  70
               +AR TS        G++ K+G   K+W+ RF+V+   +L   Y+E+      PT +   P
Sbjct  230200  RARSTSAPPSRDHRGWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT--PTLK---P  230042

Query  71      KGSFYLSSIE  80
               KGSF +  IE
Sbjct  230041  KGSFQVLVIE  230012

>PYVX:scaffold_722 pve_scaffold_722 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_722:1:14843:1 
REF
Length=14843

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 27/140 (19%)
 Frame = -3

Query  15     GDKARPTS---CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPK  71
              G    PT    C G++ K G   KSW+ R+  + G+ L   Y++S               
Sbjct  11952  GSNLEPTDLVVCSGWLRKEGGTVKSWKQRYFTLHGTTL--CYFKS-------------DN  11818

Query  72     GSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARN  131
              G+   S I  H     V+    K    ++   + +K    L V  D+  D  +WL   + 
Sbjct  11817  GALLRSLIVCH-----VVTVRTKTLCLEITTESGRK----LLVASDSQVDFERWLSSLQR  11665

Query  132    ALSVKRQLTRQAIDQSVSPN  151
              AL V ++    AI +  SP+
Sbjct  11664  ALVVDKERKFAAIREKRSPS  11605

>SAPA:scaffold_341 supercont2.341 dna:supercontig supercontig:ASM15154v2:supercont2.341:1:13343:1 
REF
Length=13343

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 39/80 (49%), Gaps = 7/80 (9%)
 Frame = -1

Query  9     HGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGS----NLQVSYYESRAACHPPT  64
             H  +  G     T    + +++G F K W+VR + V GS     L+V  +  +  C    
Sbjct  1577  HQASKKGQGENRTQIRIFGSRKGFFPKQWKVRPMFVSGSRPRRTLEVRSFSGK--CAKLR  1404

Query  65    G-EPSAPKGSFYLSSIEPHE  83
             G EP+AP+ +F+ S ++  E
Sbjct  1403  GFEPNAPRNTFFRSCVDGLE  1344

>APIN:scaffold_71 supercont1.71 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.71:1:149896:1 
REF
Length=149896

 Score = 34.7 bits (78),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 28/59 (47%), Gaps = 6/59 (10%)
 Frame = +1

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR----AACHPPTGEPSAPKGSFYLSSI  79
              G + KRGH RK+W  RF V+    L+  YY       A C   + +P   +G   L+ I
Sbjct  53449  GILLKRGHLRKNWLTRFFVLTSGALR--YYRKPPGGGAKCTTWSVDPRYLRGELPLADI  53619

>PYAP:scaffold_549 pag1_scaffold_549 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_549:1:22126:1 
REF
Length=22126

 Score = 34.7 bits (78),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
              EGY+ K+G   K W+ R+ V +G  L  SYY SR
Sbjct  18799  EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISR  18894

>PYIR:scaffold_1235 pir_scaffold_1235 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1235:1:9021:1 
REF
Length=9021

 Score = 34.3 bits (77),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 23/36 (64%), Gaps = 2/36 (6%)
 Frame = -2

Query  22    SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
             S EGY+ K+    +SW+  + V++G  +  +YYESR
Sbjct  3614  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESR  3513

>PYAR:scaffold_995 par_scaffold_995 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_995:1:11277:1 
REF
Length=11277

 Score = 34.3 bits (77),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 6/51 (12%)
 Frame = +1

Query  6     VPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
             V   GTT  G     T  +G++ K G   KSW+ R+ V+DG+ L   YYE+
Sbjct  6868  VASPGTTTPG----ATIKKGWLRKEGQRMKSWKRRYFVLDGTRLH--YYEN  7002

>PLHA:NW_020189809.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2904, whole genome shotgun sequence
Length=1431973

 Score = 34.3 bits (77),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 27/117 (23%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
               G++ K+GH  KSW+ RF V+  DG+   V YY++++            KG  +L+     
Sbjct  779623  GWLKKQGHMWKSWKARFFVLFSDGT---VVYYKNKSR--------KKIKGYMHLN-----  779754

Query  83      EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
               + VV V    +  A K + F++     +KG+  L     +  D   W+   R+   V
Sbjct  779755  DGVVSVQHVDIRVAGKAYVFQI-----EKGFYRLLCHCSSQIDAELWVTALRSVRKV  779910

>ALCA:scaffold_49 AcNc2_CONTIG_49_length_115235 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_49_length_115235:1:115235:1 
REF
Length=115235

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 0/50 (0%)
 Frame = +2

Query  3      ILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVS  52
              I+ +       S D+ +  + EG +TKR  + K WR R+ ++ G+ L  S
Sbjct  38837  IMSIKNDEENLSIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS  38986

>PYVX:scaffold_47 pve_scaffold_47 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_47:1:73819:1 
REF
Length=73819

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (4%)
 Frame = +1

Query  7     PEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
             P+   T S D  +   C G++ K+G    SW+ R+  + GS L+  YY+S    
Sbjct  8296  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKSETGA  8451

>PYIW:scaffold_2266 piw_scaffold_2266 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_2266:1:5486:1 
REF
Length=5486

 Score = 34.3 bits (77),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (48%), Gaps = 17/67 (25%)
 Frame = +2

Query  2     NILRVPEHGTTASGDKARPTSCE------------GYVTKRGHFRKSWRVRFLVVDGSNL  49
             +I+  P H   A G   RPT+              G+V K G   KSW+ RFLVV  + L
Sbjct  5099  SIISTPHH---ARGRPERPTAAAMAAERGGDVTYAGWVFKEGSLVKSWKKRFLVVKRTEL  5269

Query  50    QVSYYES  56
               +YY++
Sbjct  5270  --AYYKN  5284

>PYAR:scaffold_267 par_scaffold_267 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_267:1:23113:1 
REF
Length=23113

 Score = 34.3 bits (77),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (55%), Gaps = 4/42 (10%)
 Frame = +3

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
             EG +TKR  + K WR RF V+ G+ L    Y  RAA  P  G
Sbjct  2250  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEPAHG  2363

>PYVX:scaffold_35 pve_scaffold_35 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_35:1:77315:1 
REF
Length=77315

 Score = 34.3 bits (77),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 8/52 (15%)
 Frame = +3

Query  9      HGTTASGDKAR---PTS---CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
              H T  S +  R   PTS    EG + KRGHF K+W+ RF  ++   L   YY
Sbjct  56064  HDTEVSHEWKRYDDPTSYIHMEGCLMKRGHFNKNWKNRFFRIEKGELL--YY  56213

>HYAP:scaffold_322 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_322:1:27901:1 
REF
Length=27901

 Score = 34.3 bits (77),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 23/31 (74%), Gaps = 2/31 (6%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
              G++ KRGH  K+W+ RF +++G+ L  +YY+
Sbjct  26994  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  27080

>PYIR:scaffold_47 pir_scaffold_47 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_47:1:69492:1 
REF
Length=69492

 Score = 34.3 bits (77),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (58%), Gaps = 0/33 (0%)
 Frame = -2

Query  18     ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
              A    CEG++ KRG    +W+ RF  ++G  LQ
Sbjct  54407  AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  54309

>PYAR:scaffold_2807 par_scaffold_2807 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2807:1:4275:1 
REF
Length=4275

 Score = 33.9 bits (76),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 30/72 (42%), Gaps = 17/72 (24%)
 Frame = +2

Query  17    KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES---------------RAACH  61
             K  P   EGYV +RG +   W   +L +DG  L+  +YES               RA   
Sbjct  1055  KMLPILWEGYVRRRGDWLPRWEEMYLTMDGRWLR--FYESKTKYIEAQAADEKSIRAGMR  1228

Query  62    PPTGEPSAPKGS  73
              P G P  P+ S
Sbjct  1229  LPQGSPPQPQRS  1264

>PLHA:NW_020187331.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_410, whole genome shotgun sequence
Length=672108

 Score = 34.3 bits (77),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 58/155 (37%), Gaps = 46/155 (30%)
 Frame = -2

Query  20      PTS---CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPT---------GEP  67
               PTS    EG + KRGH  K+W+ RF  +    L+  Y E++  C             G  
Sbjct  208679  PTSYIHMEGRLLKRGHLNKNWKTRFFRIQQGELRY-YTENQNKCKGSVPLKDTIVSPGMA  208503

Query  68      SAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLE  127
                 P G  Y            V+ + D  F   +  H  K  ++ ++            L+
Sbjct  208502  QCPDGRKYYF----------VLTSKDSKFEMHLNAHNEKSMHLWIEA-----------LQ  208386

Query  128     VARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVAL  162
                A+ ALS             V+ NK+T+ G S+ +
Sbjct  208385  EAQTALS------------KVAGNKETVAGLSLVI  208317

>PHCA:scaffold_72 PHYCAscaffold_72
Length=230452

 Score = 34.3 bits (77),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +2

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              GY+ K+G F KSW+ RF ++      + YY S
Sbjct  70904  GYLVKQGSFWKSWKRRFFILRRDRPVLCYYTS  70999

>PHRA:scaffold_3
Length=946144

 Score = 34.3 bits (77),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = -1

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
               G+V K+G   ++W+ RF+V+ G   Q++YY++ A   P        KGSF + ++E
Sbjct  661720  GWVFKQGSLVRNWKKRFMVLRGR--QLTYYDT-AKVDPTV----KAKGSFQVITVE  661574

>APIN:scaffold_59 supercont1.59 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.59:1:326880:1 
REF
Length=326880

 Score = 34.3 bits (77),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 24/111 (22%)
 Frame = -1

Query  17      KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
               +A   S EG++ KRG   K+W+ R+  ++G  L+  Y E         G  + PKG    
Sbjct  308091  RASMRSFEGWLLKRGQRVKNWKRRYFTLNGQELK--YME---------GPGAKPKG----  307957

Query  77      SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLE  127
                    +  VVGV    + P+    +   P +    LDV  ++  ++  W++
Sbjct  307956  -----YGMVVGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQ  307831

 Score = 33.5 bits (75),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 29/52 (56%), Gaps = 2/52 (4%)
 Frame = -1

Query  8       EHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
               ++G  +S D A  T+CEG++ K+G   K+W+ R+  + G  L     +S  A
Sbjct  307596  DYGIQSSLDTA--TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVA  307447

>PYVX:scaffold_158 pve_scaffold_158 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_158:1:42935:1 
REF
Length=42935

 Score = 33.9 bits (76),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
              EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  15513  EGFLQKKGQRLKGWKRRWFVCDGRAL--SYYISR  15418

>ALCA:scaffold_464 AcNc2_CONTIG_464_length_18313 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_464_length_18313:1:18313:1 
REF
Length=18313

 Score = 33.9 bits (76),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
 Frame = -2

Query  17     KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
              K    +  GY+ KRG   KS+R R++ + G+ L  SYY+ + +        +  +GS +L
Sbjct  15519  KGTEVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREENKTYLRGSIHL  15346

Query  77     SSI  79
               S+
Sbjct  15345  ESV  15337

>PYUU:scaffold_2038 scf1117875582038 dna:supercontig supercontig:pug:scf1117875582038:1:913258:1 
REF
Length=913258

 Score = 33.9 bits (76),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 2/34 (6%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               EGY+ K+G   K W+ R+ V D   L  SYY SR
Sbjct  457794  EGYLQKKGQRLKGWKRRWFVCDARTL--SYYISR  457699

>SADI:scaffold_72 supercont1.72 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.72:1:302499:1 
REF
Length=302499

 Score = 33.9 bits (76),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 35/59 (59%), Gaps = 7/59 (12%)
 Frame = +3

Query  22      SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
               + EG++ K+G    +W+ R++V+ G    ++YY+ +   +P   E    KG+F L+++E
Sbjct  145548  AWEGWIYKQGSLMPTWKKRYMVLKGR--HIAYYD-KEVSNPRAKE----KGTFTLAAVE  145703

>PYIW:scaffold_1276 piw_scaffold_1276 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1276:1:9914:1 
REF
Length=9914

 Score = 33.9 bits (76),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 31/66 (47%), Gaps = 6/66 (9%)
 Frame = -2

Query  10    GTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSA  69
             G +  G   R    EGY+ KRGH   S R R+ V+   N  + Y+    A H  +  P+ 
Sbjct  5767  GDSQPGGGLREALMEGYLVKRGHLIPSMRKRYCVL-LKNASLEYF----ATHEDSRNPAI  5603

Query  70    -PKGSF  74
              P GSF
Sbjct  5602  RPHGSF  5585

>PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:pug:scf1117875582011:1:418791:1 
REF
Length=418791

 Score = 33.9 bits (76),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 23/36 (64%), Gaps = 2/36 (6%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
               S EGY+ K+    +SW+  + V++G  +  +YYESR
Sbjct  318848  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESR  318747

>PYUU:scaffold_2025 scf1117875582025 dna:supercontig supercontig:pug:scf1117875582025:1:692778:1 
REF
Length=692778

 Score = 33.9 bits (76),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
               GY+ K+G + K+WR R+ ++      +SYY+S
Sbjct  138731  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  138826

>SAPA:scaffold_7 supercont2.7 dna:supercontig supercontig:ASM15154v2:supercont2.7:1:943373:1 
REF
Length=943373

 Score = 33.9 bits (76),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 35/59 (59%), Gaps = 7/59 (12%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
               + EG++ K+G    +W+ R++V+ G    ++YY+ +   +P   E    KG+F L+++E
Sbjct  162385  AWEGWIYKQGSLMPTWKKRYMVLKGR--HIAYYD-KEVTNPRAKE----KGTFTLAAVE  162230

>PYIW:scaffold_735 piw_scaffold_735 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_735:1:14751:1 
REF
Length=14751

 Score = 33.9 bits (76),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              GY+ K+G F K+WR R+ ++      +SYY+S
Sbjct  12042  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  11947

>ALCA:scaffold_110 AcNc2_CONTIG_110_length_72385 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_110_length_72385:1:72385:1 
REF
Length=72385

 Score = 33.9 bits (76),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%)
 Frame = -1

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
             EGY+ K+G   K W+ R+ V DG  L  SYY
Sbjct  9766  EGYLQKKGQRLKGWKQRWFVCDGRTL--SYY  9680

>PLHA:NW_020188201.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1286, whole genome shotgun sequence
Length=27542

 Score = 33.9 bits (76),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 28/54 (52%), Gaps = 8/54 (15%)
 Frame = -2

Query  4     LRVPEHGTTASGDKARPTSCEGYVTKRGHF--------RKSWRVRFLVVDGSNL  49
             +++PE     +  +   T  +GY+ K+G          RK+W+ R+ ++ GSNL
Sbjct  8446  VQLPEQKVIEAAQEKEVTELQGYLIKQGGGGNVLNPLRRKNWKQRYFILTGSNL  8285

>PYVX:scaffold_1 pve_scaffold_1 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1:1:185872:1 
REF
Length=185872

 Score = 33.9 bits (76),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (48%), Gaps = 16/71 (23%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR---------AACHPPTGEPSAPKGSFY  75
              GY+ K+G F K+WR R+ V+      +SY+ S+         A     T EP APK  F 
Sbjct  80031  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKDDLMKLGEIAIDESTTVEP-APKDGF-  80204

Query  76     LSSIEPHEYVV  86
                   P+ ++V
Sbjct  80205  -----PNRFIV  80222

>PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:pug:scf1117875582032:1:863081:1 
REF
Length=863081

 Score = 33.9 bits (76),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 56/133 (42%), Gaps = 18/133 (14%)
 Frame = -3

Query  6      VPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
               PE     + D +   S  G++ K GH RK+W+ R+ V++ S L+  YY   +       
Sbjct  62991  TPEAPDANAFDDSFLDSMRGWLRKLGHVRKNWKSRYFVLERSVLR--YYSDDSM------  62836

Query  66     EPSAPKGSFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRN  123
                +  KG   L   +   H   + + G  D  F  + VG    K Y  L +  D L+ R 
Sbjct  62835  --TRLKGEVLLFHPATRVHYVDIHLSGGRDCTFAIQ-VG----KDYTLL-LQADQLSVRE  62680

Query  124    KWLEVARNALSVK  136
               W+    +AL  +
Sbjct  62679  NWMYCIEDALLCR  62641

>PYIR:scaffold_78 pir_scaffold_78 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_78:1:58522:1 
REF
Length=58522

 Score = 33.5 bits (75),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -2

Query  25     GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
              GY+ K+G F K+WR R+ ++      +SYY+S
Sbjct  48174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  48079

>PHIF:NW_003303737.1 Phytophthora infestans T30-4 supercont1.22 
genomic scaffold, whole genome shotgun sequence
Length=2337630

 Score = 33.5 bits (75),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 3/52 (6%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR-AACHPPTGEPSAPKGSF  74
               EGY+ KRGH   S R R+ V+ G+ L  +YY +   + +P  G  + P G+F
Sbjct  529101  EGYLMKRGHKIPSMRKRYCVLIGNEL--TYYVTHDDSKNPGGGATTNPLGNF  528952

>PHPA:scaffold_25 NW_008649011.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.25, whole genome shotgun 
sequence
Length=859936

 Score = 33.5 bits (75),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 3/52 (6%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR-AACHPPTGEPSAPKGSF  74
              EGY+ KRGH   S R R+ V+ G+ L  +YY +   + +P  G  + P G+F
Sbjct  90806  EGYLMKRGHKIPSMRKRYCVLIGNEL--TYYVTHDDSKNPGGGATTNPLGNF  90657

>APIN:scaffold_54 supercont1.54 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.54:1:414455:1 
REF
Length=414455

 Score = 33.5 bits (75),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVVDGS  47
                G++ K+GH  K+W+ RF V+DGS
Sbjct  365272  SGWLYKQGHILKNWKRRFFVLDGS  365343

>ALLA:FR824244 dna:supercontig supercontig:ENA1:FR824244:1:48268:1 
REF
Length=48268

 Score = 33.5 bits (75),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
              EGY+ K+G   K W+ R+ V DG  L  SYY
Sbjct  13532  EGYLQKKGQRLKGWKQRWFVCDGRTL--SYY  13446

>PHSO:scaffold_5
Length=6830280

 Score = 33.5 bits (75),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
 Frame = +2

Query  25       GYVTKRG-HFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPK  71
                G + KRG  +R+ W++RF+ +DG   Q++YYE   A    T   S  K
Sbjct  4809230  GSLEKRGFRWRRKWKLRFVELDGR--QLAYYEDSGAFSATTASASGVK  4809367

>SAPA:scaffold_181 supercont2.181 dna:supercontig supercontig:ASM15154v2:supercont2.181:1:64981:1 
REF
Length=64981

 Score = 33.5 bits (75),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (3%)
 Frame = -3

Query  25    GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPT  64
             G + KRGH RK+W  RF V+  ++L+  Y + R+  H  T
Sbjct  5774  GVLQKRGHLRKNWLTRFFVLTPTHLRY-YKKPRSPNHSST  5658

>ALLA:FR824107 dna:supercontig supercontig:ENA1:FR824107:1:102118:1 
REF
Length=102118

 Score = 33.5 bits (75),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
              EGY+ KRGH   S R R+ V+   N  + Y+E++
Sbjct  26529  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETK  26630

Lambda      K        H        a         alpha
   0.315    0.130    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 95056894016

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40