Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHSO:scaffold_12804766280706376633970.0
PHPA:scaffold_6325589025811576426920.0
PHCA:scaffold_8410510210733976826910.0
PHIF:NW_003303697.143590543808874526220.0
PHRA:scaffold_5614401414622776625510.0
PHKE:scaffold_98722467444175024260.0
PLHA:NW_020189861.11838333184056476922990.0
HYAP:scaffold_5919133519350376722170.0
PYIR:scaffold_8953389702057815150.0
PYUU:scaffold_20371312606131454368914911e-180
PYIW:scaffold_9635251674451314028e-169
PYAP:scaffold_162248362638652213595e-163
PYAR:scaffold_2996741150061513367e-160
PYVX:scaffold_13231208271951712252e-148
ALCA:scaffold_6224203257235128351e-93
ALLA:FR82421522204237065248342e-93
SAPA:scaffold_244298674311774585971e-62
SADI:scaffold_41718021731364625792e-60
PYVX:scaffold_6749762102801771371e-06
PHCA:scaffold_282793172802253281192e-04
PHKE:scaffold_386800884901651182e-04
PYAP:scaffold_55419660200581381173e-04
PYIR:scaffold_3274484748881391090.003
PYAR:scaffold_13927917283211411080.004
SAPA:scaffold_92488034900068750.082
SADI:scaffold_11626744627088119833.3
PYUU:scaffold_202273481773506282716.0
APIN:scaffold_118536718549242807.6
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYSO_348903

Length=766
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHSO:scaffold_1                                                       1313       0.0   
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  1041       0.0   
PHCA:scaffold_84 PHYCAscaffold_84                                     1041       0.0   
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  1014       0.0   
PHRA:scaffold_56                                                      987        0.0   
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  939        0.0   
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  890        0.0   
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  858        0.0   
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  588        0.0   
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  578        1e-180
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  544        8e-169
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  528        5e-163
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  519        7e-160
PYVX:scaffold_1323 pve_scaffold_1323 dna:supercontig supercontig:...  476        2e-148
ALCA:scaffold_62 AcNc2_CONTIG_62_length_96346 dna:supercontig sup...  326        1e-93 
ALLA:FR824215 dna:supercontig supercontig:ENA1:FR824215:1:55297:1...  325        2e-93 
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  234        1e-62 
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  227        2e-60 
PYVX:scaffold_674 pve_scaffold_674 dna:supercontig supercontig:pv...  57.4       1e-06 
PHCA:scaffold_28 PHYCAscaffold_28                                     50.4       2e-04 
PHKE:scaffold_386 scf_22126_386.1 dna:supercontig supercontig:Phy...  50.1       2e-04 
PYAP:scaffold_554 pag1_scaffold_554 dna:supercontig supercontig:p...  49.7       3e-04 
PYIR:scaffold_32 pir_scaffold_32 dna:supercontig supercontig:pir_...  46.6       0.003 
PYAR:scaffold_139 par_scaffold_139 dna:supercontig supercontig:pa...  46.2       0.004 
SAPA:scaffold_92 supercont2.92 dna:supercontig supercontig:ASM151...  33.5       0.082 
SADI:scaffold_11 supercont1.11 dna:supercontig supercontig:Sap_di...  36.6       3.3   
PYUU:scaffold_2022 scf1117875582022 dna:supercontig supercontig:p...  32.0       6.0   
APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inv...  35.4       7.6   

>PHSO:scaffold_1
Length=13391543

 Score = 1313 bits (3397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 766/766 (100%), Positives = 766/766 (100%), Gaps = 0/766 (0%)
 Frame = -1

Query  1        MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
                MVGNTMHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT
Sbjct  2807063  MVGNTMHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  2806884

Query  61       DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120
                DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ
Sbjct  2806883  DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  2806704

Query  121      FSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlrae  180
                FSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAE
Sbjct  2806703  FSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAE  2806524

Query  181      vlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssld  240
                VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSLD
Sbjct  2806523  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSLD  2806344

Query  241      plsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALST  300
                PLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALST
Sbjct  2806343  PLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALST  2806164

Query  301      PLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGE  360
                PLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGE
Sbjct  2806163  PLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGE  2805984

Query  361      GGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLAR  420
                GGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLAR
Sbjct  2805983  GGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLAR  2805804

Query  421      LNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQ  480
                LNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQ
Sbjct  2805803  LNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQ  2805624

Query  481      IIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDF  540
                IIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDF
Sbjct  2805623  IIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDF  2805444

Query  541      VKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFE  600
                VKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFE
Sbjct  2805443  VKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFE  2805264

Query  601      DKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVA  660
                DKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVA
Sbjct  2805263  DKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVA  2805084

Query  661      VRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdg  720
                VRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSGSSSGHSGSSSDG
Sbjct  2805083  VRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSGSSSGHSGSSSDG  2804904

Query  721      ttsAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRGTTY  766
                TTSAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRGTTY
Sbjct  2804903  TTSAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRGTTY  2804766

 Score = 36.6 bits (83),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 30/63 (48%), Gaps = 5/63 (8%)
 Frame = -1

Query  300      TPLTSQQINEMFPLIDFTSELAAHARGLTPG-SRTWALTRVEEWLDSRFNTGSDILLAVV  358
                T L +  + E  PL+   +  AA   G  PG SR WA      W DSR   G  + LAV+
Sbjct  8929595  TTLYNFMLFERVPLLAKVAAWAAFRYGCFPGHSRAWA----RSWSDSRLGRGLRLCLAVL  8929428

Query  359      GEG  361
                G G
Sbjct  8929427  GIG  8929419

 Score = 36.6 bits (83),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 30/63 (48%), Gaps = 5/63 (8%)
 Frame = +2

Query  300      TPLTSQQINEMFPLIDFTSELAAHARGLTPG-SRTWALTRVEEWLDSRFNTGSDILLAVV  358
                T L +  + E  PL+   +  AA   G  PG SR WA      W DSR   G  + LAV+
Sbjct  8930798  TTLYNFMLFERVPLLAKVAAWAAFRYGCFPGHSRAWA----RSWSDSRLGRGLRLCLAVL  8930965

Query  359      GEG  361
                G G
Sbjct  8930966  GIG  8930974

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 1041 bits (2692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/764 (80%), Positives = 677/764 (89%), Gaps = 24/764 (3%)
 Frame = -1

Query  1       MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
               MVG TM+RIKNKLRSSRL     + AWALDEDSLRLKQ QDD PVR+DRS TL+DTVNVT
Sbjct  258115  MVG-TMNRIKNKLRSSRLHKK--EGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVT  257945

Query  61      DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120
               DDVE+MFYGR   ST++ +SD+PQYRTTEQ+R  ++TLSALHED E  S  +N+SSSFSQ
Sbjct  257944  DDVEEMFYGR---STSNTSSDMPQYRTTEQIRANNMTLSALHEDVEA-SNVSNVSSSFSQ  257777

Query  121     FSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeeg--elerlr  178
               FS TTPSNYAASTPGNFS+                GF+ + +T G++ A  G  ELERLR
Sbjct  257776  FSTTTPSNYAASTPGNFSSTY-------------HGFNTVHSTTGTSRAVSGDFELERLR  257636

Query  179     aevlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsss  238
               +EVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGA+AQLTA QHS+PPSVSST+SSS
Sbjct  257635  SEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSS  257456

Query  239     ldplsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDAL  298
                DPLSA++RA L RQTSTKTS ATR+RLAASR N+ KTPPP ARASVRLTQLAPVAD+AL
Sbjct  257455  SDPLSAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNAL  257276

Query  299     STPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVV  358
               STPL+ QQINEMFPLIDFTSELAAHARGLTPG+RTWALTRVEEWLD+RFN G+D LLAVV
Sbjct  257275  STPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVV  257096

Query  359     GEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQL  418
               GEGGTGKSAFCGTVAQQFRGN+LAAHCCQFDRKSKS+PRNVLLSMVHQ+VDN P FKNQL
Sbjct  257095  GEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQL  256916

Query  419     ARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFF  478
               ARLNLKYVLEEADP LLA KVLVDPLNA+EEP+ A FM+VDGIDQCAAG  GRNELLEFF
Sbjct  256915  ARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFF  256736

Query  479     AQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDD  538
               AQ+IPQLP+WVGFL+SSKPSSKLAKRLPVSSVLDFSA+N AFVADV+ +V+DIARNFSDD
Sbjct  256735  AQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDD  256556

Query  539     DFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEI  598
               D  +AK +LK+KSGGNFAYLEFTKQALSHPGMAAASKEGAVPL VL++LPETLYDIYAEI
Sbjct  256555  DTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEI  256376

Query  599     FEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDL  658
               FEDKFGQGRARVWGKAKPLLQL+VGAA+GPYSP+TEEQA+EHF  TAEDLRMLRRSFVDL
Sbjct  256375  FEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDL  256196

Query  659     VAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsss  718
               VAV+HG+YRIESSALCAWLSDPARSEEQFYFSIDDALQALR+MRR  SSGSSSGHSGSSS
Sbjct  256195  VAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRRVSSSGSSSGHSGSSS  256016

Query  719     dgttsAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKR  762
               DG  +    SR   + ++K+H R+H +HEPRANPD+KPVGILKR
Sbjct  256015  DGKATHRASSRV--KTSSKTHQRAHTRHEPRANPDFKPVGILKR  255890

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 1041 bits (2691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/768 (78%), Positives = 654/768 (85%), Gaps = 27/768 (4%)
 Frame = -3

Query  1       MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
               MVG TMHR+KNKLRSSRL     + AWALDEDSLRLKQ QDDA VR+DRS TL+DTVNVT
Sbjct  107339  MVG-TMHRLKNKLRSSRLHKK--EGAWALDEDSLRLKQQQDDA-VRFDRSTTLADTVNVT  107172

Query  61      DDVEDMFYGRN-NRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFS  119
               DDVE+MFYGRN NRST   AS++PQYRTTEQ+R  +LTLSALHE+A TPSA+N  SS  S
Sbjct  107171  DDVEEMFYGRNTNRSTT--ASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSF-S  107001

Query  120     QFSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeeg--elerl  177
               QFS TTPSNYAASTPGN  N+               GFS+   T G++       ELERL
Sbjct  107000  QFSATTPSNYAASTPGNVGNNTY------------HGFSSALNTAGTSRVISEDFELERL  106857

Query  178     raevlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdss  237
               R+EVLEVKEEVKAIRREVMNELHVTRYDVLKEL LLKGA+AQLTAAQHSSP   S+  SS
Sbjct  106856  RSEVLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSS  106677

Query  238     sldplsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDA  297
               S    + + RA L RQTSTKTS ATR+RLAASR NV KTPPP ARASVRLTQLAPVAD+A
Sbjct  106676  SDPLSAEE-RAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNA  106500

Query  298     LSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAV  357
               LSTPL+SQQINEMFPLIDFTS+LAAHARGLTPGSRTWALTRVEEWLD+RFN G+D LLAV
Sbjct  106499  LSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAV  106320

Query  358     VGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQ  417
               VGEGGTGKSAF GTVAQQFRGN+LAAHCCQFDRKSKS+PRNVLLSMVHQ+VDN P FKNQ
Sbjct  106319  VGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQ  106140

Query  418     LARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEF  477
               LARLNLKYVLEEADP+LLA KVLVDPLNA+EEPV A FM+VDGIDQC+AG  GRNELL+F
Sbjct  106139  LARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQF  105960

Query  478     FAQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSD  537
               FAQ+IPQLP+W+GFL+SSKPSSKLAKRLPVSSVLDFSA+N AFVADV+ LV+DIARNFSD
Sbjct  105959  FAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSD  105780

Query  538     DDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAE  597
               DD  +AK +LK KSGGNFAYLEFTKQALSHPGM A SKEGAVPLGVL++LPETLYDIYAE
Sbjct  105779  DDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAE  105600

Query  598     IFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVD  657
               IFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQA+EHF LTAEDLRMLRRSFVD
Sbjct  105599  IFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVD  105420

Query  658     LVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgss  717
               LVAV+HGSYRIESSALCAWLSDPARSEEQFYFSIDDAL ALR+MRR+ SS   S    SS
Sbjct  105419  LVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKMRRNVSSSGHSHSGSSS  105240

Query  718     sdgttsAPTLSRTTSR--GATKSHHRSHVKHEPRANPDYKPVGILKRG  763
                   T   T SR +SR   ++KS  RSH +HEPR NP  KPVGILKRG
Sbjct  105239  DSSATHH-TSSRASSRVTASSKSQQRSHTRHEPRTNPG-KPVGILKRG  105102

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/745 (77%), Positives = 640/745 (86%), Gaps = 23/745 (3%)
 Frame = -3

Query  24      DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRNNRSTASAASDVP  83
               + AWALDEDSLRLKQ QDD PVR+DRS TL+DTVNVTDDVE+MFYGR   ST++ +SD+P
Sbjct  438088  EGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYGR---STSNTSSDMP  437918

Query  84      QYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPgnfsnhngq  143
               QYRTTEQLR  ++TLSALHED E  S  +N+SSSFSQFS TTPSNYAASTPG F++ +  
Sbjct  437917  QYRTTEQLRGNNITLSALHEDVEA-SNVSNVSSSFSQFSATTPSNYAASTPGKFTSTH--  437747

Query  144     nnntnqsttfARGFSAIPTTVGSavaeeg--elerlraevlevkeevkaIRREVMNELHV  201
                          +G +   TT G + A  G  ELERLR+EVLEVKEEVKAIRREVMNELHV
Sbjct  437746  -----------QGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHV  437600

Query  202     TRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAKLVRQTSTKTSPA  261
               TRYDVLKELALLKGA+AQLTA QH +P SVSST+SSS DPLS D+RA L RQTSTKTS A
Sbjct  437599  TRYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDERAALTRQTSTKTSQA  437420

Query  262     TRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELA  321
               TR+RLAASR N+ KTPPP ARASVRLTQLAPVAD+ALSTPL  QQINEMFPLID TSELA
Sbjct  437419  TRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELA  437240

Query  322     AHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNML  381
               AHARGLTPG+RTWALTRVEEWLD+R+N G+D LLAVVGEGGTGKS FCGTVAQQFRGN+L
Sbjct  437239  AHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLL  437060

Query  382     AAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLV  441
               AAHCCQFDRKSKS+PRNVLLSMVHQ+VD+ P FKNQLARLNLKYVLEEADP LLA KVLV
Sbjct  437059  AAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLV  436880

Query  442     DPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFllsskpsskl  501
               DPLNA+EEP+ A F++VDGIDQCA G+ GRNELLE FAQ+IPQLP+WVGFL+SSKPSSKL
Sbjct  436879  DPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKL  436700

Query  502     akrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFT  561
               AKRLPVSSVLDFSA+N AFVAD + LV+DIARNFSDDD  +AK +LK+KSGGNFAYLEFT
Sbjct  436699  AKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFT  436520

Query  562     KQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  621
               KQALSHPG+AAASKEGAVPL VL++LPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV
Sbjct  436519  KQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  436340

Query  622     VGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPA  681
               VGAA+GPYSPVTEEQA+EHFNLT EDLRMLRRSFVDLV+V+HGSYRIESSALCAWLSDPA
Sbjct  436339  VGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPA  436160

Query  682     RSEEQFYFSIDDALQALRQMRRs--gssgsssghsgsssdgttsAPTLSRTTSRGAT--K  737
               RSEEQFYFS+DDAL ALR++RR    SS S    + S      +    SR ++R  T  K
Sbjct  436159  RSEEQFYFSVDDALLALRKIRRVGSSSSSSGHSGNSSDGKAAKNGHASSRPSNRVKTSSK  435980

Query  738     SHHRSHVKHEPRANPDYKPVGILKR  762
               +H R+H ++EPR +PDYKPVGILKR
Sbjct  435979  THQRAHTRYEPRTSPDYKPVGILKR  435905

>PHRA:scaffold_56
Length=334739

 Score = 987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/766 (73%), Positives = 623/766 (81%), Gaps = 32/766 (4%)
 Frame = +2

Query  1       MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
               MVG TMHR+KNKLR  +      DA WALDEDSLRLKQ QDDA +R DRS TL+DTVNVT
Sbjct  144014  MVG-TMHRLKNKLRLHKK-----DANWALDEDSLRLKQTQDDA-LRLDRSTTLTDTVNVT  144172

Query  61      DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120
               DDVE+MFYG   RST S   DVPQYRTTEQLR TH+TLSALHEDAE  +A+++ S     
Sbjct  144173  DDVEEMFYG--GRSTVS---DVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQF---  144328

Query  121     FSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlrae  180
                S TTPSNYAASTPG+  N                 FS   +T  +              
Sbjct  144329  -SATTPSNYAASTPGHVPNQGAY-----------HDFSTAHSTTRAISDAFELERLRSEV  144472

Query  181     vlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssld  240
               V   +E    IRREVMNELHVTRYDVLKELALLKGA+AQL A QH SP +  S+  SS  
Sbjct  144473  VEVKEEVKA-IRREVMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSS  144649

Query  241     p-lsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALS  299
                 LSAD+RA L RQTSTKTS ATRERLAASRAN+ KTPPP ARASVRLTQLAPVAD+ALS
Sbjct  144650  DPLSADERAALTRQTSTKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALS  144829

Query  300     TPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVG  359
               TPLT QQIN+MFPLIDFTSELAAHAR LTPGSRTWALTRVEEWLD+RFN G D LLAVVG
Sbjct  144830  TPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVG  145009

Query  360     EGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLA  419
               EGGTGKSAF GTVAQQFRGN+LAAHCCQFDRKSKS+PRNVLLSMVHQ+VD+ PPFKNQLA
Sbjct  145010  EGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLA  145189

Query  420     RLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFA  479
               RLNLKYVLEEADP +LA KVLVDPLNA+EEP+ A FM+VDGIDQC+AG +GRNELLEFFA
Sbjct  145190  RLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFA  145369

Query  480     QIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDD  539
               Q+IP LP+WVGF++SSKPSSKLAKRLPVSSVLDFSA+N AFV+DV+ LVED+ARNFSD+D
Sbjct  145370  QVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDND  145549

Query  540     FVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIF  599
                 +AK +LKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPL VL++LPETLYDIYAEIF
Sbjct  145550  AAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIF  145729

Query  600     EDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLV  659
               EDKFGQGRARVWGKAKPLLQL+VGAA+GPYS VTEEQA++HFNLTAEDLRMLR SFVDLV
Sbjct  145730  EDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLV  145909

Query  660     AVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssd  719
               AVRHG+YRIESSALC WLSDPARSEEQFYF+IDDA+QALR MRRS SS S S    S   
Sbjct  145910  AVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAIQALRSMRRSVSSSSHSNSGSSDDS  146089

Query  720     --gttsAPTLSRTTSRGAT-KSHHRSHVKHEPRANPDYKPVGILKR  762
                  +    T SR +SR  T KS+ R+H +H+PRA  ++KPVGILKR
Sbjct  146090  PPTSRRGHTSSRASSRVTTSKSNQRAHTRHDPRATQEFKPVGILKR  146227

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/750 (70%), Positives = 612/750 (82%), Gaps = 28/750 (4%)
 Frame = -3

Query  24     DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRNN-RSTASAASDV  82
              + AWALDEDSLRL + Q DA  R+DR+  ++DTVNV+DDVEDMFYGR+  +S  S  SDV
Sbjct  74441  EGAWALDEDSLRLNKQQQDAD-RFDRNTAMTDTVNVSDDVEDMFYGRSTTQSQLSNTSDV  74265

Query  83     PQYRTTEQLRDTHLTLSALHED-AETPSATNNLSSSFSQFSVTTPSNYAASTPgnfsnhn  141
              P YRTTEQ+R T+ TL+ALHE+ A TPSA++ LS+SF+    +TP NY  + P     + 
Sbjct  74264  PSYRTTEQMRGTNSTLTALHEEEAMTPSASH-LSNSFASSYASTPGNYQ-NPPTFNGFNT  74091

Query  142    gqnnntnqsttfARGFSAIPTTVGSavaeegelerlraevlevkeevkaIRREVMNELHV  201
                +             + +  T+        E+ RLRAE+ EVK EV+ IRREVMNELH+
Sbjct  74090  THS-------------TGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVMNELHM  73950

Query  202    TRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAKLVRQTSTKTSPA  261
              TRYDVLKEL LLKGAVAQL+AAQ  +  SVS + SSS DPLSA+DRA L R  S  TS  
Sbjct  73949  TRYDVLKELTLLKGAVAQLSAAQ--TTGSVSPSTSSSSDPLSAEDRAALTRVPSKLTSKT  73776

Query  262    TRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELA  321
              T++RLA SR N+   PPP ARASVRLTQLAPVAD+ALSTPL  QQINEMFPLIDFTSELA
Sbjct  73775  TKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELA  73596

Query  322    AHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNML  381
              AHARGL PG+RTWALTRVEEWLD+RFN G+D +LAVVG+GGTGKSAFCGTVAQQFRGN+L
Sbjct  73595  AHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLL  73416

Query  382    AAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLV  441
              AAHCCQFDRKSKSTPRNVLLS VHQ+VDN PPFKNQLARLNLKYVLEE+DP LLAAKV V
Sbjct  73415  AAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFV  73236

Query  442    DPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFllsskpsskl  501
              DPLNA+EEP+ A FM+V+G+DQC+AG  GRNELLEF +QIIPQLP+WVGF++SSKP SK 
Sbjct  73235  DPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKF  73056

Query  502    akrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFT  561
              AKRLPVSSVLDFSA+N AFV+DV+ LV+DIARNFSD+D  +AK +LK+KSGGNFAYLEFT
Sbjct  73055  AKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFT  72876

Query  562    KQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  621
              KQALSHPGMA ASKEGAVPL VL+DLP++L+DIY EIFEDKFGQGRAR+W KAKPLLQL+
Sbjct  72875  KQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLI  72696

Query  622    VGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPA  681
              VGAA+GPYSPVTE QA+EHF  T EDLRMLRRSFVDLV V+HG+YR+ESSALC+WLSDPA
Sbjct  72695  VGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPA  72516

Query  682    RSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdg------ttsAPTLSR-TTSRG  734
              RSEEQFY S+DDAL ALR++RRS SSGS+S HS S S        +T++ T SR T+SR 
Sbjct  72515  RSEEQFYLSVDDALTALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTPSRATSSRA  72336

Query  735    A-TKSHHRSHVKHEPRANPDYKPVGILKRG  763
              A +KSH R+H +HEPR NP++KP+GILKRG
Sbjct  72335  ASSKSHQRAHTRHEPRVNPEFKPMGILKRG  72246

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/769 (68%), Positives = 599/769 (78%), Gaps = 31/769 (4%)
 Frame = +2

Query  1        MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
                MVG TMH++KNKLR S L     ++A+ L++DSLR K  QD+  VR DRS TL+DTVN+T
Sbjct  1838333  MVG-TMHKLKNKLRGSLLLKK--ESAYELNDDSLRRKHTQDET-VRVDRSATLTDTVNMT  1838500

Query  61       DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120
                DDVE+MFY   NRSTA+  S +PQYRTTEQ+R  +L L ALHED ET S  ++ SSSFSQ
Sbjct  1838501  DDVEEMFY---NRSTAT--SGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQ  1838665

Query  121      FSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlrae  180
                FS TTPS+YAASTPGN +  +   +    +T      S +P   G    E    E L+ +
Sbjct  1838666  FSATTPSSYAASTPGNHAGIHHDFSTMYNTT------STLPAISGDFDLERLHSEVLKIK  1838827

Query  181      vlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQL-TAAQHssppsvsstdsssl  239
                          IRREVMNELHVTRYDVLKEL LLKGA+AQL +    +S  SVSSTDSSS 
Sbjct  1838828  SEVKT-----IRREVMNELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSS  1838992

Query  240      dplsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALS  299
                DPLS+D+RA L RQT TKTS ATR+RLAA R N  K PP   RAS RLTQLAPVADDALS
Sbjct  1838993  DPLSSDERAALTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALS  1839172

Query  300      TPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVG  359
                TPL SQQINE FPLIDFTSELAAHAR LTPGSR+WALTR++EWLD+RF+ G+D LLAVVG
Sbjct  1839173  TPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVG  1839352

Query  360      EGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLA  419
                EGG+GKSAFCGTVAQQFRGN+LAAHCCQFDRKSKS PRNVLLSMVHQ+VDN P FKNQLA
Sbjct  1839353  EGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLA  1839532

Query  420      RLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFA  479
                RLNL+YVLEE DP LLA KVL+DPLNALEEP  + F+++DGIDQCA G+ GRNELLEF +
Sbjct  1839533  RLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFIS  1839712

Query  480      QIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDD  539
                QII  LP+WVGFL+SSKPSSKLAK LPVSSVLDFSA+N AFVAD + LVEDI++ FSDDD
Sbjct  1839713  QIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDD  1839892

Query  540      FVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIF  599
                 V+AK ML +KSGGNFAYLEFTKQALSHPGMA  S  G VPL VL +LPETLYDIYAEIF
Sbjct  1839893  AVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIF  1840072

Query  600      EDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLV  659
                EDKFGQG AR WGKAKPLLQL+VGAA+GPYS VTEEQA++  +L A+DLRMLRRSFVD+V
Sbjct  1840073  EDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIV  1840252

Query  660      AVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssd  719
                AV+HG+YRIESSALCAWLSDP RSEEQFYFSI+DAL ALR+MR   +S S S        
Sbjct  1840253  AVKHGAYRIESSALCAWLSDPVRSEEQFYFSIEDALLALRKMR--LNSSSDSSSGDPGIS  1840426

Query  720      gttsAPT----LSRTTSRGATKSHHRSHVKHEPRAN-PDYKPVGILKRG  763
                   +AP     LSR  SRG   +  +   +HEPR N  +YKPVGILKRG
Sbjct  1840427  SDKNAPDHNRRLSRANSRGKLPNKSQ---RHEPRTNFENYKPVGILKRG  1840564

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/767 (64%), Positives = 573/767 (75%), Gaps = 48/767 (6%)
 Frame = -1

Query  1       MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
               MVG TMHR+KNKLR  +      D  W LDEDS+RLKQ QD   VR DRSGTL+DTVN T
Sbjct  193503  MVG-TMHRLKNKLRLHKK-----DGTWDLDEDSMRLKQNQDHV-VRLDRSGTLTDTVNET  193345

Query  61      DDVEDMFYGRNN-RSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFS  119
               DDVE+MFY     RST       PQYR+TEQL    LTL++L+EDAETPS  +N SSSFS
Sbjct  193344  DDVEEMFYSSTQTRSTNGP----PQYRSTEQLPGRLLTLTSLNEDAETPSGGSNASSSFS  193177

Query  120     QFSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlra  179
               QFS     ++A S        +    +T+   T +    + P  VG A +E  +L     
Sbjct  193176  QFS-----DHATSI------SSVNLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELI  193030

Query  180     evlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAA-QHssppsvsstdsss  238
               EV +       IR+ V+NELHVTRYDVLKELALLKGA+AQLT      +     S   S 
Sbjct  193029  EVKQEVAA---IRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSV  192859

Query  239     ldplsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDAL  298
                +PLS+ DR  L RQTST TS ATR+RLAASR N  K PPP ARASVRLTQLAPVAD AL
Sbjct  192858  SNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSAL  192679

Query  299     STPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVV  358
               STPL+S Q+N++FPLIDFT+ELAAHAR LTPGSRTWALTR EEWL+SRF  G D LLAVV
Sbjct  192678  STPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVV  192499

Query  359     GEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQL  418
               GEGG+GKSAFCGTVAQQ+RG ++AAHCCQFDRK KS+PRNVLLS+VHQ+V N P FKNQL
Sbjct  192498  GEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQL  192319

Query  419     ARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFF  478
               ARLNLKYVLEEADP+LLA+KVLVDPLNALE+PV  AFM+VDGIDQC  G  GRNELLEF 
Sbjct  192318  ARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFL  192139

Query  479     AQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDD  538
               AQ+IPQLP+W+G ++SSKPSSKLAKRLPVSSVLDFSA+N+AFVADV+ LV++IA +F  +
Sbjct  192138  AQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHE  191959

Query  539     DFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEI  598
               D  +AK +LK KSGGNFAYLEFTKQALS  GMA+ SKEG V + VL +LPETLYDIYAEI
Sbjct  191958  DVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEI  191785

Query  599     FEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDL  658
               FEDKFG GRARVW KA+ +LQL +GA +GPYSPVTEEQA+EHF LT EDLR+LRRSFVDL
Sbjct  191784  FEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDL  191605

Query  659     VAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsss  718
               VAV+HG YRIE+SALCAWL DPAR+EEQFYF+IDDALQALR+MRR+ +S SS        
Sbjct  191604  VAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMRRASASASS--------  191449

Query  719     dgttsAPTLSRTTSRGATKSH--HRSHVKHEPRANPDYKPVGILKRG  763
                         + TS G++      RS    + +   D +PV ILKRG
Sbjct  191448  ---------GQLTSSGSSNGSAPGRSQSPQKVQTESDCQPVSILKRG  191335

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/578 (53%), Positives = 403/578 (70%), Gaps = 23/578 (4%)
 Frame = +1

Query  191    IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAK-  249
              IRRE+MNE+HVTRYDVLKE+ +LKG + QL  A  S          +++   +  + +  
Sbjct  95338  IRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSD  95517

Query  250    ----LVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQ  305
                  + R T+  TS AT+ER    RA  + + P   RAS RLTQLAPVADDALSTPL   
Sbjct  95518  ELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAPVADDALSTPLLQH  95685

Query  306    QINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGK  365
              QI+EMFPL++ ++EL A A+   P SR WA+ R +EW+DSRFN G D LLA+VG+GG+GK
Sbjct  95686  QIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGK  95865

Query  366    SAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKY  425
              S   G +  +F  N++A H C FDRKSKS+PRNVLLS+V+Q++ N P FKNQLARLNLKY
Sbjct  95866  STLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKY  96045

Query  426    VLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQL  485
              VLEE DP++LA KVLVDPL ALEEP+ A   + DGIDQC   ++GRN+LL+F A IIP+L
Sbjct  96046  VLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK--SKGRNDLLDFLAVIIPEL  96219

Query  486    PTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKS  545
              PTWVG  ++SKPS +L  +L ++S+LDFSA+N  ++ D   L+ DI  NFSD D  +A+ 
Sbjct  96220  PTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQARE  96399

Query  546    MLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQ  605
              +LK+KSGGNF +L+FTKQALSHPGM      G +PL VL+DLPE++Y+IY EIFEDKFG+
Sbjct  96400  ILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGK  96573

Query  606    GRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGS  665
              GR+R+W K +PLL+L+V AASGPY+ +TE QA+E F+L+ ED+R +RR+FVD++AV HG+
Sbjct  96574  GRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGT  96753

Query  666    YRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdgttsAP  725
              YRIE+SAL  WL DP R+ EQFY  +   +  LRQ+    SS + S  S           
Sbjct  96754  YRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQDSSDTHSAASSE---------  96906

Query  726    TLSRTTSRGATKSHHRSHVKHEPRA-NPDYKPVGILKR  762
                S   S  +T S H S+V   P A   ++KPVGILK+
Sbjct  96907  ASSNNVSNVSTASSHLSYVVPPPAAPKVNFKPVGILKK  97020

 Score = 36.2 bits (82),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 44/126 (35%)
 Frame = +1

Query  28     ALDEDSLRLKQAQDDAPVRYDRSGTLSDTVN------VTDDVEDMFY-------------  68
              A DE++LR+ +   +   R+ R+ T++ +        ++DDVE+MFY             
Sbjct  94870  ATDEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSAS  95049

Query  69     -----------------------GRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDA  105
                                     G  +R+T  +      YRTTEQ+R T+L    L ED 
Sbjct  95050  ARSTDNFGRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTNLM--PLQEDE  95223

Query  106    ETPSAT  111
                P+A+
Sbjct  95224  VLPAAS  95241

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 578 bits (1491),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 325/689 (47%), Positives = 440/689 (64%), Gaps = 58/689 (8%)
 Frame = -2

Query  30       DEDSLRLKQAQDDAPVRYDRSGTLSDTVN------VTDDVEDMFYGRNNRSTASAASDVP  83
                DED+LR+ +   +   RY R+ T++ +        ++DDVEDMFY      T S  SD  
Sbjct  1314543  DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRST-SDYT  1314367

Query  84       QYRTTEQLRD-------THLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPgn  136
                  RTT  +RD       T L ++ ++   E    TN +           P N     P  
Sbjct  1314366  TGRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNLM-----------PLNEDEVLP--  1314226

Query  137      fsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlraevlevkeevkaIRREVM  196
                                     +A+ TT G+A   E +  R     ++ + +   IRRE+M
Sbjct  1314225  ---------------------AAMRTTTGAAGGSEADALRAELVEMKQEMQT--IRREMM  1314115

Query  197      NELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsst--dsssldplsaddRAKLVRQT  254
                NE+HVTRYDVLKE+ +LKG + QL AA  S           +     LS      + R T
Sbjct  1314114  NEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTT  1313935

Query  255      STKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLI  314
                +  TS AT++RLAA    V   P      + RLTQLAPVADDALSTPL   QI++MFPL+
Sbjct  1313934  AVHTSKATKDRLAAR--EVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLV  1313761

Query  315      DFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQ  374
                DF+++L  HA+   P SR WA  R ++W+DSRFN G D LLA+VG+GG+GKS   G +  
Sbjct  1313760  DFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCD  1313581

Query  375      QFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPML  434
                +F  N++A H C+FDRKSKS+PRNVLLS+V+Q++ N P FKNQLARLNLKYVLEE DP++
Sbjct  1313580  RFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLV  1313401

Query  435      LAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFlls  494
                LA KVLVDPL ALEEP+ A  ++VDGIDQC   ++ RN+LL+F A IIP+ PTW+G  ++
Sbjct  1313400  LARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTWLGIFIT  1313227

Query  495      skpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGN  554
                SKPS +L  +L ++S+LDFS +N  ++ D   L+ DI  NFSD D  +A+ +LK+KSGGN
Sbjct  1313226  SKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGN  1313047

Query  555      FAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKA  614
                F +L+FTKQALSHPGM    + G VPL VL+DLPE++Y+IY EIFEDKFG+G  R+W K 
Sbjct  1313046  FTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKV  1312873

Query  615      KPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALC  674
                +PLL L+V AASGPY+ +TEEQA+E F+L+ +D+RM+RR+F D++ VRHG+YR+E+SA+ 
Sbjct  1312872  QPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMY  1312693

Query  675      AWLSDPARSEEQFYFSIDDALQALRQMRR  703
                 WL DP RS EQFY +I  ++  LR++ R
Sbjct  1312692  EWLVDPQRSGEQFYVNISASMDILRRLHR  1312606

 Score = 40.8 bits (94),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 97/233 (42%), Gaps = 25/233 (11%)
 Frame = -2

Query  250     LVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQ----  305
               +VRQ     S    + L  S   +   P   A +S+   + + +  D L T L  Q    
Sbjct  170058  MVRQCEIPLSICRIQWLDMSDCLLYDDPSSIAASSINEVRYS-MRKDQLITALQGQLDHE  169882

Query  306     ----QINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEG  361
                   +++ +   + F  +++  A       R W + ++ +W+DS   T S  +  V G+ 
Sbjct  169881  GQQARLHSILAPVPFQQQISKLASRFV--GRKWLIAQLTKWIDS--PTASQ-MFWVTGQI  169717

Query  362     GTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARL  421
               G+GK+A    + Q     + A H    + +     R  +LS+ +Q+       K+  A L
Sbjct  169716  GSGKTALAARLVQTI-PEIKAFHFAFEEDEQTQNARRCVLSLAYQLTTQ---LKDYAAFL  169549

Query  422     NLKYVLEEADPML----LAAKVLVDPLN---ALEEPVQAAFMMVDGIDQCAAG  467
                 +  LEE  P+     L   +L+ PLN    L+       +++DG++  + G
Sbjct  169548  QAREPLEELVPVSTFNELVTHLLIKPLNEIAQLQSQNTPLVLLIDGLENLSDG  169390

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 544 bits (1402),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 279/513 (54%), Positives = 367/513 (72%), Gaps = 15/513 (3%)
 Frame = +1

Query  250   LVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINE  309
             + R T+  TS AT++R A      + + P   RAS RLTQLAPVAD+ALSTPL   QI+E
Sbjct  5251  ISRTTALFTSKATKDRRATRD---ESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDE  5421

Query  310   MFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFC  369
             MFPLI+ + EL A +R     SR WA+ R +EW+DSRFN G D LLA+VGEGG+GKS   
Sbjct  5422  MFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLA  5601

Query  370   GTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEE  429
             G ++ +F  N++A H C FDRKSKS+PRNVLLS+V+Q++ N P FKNQLARLNLKYVLEE
Sbjct  5602  GALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEE  5781

Query  430   ADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWV  489
             +DP++LA K+LVDPL ALEEP+ A   M+DG+DQC   ++GRN+LL+F A IIP+LPTW+
Sbjct  5782  SDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK--SRGRNDLLDFLAVIIPELPTWI  5955

Query  490   GFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQ  549
             G  ++SKPS +L  RL +SS+LDFSA+N  ++ D   ++ DI  +FSD D  +A+ +LK+
Sbjct  5956  GVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKR  6135

Query  550   KSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRAR  609
             KSGGNF +L+FTKQALSHPGM      G +PL VL+DLPE++Y+IY EIFEDKFG+GR R
Sbjct  6136  KSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRNR  6309

Query  610   VWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIE  669
             +W K +PLL+L+V AASGPY+ +TE QA+E F L+ ED+R +RRSFVD++ VRHG+YRIE
Sbjct  6310  IWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIE  6489

Query  670   SSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdgttsAPTLSR  729
             +SAL  WL DP R+ EQFY  +   + ALRQ+            S  +    +S  + S 
Sbjct  6490  NSALFEWLVDPQRAGEQFYVDVSGGMSALRQLHH--------QDSSETHSVGSSDGSSSN  6645

Query  730   TTSRGATKSHHRSHVKHEPRANPDYKPVGILKR  762
              TS  +T S H S+V   P    ++KPVGILK+
Sbjct  6646  ATSNVSTASSHLSYVVPPPVPKVNFKPVGILKK  6744

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 95/233 (41%), Gaps = 74/233 (32%)
 Frame = +1

Query  26    AWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT------DDVEDMFY-----------  68
             A A DEDSLR+ +   +   R+ R+ T++ +   +      DDVEDMFY           
Sbjct  4414  ATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSS  4593

Query  69    -------GRN-----------NRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSA  110
                    GR+           +R+T  +      YRTTEQLR T   L  L ED   P+A
Sbjct  4594  VRSTDTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRGT-ANLIPLQEDEVLPAA  4770

Query  111   TNNLSSSFSQFSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavae  170
             +   ++S     + T  NY+                    +       A+ T +     E
Sbjct  4771  SRTTTTS----QMPTNGNYSNGN-----------------SGGGSQLDALRTELSEMKLE  4887

Query  171   egelerlraevlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAA  223
                                 IRRE+MNE+HVTRYDVLKE+ +LKG + QL  A
Sbjct  4888  VQA-----------------IRREMMNEMHVTRYDVLKEVTMLKGTILQLVTA  4995

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 528 bits (1359),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 265/522 (51%), Positives = 369/522 (71%), Gaps = 14/522 (3%)
 Frame = -3

Query  191    IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAK-  249
              I+RE+MNE+H+TRYDVLKE+ +LKG + QL +    S      T +++   +    +A  
Sbjct  26386  IKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAAMGIDVPPQANE  26207

Query  250    --------LVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTP  301
                      L R+T+T  S  T+ER+  +R +  + PP     S RLTQLAPV D ALSTP
Sbjct  26206  LSPEEKEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRLTQLAPVDDSALSTP  26033

Query  302    LTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEG  361
              L  +QI++MFPLIDF++E+   +R    GSR W   RV+EWLDSRFN G+D++LA+VG+ 
Sbjct  26032  LHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  25853

Query  362    GTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARL  421
              G+GK+    +V  ++   ++A H C+FDRK+KS+PRNVLLS+V+Q+  + P FK+QLARL
Sbjct  25852  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARL  25673

Query  422    NLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQI  481
              NLKYVLEE D   L+ KVL+DPLNALEEP+   F++ D IDQC  G  G N+L +F + I
Sbjct  25672  NLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSAI  25496

Query  482    IPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFV  541
              IP+ P W+GFL+SSKPS + A  +PVSSVLDFSA+N  ++ D   L+ DIA  F D+D  
Sbjct  25495  IPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQA  25316

Query  542    KAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFED  601
              +AK +LK KSGGN++YLEFTKQALS+PGM  AS  G VP+ VL+DLP++LY+IY EIFED
Sbjct  25315  EAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDLPQSLYEIYEEIFED  25142

Query  602    KFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAV  661
              KFG+GR RVW KA P+LQL+  AASGPY+ +TE+   +  + T +++RMLRR+F+D++++
Sbjct  25141  KFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISI  24962

Query  662    RHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRR  703
              RHG+Y I SSA+  WL+D  R  EQ++  ++  ++ LR++ R
Sbjct  24961  RHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLR  24836

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 519 bits (1336),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 284/615 (46%), Positives = 400/615 (65%), Gaps = 46/615 (7%)
 Frame = +2

Query  191    IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAK-  249
              IRRE+MNE+H +RYDVLKE+ +LKG + QL +    S                       
Sbjct  9674   IRREMMNEMHTSRYDVLKEVTMLKGTITQLVSILQQSGXXXXXXXXXXXXXXXXXXXXXX  9853

Query  250    ------------LVRQTSTKTSPATRERLAASRANVQKTPPPFARA-SVRLTQLAPVADD  296
                          + R+T+T  S +T+ER+  +R ++    PP  RA SVRLTQLAPV D 
Sbjct  9854   XXPELSPDQIETMARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDS  10024

Query  297    ALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLA  356
              ALSTPLT +QI+E+FPL+DF++E+   AR    G+R WA  RV+EWLDSRFN GSD+LLA
Sbjct  10025  ALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLA  10204

Query  357    VVGEGGTGKSA----------FCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQ  406
              +VG+ GTGK+               ++ +F  +++A H C+F+RK KS+PRNVLLS+V+Q
Sbjct  10205  MVGDAGTGKTVAXXXXXXXXXXXXAISDRFHEHVVAQHFCKFERKGKSSPRNVLLSVVNQ  10384

Query  407    IVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAA  466
              +    P FK+QLARLNLKYVLEE D + LA KVLVDPL +LEEP+ A F+++DG+DQC  
Sbjct  10385  LTATLPTFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV  10564

Query  467    GAQGRNELLEFFAQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAP  526
               A G N+LL+F + ++P+ P+W+GFL+++KPS + A+++PV+S+LDFSA+N A+V D A 
Sbjct  10565  -ANGYNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAV  10741

Query  527    LVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLND  586
              L+ DI   F  +D   A  +LK KS GN++YLEFT+QA+S+PGM A   +G+VP+ VL+D
Sbjct  10742  LLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHD  10915

Query  587    LPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAE  646
              LP++LY+IY EIFEDKFG+GR R+W KA P+LQL+  AASGPY+ +TE+   +  +   +
Sbjct  10916  LPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKD  11095

Query  647    DLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgs  706
              D+RMLRR+F+D++++RHG+Y I SSAL  WL+DP R  E ++  +   ++ LR++ R   
Sbjct  11096  DVRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEK  11275

Query  707    ------------sgsssghsgsssdgttsAPTLSRTTSRGATKSHHRSHV----KHEPRA  750
                          S  ++  S S +   +S+ T S   S G  K+   S      +HEP  
Sbjct  11276  LQLPGTAHGTPASERATTTSRSPASPESSSSTASSDRSSGGGKTRVTSMTTPPKRHEPNM  11455

Query  751    NPDYKPVGILKRGTT  765
               P  KPVGILKR TT
Sbjct  11456  APREKPVGILKRTTT  11500

>PYVX:scaffold_1323 pve_scaffold_1323 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1323:1:4715:1 
REF
Length=4715

 Score = 476 bits (1225),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 263/517 (51%), Positives = 347/517 (67%), Gaps = 42/517 (8%)
 Frame = -2

Query  276   TPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWA  335
             TP P ARAS RLTQLAPV D ALS PL  +Q++E+FPL+D ++++AA AR   PG+R WA
Sbjct  2719  TPTPAARASARLTQLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWA  2540

Query  336   LTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKST  395
               RV+EWLDSRFN G D LL VVG  GTGKS FCG+V    +GN+LA H C+FDRK+KST
Sbjct  2539  TARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKST  2360

Query  396   PRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAF  455
             PR VLLS+V Q+V N PPFK QLARLNLKYVLEE D  +LA KVL+DPL A EEP+ A  
Sbjct  2359  PRVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKC  2180

Query  456   MMVDGIDQCAAGAQG--RNELLEFFAQIIPQLPTWVGFllsskpssklakrlPVSSVLDF  513
             +++DG+DQC    +G  RNELLEF A ++PQLP+W+G L+SSKP+ +LA +L  +S+LDF
Sbjct  2179  LVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDF  2000

Query  514   SAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAA  573
             S +N  FV D   LV+DIA NF+D    +A+ +L+ K+GGNFAYL+FT+QALS PG+   
Sbjct  1999  SGKNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGL---  1829

Query  574   SKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVW--GKAKPLLQLVVGAASGPYSP  631
               +G + L +L+DLPE+LY+IY EIFEDKFG+GR R+W                 GPYS 
Sbjct  1828  -DDGELELDMLHDLPESLYEIYLEIFEDKFGRGRNRLWXXXXXXXXXXXXXXXXXGPYSL  1652

Query  632   VTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSI  691
             V E+ ARE    +++D+R+++RSFVD++AVR G YRIESSAL  WLSDPARS E F+F  
Sbjct  1651  VREDAARELLGYSSDDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDA  1472

Query  692   DDALQALRQMRRsgssgsssghsgsssd-------------------------gttsAPT  726
             D  +  LR++++  ++ +      + +                            + +P 
Sbjct  1471  DAGVDELRRLQQHVAAKAKQQSDEADAQGHERRRMSRRESARSTASNSSSSTSSRSHSPP  1292

Query  727   LSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRG  763
              +RT+SR ++        ++EP ANP  KPVGILKRG
Sbjct  1291  PARTSSRVSS--------RYEPPANPS-KPVGILKRG  1208

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 91/204 (45%), Gaps = 65/204 (32%)
 Frame = -3

Query  30    DEDSLRL-KQAQDDAPVRYDRSGTLSDTVNVTDD-VEDMFYGRN----------------  71
             D++SLRL +Q  +DA +R+ R  TLS   +   D VE+MFYG                  
Sbjct  3420  DDESLRLSRQVAEDA-LRFQRHTTLSSASSAMSDDVEEMFYGGGPGGHAGHGGHAGHGGA  3244

Query  72    NRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAA  131
             +RSTA +      YRTTEQLR T   L  L ED   P A                     
Sbjct  3243  DRSTAGSVRTTDVYRTTEQLRST--GLEPLAEDRVLPPAVP-------------------  3127

Query  132   STPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlraevlevkeevkaI  191
                                      + ++P T G      G L  LRAE+ +V+ E +AI
Sbjct  3126  -------------------------YGSVPHTSGPHADGPGGLAALRAELADVRAETQAI  3022

Query  192   RREVMNELHVTRYDVLKELALLKG  215
             RREVMNELHV RYDVLKE+ +LKG
Sbjct  3021  RREVMNELHVLRYDVLKEVTVLKG  2950

>ALCA:scaffold_62 AcNc2_CONTIG_62_length_96346 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_62_length_96346:1:96346:1 
REF
Length=96346

 Score = 326 bits (835),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 187/512 (37%), Positives = 293/512 (57%), Gaps = 8/512 (2%)
 Frame = -1

Query  191    IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAKL  250
              +R+E++  +  TRYD+LKE+  LKG VA ++    S   +  +  + +    SA      
Sbjct  25723  VRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANGSACSEGAD  25544

Query  251    VRQTSTKTSPATRERLAASRANVQK--TPPPFARASVRLTQLAPVADDALSTPLTSQQIN  308
                +  +      R  + +  +++ +  +     R S  L  L  + +  LS PL+  +I+
Sbjct  25543  DNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRES-GLPTLMTMDEANLSKPLSKDEID  25367

Query  309    EMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAF  368
              EMFPLID + ++ ++A  L  G+R WAL  + +W+ S F  G++ +L +VGEGG GKS  
Sbjct  25366  EMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTL  25187

Query  369    CGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLE  428
               G V Q+F  N+ A H  QFDRK  S+ R+V+LS+V Q       +K QL RLNL+Y+L 
Sbjct  25186  AGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYILA  25007

Query  429    EADPMLLAAKVLVDPLNAL-EEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPT  487
              E++P+++A K+L+DPL A+ E      F++ DGIDQC    Q  N+LLE  + I  + P+
Sbjct  25006  ESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQS-NDLLELLSHITERFPS  24830

Query  488    WVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSML  547
              W+GF+++SK     A RL  +SV+     N  F+ D   L+E++   F      +A  +L
Sbjct  24829  WIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDIL  24650

Query  548    KQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGR  607
               +KSGGN  YL+F  +ALSHP +    ++  + L VL++LPE++ +I   IF+DKFGQG 
Sbjct  24649  MRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELPESVDEIIFTIFDDKFGQGH  24476

Query  608    ARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYR  667
               RVW  AKP+L+++V AA+GPY  V E Q ++ F L   + RM+ R+F D++      YR
Sbjct  24475  QRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGYR  24296

Query  668    IESSALCAWLSDPARSEEQFYFSIDDALQALR  699
              I +S+L  WL    RS + F+ +     + LR
Sbjct  24295  IINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  24203

>ALLA:FR824215 dna:supercontig supercontig:ENA1:FR824215:1:55297:1 
REF
Length=55297

 Score = 325 bits (834),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 188/524 (36%), Positives = 301/524 (57%), Gaps = 45/524 (9%)
 Frame = -2

Query  191    IRREVMNELHVTRYDVLKELALLKGAVAQL---------------TAAQHssppsvsstd  235
              +R+E++  +  TRYD++KE+  L+G V  +               T   H++    + ++
Sbjct  23706  VRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTAFSE  23527

Query  236    sssldplsad----dRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLA  291
              S+  D + +     +R+ +V   S K+   T ERL    ++   +               
Sbjct  23526  SAEDDEIISRFITPERSTIVADCSYKSGFVT-ERLNTKDSSFSTS--------------V  23392

Query  292    PVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGS  351
              P+ +  LS PL   + +EMFP ID  S+L ++A  L  G+R WAL RV+EW++S F + +
Sbjct  23391  PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSEN  23212

Query  352    DILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNY  411
              D +L ++GEGG+GKS   G + Q+F   + A H CQFDRKS+S+ R+V+LS+V Q     
Sbjct  23211  DHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASKN  23032

Query  412    PPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAA---FMMVDGIDQCAAGA  468
              P +K QL  LNL+Y+L+E++P+++A K+L++PL A+  PV  +   F++ DGIDQC    
Sbjct  23031  PLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLVEN  22858

Query  469    QGRNELLEFFAQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLV  528
              +  N+LL+  + I  + P+ +GF+++SK S     +    S++     N  F+ D   L+
Sbjct  22857  ES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILM  22681

Query  529    EDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLP  588
              E+   NF      +A  +L +KSGGN  YL+FT++ALSHP +    +   + L VL++LP
Sbjct  22680  ENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ERTFLSLDVLDELP  22507

Query  589    ETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDL  648
              +++ DI+  IFEDKFGQG  RVW   KP+L+ +V AA+G +  V E Q ++ F L  E+ 
Sbjct  22506  DSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEW  22327

Query  649    RMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSID  692
              RM++RSF D++      YRI +S+L AWL    RS+   +F ID
Sbjct  22326  RMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRSQ---HFYID  22204

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 234 bits (597),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 149/458 (33%), Positives = 248/458 (54%), Gaps = 30/458 (7%)
 Frame = -2

Query  250     LVRQTSTKTSPATRE--RLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQI  307
               +VR++   +S  +RE  +L+   + + +      R S R     P+ D AL+ P  +  +
Sbjct  431177  VVRESIRASSKLSRESSKLSRESSKISRESSKLFRESTR----QPIKDQALTQPWENV-L  431013

Query  308     NEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSA  367
               N+  P ++        A  + P +RTWA+ +  +W      T    +L VVG  G GKS 
Sbjct  431012  NQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKST  430845

Query  368     FCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVL  427
                   +   +   ++A+H  ++D +  ++   +L+S+ HQI    P F+ QL RLNL Y++
Sbjct  430844  LLSHLVSNYPEQIMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLI  430671

Query  428     EEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPT  487
               +E DP++LA K+L++PL ++  P+++  +++D +D+ A+   G N L+   A +  + P+
Sbjct  430670  QEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTP-GTN-LISLLADVALEFPS  430497

Query  488     WVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSML  547
               WV FLLSS+P   + K LP   VL F  E+  F AD    V+ +      DD      +L
Sbjct  430496  WVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD-KNILFLL  430320

Query  548     KQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGR  607
               K KS G+F YL+F  QA        A     +  G++ +LP+TLY+IY ++FE+K+G+GR
Sbjct  430319  KAKSQGSFLYLQFVDQAF-------AMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGR  430161

Query  608     ARVWGKAKPLLQLVVGAASGPYSP-----VTEEQAREHFNLTAEDLRMLRRSFVDLVAVR  662
                RVW K +P+L+ +VGAA+  +       VTE   +  F L   DL ++ RSF D+VAV 
Sbjct  430160  RRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVD  429981

Query  663     H--GSYRIESSALCAWLSDPARSEEQFYFSIDDALQAL  698
                  G YR++S  L  +L D +RS+E  + +++  +  L
Sbjct  429980  EETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYL  429867

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  191     IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQH  225
               IRR+VM ELH T+YD+LKE+ +L+GAV QL  A H
Sbjct  431483  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  431379

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 227 bits (579),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 144/462 (31%), Positives = 245/462 (53%), Gaps = 30/462 (6%)
 Frame = +1

Query  250     LVRQTSTKTSPATRE--RLAASRANVQKTPPPFARASVRL----TQLAPVADDALSTPLT  303
               + R+++  +S  +RE  +L+   + + +     +R S +L    +   P+ D AL+ P  
Sbjct  171802  VFRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPWE  171981

Query  304     SQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGT  363
               +  +N+  P ++        A  + P +RTWA+ +  +W      T    +L VVG  G 
Sbjct  171982  NV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGA  172146

Query  364     GKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNL  423
               GKS     +   +   ++A+H  ++D +    P  +L+S+ HQI    P ++ QL RLNL
Sbjct  172147  GKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKLPDYQQQLVRLNL  172320

Query  424     KYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIP  483
                Y+++E DP++LA K+L++PL ++  P+++  +++D +D+      G N L+   A +  
Sbjct  172321  PYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVSTPGAN-LISLLADVAL  172494

Query  484     QLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKA  543
               + P+WV FLLSS+    + K LP   VL F  E+  F AD    V+ +      DD    
Sbjct  172495  EFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDD-KNI  172671

Query  544     KSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKF  603
                 +LK KS G+F YL+F  QA S            +  G++ +LP+TL++IY ++FE+K+
Sbjct  172672  LFLLKAKSQGSFLYLQFVDQAFS-------MIHSEIDAGMILELPKTLHEIYDQVFEEKY  172830

Query  604     GQGRARVWGKAKPLLQLVVGAASGPYSP-----VTEEQAREHFNLTAEDLRMLRRSFVDL  658
               G+GR RVW K + +L+ +VGAA+  +       VTE   +  F L   DL ++ RSF D+
Sbjct  172831  GKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDI  173010

Query  659     VAVRH--GSYRIESSALCAWLSDPARSEEQFYFSIDDALQAL  698
               V V    G YR++S  L  +L D ARS+E  + +++  +  L
Sbjct  173011  VTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  173136

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  191     IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQH  225
               IRR+VM ELH T+YD+LKE+ +L+GAV QL  A H
Sbjct  171490  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  171594

>PYVX:scaffold_674 pve_scaffold_674 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_674:1:16178:1 
REF
Length=16178

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 76/177 (43%), Gaps = 23/177 (13%)
 Frame = -1

Query  332    RTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRK  391
              R W   RV++W++   +     +  + G+ G+GK++    + Q F   + A H    +  
Sbjct  10280  RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDD  10104

Query  392    SKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPM----LLAAKVLVDPLNAL  447
                   R  +LS+ +Q+    P +      L  +  LEE  P+     L   +LV+PLN +
Sbjct  10103  QTHIARRCVLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTI  9933

Query  448    EEPVQAAFMMVDGIDQCAAGAQGR---------------NELLEFFAQIIPQLPTWV  489
              + P +   +++DG++   +GA                    L+     ++ +LP+WV
Sbjct  9932   KRPAKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWV  9762

>PHCA:scaffold_28 PHYCAscaffold_28
Length=757753

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 72/328 (22%), Positives = 128/328 (39%), Gaps = 74/328 (23%)
 Frame = -1

Query  354     LLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPP  413
               +  VVG+ G+GKS+    +       + A H  + + +   + R  +LS+ +Q+    P 
Sbjct  280225  MFWVVGQIGSGKSSVAACMVHSC-PEIAAFHFARQEDEQTHSARRCILSLAYQLTTQLPE  280049

Query  414     FKNQL-ARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQ--AAFMMVDGID--------  462
               + + L +   L+ ++  A  + L   +L+ PLNA+  P +  +  +++DG++        
Sbjct  280048  YAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNAIARPTKYKSLVLLIDGVEWLIPRPAS  279869

Query  463     --------QCAAGAQGRNELLEFFAQIIPQLPTWVGFllss-----kpssklakrlPVSS  509
                           G+     L+     +I +LP WV  +L S       S   A   P  +
Sbjct  279868  SSLPPLSGNSWKGSNDEECLVSMLPSLISRLPEWVRVVLLSREDPPVLSKLHAFVPPDIT  279689

Query  510     VLDFSAENDAFVADVAPLVEDIAR---------NFSDDDFVKAK----------------  544
               +  F  +ND          +DI R         +FSDDDF KA                 
Sbjct  279688  IEQFQQQND----------QDIRRYVHHSLSKLHFSDDDFEKASVGIEPSSHRCGMDQAV  279539

Query  545     SMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFG  604
                ++ ++S G F Y     QA+S         EG + L  L +LP  +     + F   F 
Sbjct  279538  ELIARRSEGLFLYAVNVVQAIS---------EGRLHLNELAELPVGMGAYLQQFFASHFS  279386

Query  605     QGRARVWGKAKPLLQLVVGAASGPYSPV  632
                       + +P+L++   A    Y P+
Sbjct  279385  DHDMYK-HRVRPVLEVCCAA----YEPL  279317

>PHKE:scaffold_386 scf_22126_386.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_386.1:1:33848:1 
REF
Length=33848

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 71/165 (43%), Gaps = 27/165 (16%)
 Frame = +1

Query  350   GSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVD  409
             GS  +  VVG+ G GK++    + Q     + A H  Q + +     R  +LS+ +Q+  
Sbjct  8008  GSQRVFWVVGQIGAGKTSVAARLVQSC-PEIAAFHFAQQEDEQTHNARRCVLSLAYQLTT  8184

Query  410   NYPPFKNQLARLNLKYVLEEADPML----LAAKVLVDPLNALEEPVQAAFMMVDGIDQCA  465
               P + + L        LEE  P+     L   +LV PLNA+  P ++  +++DG++   
Sbjct  8185  QLPEYAHYLQS---HEPLEEMVPVASFPELVTNLLVGPLNAIARPSKSLVLLIDGLEWLI  8355

Query  466   AGA-----------------QGRNE--LLEFFAQIIPQLPTWVGF  491
               +                 + + E  L+     ++P+LP WV F
Sbjct  8356  PASSSSSPPSLSSLSMSSWKESKEEECLVSMLPSLVPRLPEWVRF  8490

>PYAP:scaffold_554 pag1_scaffold_554 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_554:1:21860:1 
REF
Length=21860

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 63/138 (46%), Gaps = 11/138 (8%)
 Frame = -3

Query  332    RTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRK  391
              R W L  + +W+++   +GS +   V G+ G+GK++    +  Q    + A H    D  
Sbjct  20058  RAWLLESIRQWINTPVTSGSKVFW-VTGQIGSGKTSVAARMV-QLMPEIAAFHFALQDDD  19885

Query  392    SKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPM----LLAAKVLVDPLNAL  447
                   R  +LS+ +Q+    P +      L     LEE  P+     L   +LV+PLNA+
Sbjct  19884  QTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAI  19714

Query  448    EEPV--QAAFMMVDGIDQ  463
                P   +   +++DG++ 
Sbjct  19713  ARPKSDKPVVLLIDGLEH  19660

>PYIR:scaffold_32 pir_scaffold_32 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_32:1:78258:1 
REF
Length=78258

 Score = 46.6 bits (109),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/139 (24%), Positives = 67/139 (48%), Gaps = 7/139 (5%)
 Frame = +3

Query  332    RTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRK  391
              R W   ++E W+ S   T    +  V G+ G+GK+A    + Q     + A H    + +
Sbjct  74484  REWLFMQLENWIASPTATQ---VFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDE  74651

Query  392    SKSTPRNVLLSMVHQIVDNYPPFKNQL-ARLNLKYVLEEADPMLLAAKVLVDPLNALEEP  450
                   R  +LS+ +Q+    P +   L +R  L+ ++  ++   L  ++LV+PLN +  P
Sbjct  74652  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  74831

Query  451    --VQAAFMMVDGIDQCAAG  467
                 +   +++DG++  ++G
Sbjct  74832  QSTKPLVLLIDGLEHLSSG  74888

>PYAR:scaffold_139 par_scaffold_139 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_139:1:29266:1 
REF
Length=29266

 Score = 46.2 bits (108),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 62/141 (44%), Gaps = 12/141 (9%)
 Frame = +2

Query  332    RTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRK  391
              R W    + +W+D+  N  S  +  V G+ G GK++    + Q     + A H    +  
Sbjct  27917  RAWLFETIRDWIDAPHN--SSKVFWVTGQIGAGKTSVAAKMVQTI-PEIAAFHFALQEDD  28087

Query  392    SKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPM----LLAAKVLVDPLNAL  447
                   R  +LS+ +Q+    P +      L     LEE  P+     L A +L+ PLNA+
Sbjct  28088  QTQLARRCVLSLAYQLTTQLPAYA---VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAI  28258

Query  448    EEPV--QAAFMMVDGIDQCAA  466
                P   +   +++DG++  A+
Sbjct  28259  ARPKSDKPLILLIDGLEHLAS  28321

>SAPA:scaffold_92 supercont2.92 dna:supercontig supercontig:ASM15154v2:supercont2.92:1:149726:1 
REF
Length=149726

 Score = 33.5 bits (75),  Expect(2) = 0.082, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -2

Query  352    DILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAH-CCQFDRKSKSTPRNVLLSMVHQIVDN  410
              D+ + V G+ GTGKSA    + Q  R  + A H  C+ D +++S  R V LS+ +Q+   
Sbjct  49000  DLSIVVQGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDEQTQSHRRCV-LSLAYQLTTQ  48827

Query  411    YPPFKNQL  418
               P + + L
Sbjct  48826  LPEYASFL  48803

 Score = 26.9 bits (58),  Expect(2) = 0.082, Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 34/83 (41%), Gaps = 20/83 (24%)
 Frame = -3

Query  427    LEEADPMLLAAKVL----VDPLNALEEPVQAAF----------------MMVDGIDQCAA  466
              LEE  P+    ++L    V PL A+ EP                     +++DG+D    
Sbjct  48732  LEEVVPVSTVVELLDILLVAPLRAIAEPATTPLVYVHTKNDS*KKMC*VILLDGLDSLED  48553

Query  467    GAQGRNELLEFFAQIIPQLPTWV  489
                +  N L+     ++ +LP+WV
Sbjct  48552  TQETDNCLVSALPALLQKLPSWV  48484

>SADI:scaffold_11 supercont1.11 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.11:1:1009767:1 
REF
Length=1009767

 Score = 36.6 bits (83),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 59/119 (50%), Gaps = 17/119 (14%)
 Frame = -3

Query  313     LIDFTSELAAHARGLTPGSRTWALTRVEEWLDSR----FNTG---SDILL-----AVVGE  360
               L  F  +++ + +G     R W L ++++W  +     + TG   S  L+     +V+G+
Sbjct  627088  LWTFFVQISKYTQGF--AGREWVLHQLDQWKQTHDQVFWITGTIYSTSLVNTWKHSVLGQ  626915

Query  361     GGTGKSAFCGTVAQQFRGNMLAAH-CCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQL  418
                GTGKSA    + Q  R  + A H  C+ D +++S  R  +LS+ +Q+    P + + L
Sbjct  626914  IGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQS-HRRCILSLAYQLTTQLPEYASFL  626744

>PYUU:scaffold_2022 scf1117875582022 dna:supercontig supercontig:pug:scf1117875582022:1:784545:1 
REF
Length=784545

 Score = 32.0 bits (71),  Expect(2) = 6.0, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 4/82 (5%)
 Frame = +3

Query  354     LLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPR--NVLLSMVHQIVDNY  411
               LL + G+GG GKS     +A    G          D    S PR   +L   VHQ    +
Sbjct  734817  LLVLSGKGGVGKSTVACQLAFALAGKGYQVGLLDVDITGPSVPRMLGLLGQEVHQSAAGW  734996

Query  412     PP--FKNQLARLNLKYVLEEAD  431
                P    + L  +++ ++L  AD
Sbjct  734997  SPVYVDDNLGVMSIGFMLPNAD  735062

 Score = 21.6 bits (44),  Expect(2) = 6.0, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)
 Frame = +1

Query  336     LTRVEEWLDSRFNTGSDILLA  356
               LTRV  WL+ R    S + LA
Sbjct  734743  LTRVALWLEQRSRM*SSVWLA  734805

>APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.1:1:2817317:1 
REF
Length=2817317

 Score = 35.4 bits (80),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = -1

Query  71      NNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATN  112
               +NR+ ASA SD PQ+ T+   R   L L    EDAE PSAT+
Sbjct  185492  SNRTMASAWSDGPQHETSLPRRKKSLELVLDDEDAEHPSATS  185367

Lambda      K        H        a         alpha
   0.317    0.130    0.375    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 267912034504

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40