Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHSO:scaffold_12794832279630749225820.0
PHCA:scaffold_84962949776349024330.0
PHPA:scaffold_6324594524741149224260.0
PHRA:scaffold_5615887216033849124080.0
PHIF:NW_003303697.139605139752649223850.0
PHKE:scaffold_98616696314149223780.0
HYAP:scaffold_5915915216066350422520.0
PLHA:NW_020189861.11849470185091248121280.0
PYUU:scaffold_20371304058130554550221100.0
PYAP:scaffold_162170531845947720690.0
PYIR:scaffold_810456310601149020480.0
PYAR:scaffold_29183481975147620250.0
PYIW:scaffold_9637381885649919520.0
PYVX:scaffold_2754218566948919490.0
APAS:scaffold_1894545494691750417200.0
APIN:scaffold_18678336920947117090.0
SAPA:scaffold_113865738795847515940.0
SADI:scaffold_1508578996347515930.0
SAPA:scaffold_1066801466944448710362e-123
SADI:scaffold_7116512516655548910319e-123
SADI:scaffold_94317994332054836293e-69
PHPA:scaffold_212765692779394726195e-68
PYAP:scaffold_73928416544726188e-68
PHCA:scaffold_86766166779864726152e-67
PYAP:scaffold_510265240854976143e-67
PYAR:scaffold_544207435855236133e-67
PHIF:NW_003303727.15819965833544686073e-66
PHSO:scaffold_136975496990035026045e-66
PHRA:scaffold_751203281217254836002e-65
HYAP:scaffold_871212611226134685879e-64
PLHA:NW_020187271.14152514166694895772e-62
PYUU:scaffold_20354273244286944795763e-62
PHKE:scaffold_694474761654885736e-62
SADI:scaffold_831281791288562393404e-61
SADI:scaffold_393634853641622393401e-60
PYAR:scaffold_58314115234805506e-59
SAPA:scaffold_173792453799282413184e-58
PYIR:scaffold_23635380360932503112e-57
PLHA:NW_020190027.154976559473293922e-55
PYIR:scaffold_1258635576654545171e-54
APIN:scaffold_701399401409983684213e-54
ALCA:scaffold_52312154135994935126e-54
ALLA:FR82424632792335832673853e-53
PYVX:scaffold_12438180392143584021e-47
PYUU:scaffold_13521327571338093544021e-39
PYIW:scaffold_339081118573643973e-39
PYAP:scaffold_61012456138024803895e-38
APIN:scaffold_304761334768762602813e-37
PHRA:scaffold_601872391882133283737e-36
ALLA:FR82422024723260784803674e-35
ALCA:scaffold_26216793181454843666e-35
PHKE:scaffold_81640381653724823631e-34
PYIR:scaffold_544493563234903612e-34
PHPA:scaffold_791004431011772523039e-34
PHKE:scaffold_13921103934414743419e-32
HYAP:scaffold_20838045393884773372e-31
PHKE:scaffold_351060431073894823338e-31
HYAP:scaffold_321821001827052043241e-29
PHKE:scaffold_661061981068032043195e-29
PYVX:scaffold_632843496724343179e-29
PHKE:scaffold_1317480187664723161e-28
PHSO:scaffold_44005134011031993151e-28
PYUU:scaffold_20326522336535794813115e-28
PHIF:NW_003303731.1189899118995811993072e-27
PHCA:scaffold_207763987769881993062e-27
PHKE:scaffold_531311644984902964e-26
PHRA:scaffold_10967291687065122955e-26
APAS:scaffold_244172364179072372946e-26
PLHA:NW_020187357.12991483005004802947e-26
PHSO:scaffold_2130070813020514762931e-25
SAPA:scaffold_541165821179344872858e-25
PHIF:NW_003303722.154881562334802831e-24
SADI:scaffold_194915624929144872794e-24
APAS:scaffold_962026292033482532795e-24
PHCA:scaffold_513801263814784802795e-24
SAPA:scaffold_473311136531842617e-22
PHIF:NW_003303667.12300372307442501791e-20
PYAR:scaffold_42514438158625042465e-20
PYVX:scaffold_67510798111691251532e-19
PYIW:scaffold_330825531872384e-19
APIN:scaffold_444333455714442394e-19
APAS:scaffold_8845178464164442332e-18
SAPA:scaffold_114000554005131562323e-18
PHPA:scaffold_312472272484264222234e-17
PYAR:scaffold_1175317240022982181e-16
PYAP:scaffold_25534414353583371676e-15
SAPA:scaffold_7287354881722871869e-13
SADI:scaffold_472620672627592501752e-11
HYAP:scaffold_731609331615442191743e-11
PYIW:scaffold_2918363639711161555e-09
PHRA:scaffold_53529503540203721547e-09
PHPA:scaffold_1343417534352423711459e-08
PHRA:scaffold_322108322114792311394e-07
PHIF:NW_003303668.192588932382321378e-07
ALLA:FR82406994901960734001323e-06
PHSO:scaffold_79634709641172301323e-06
PHPA:scaffold_173177803184362341314e-06
HYAP:scaffold_29813173138262261314e-06
PLHA:NW_020187364.14563694570162311296e-06
PHKE:scaffold_794229229422321261e-05
PHPA:scaffold_1753541935610671261e-05
PHIF:NW_003303629.150533509821591243e-05
PHCA:scaffold_7139928405932391243e-05
APIN:scaffold_118316961831887721225e-05
APIN:scaffold_148665978669141161225e-05
PYIR:scaffold_8184447551141216e-05
APAS:scaffold_158466928469641011208e-05
APAS:scaffold_2924326924529761208e-05
PYVX:scaffold_5281198512209831162e-04
PYAR:scaffold_3989735102891971127e-04
SAPA:scaffold_8757772580891161110.001
SADI:scaffold_13323058323288871100.001
PYUU:scaffold_2014329151329342721090.002
PHIF:NW_003303757.141577624158007921070.003
PYIW:scaffold_92414851676721030.008
ALCA:scaffold_100339724160711020.011
PYIW:scaffold_103436723839641010.012
PYVX:scaffold_127217238821010.014
HYAP:scaffold_26151329151568881000.017
PHKE:scaffold_1577792783461991000.018
PYIR:scaffold_335928759457651000.020
ALCA:scaffold_5108701107978990.021
PHSO:scaffold_35403842540400964990.021
PYIW:scaffold_730721338114950.025
PHKE:scaffold_65392543941863990.026
PHPA:scaffold_1391142136382980.032
PLHA:NW_020187508.1883548852766970.040
PYUU:scaffold_140262117462140791960.048
ALLA:FR824046456002456280101940.10
PYUU:scaffold_13144864548923100920.16
PYAP:scaffold_246217362191267910.21
PHSO:scaffold_538576963857974100910.22
PHIF:NW_003303230.16387653057900.28
SAPA:scaffold_13511888210681841.1
PHPA:scaffold_15238240238518100851.1
PLHA:NW_020187445.116710361671314100832.0
PHIF:NW_003303758.136676613667939100822.2
SAPA:scaffold_68070387114822.4
PHIF:NW_003303753.12644879264502851822.6
PHRA:scaffold_182926392917100804.2
PHRA:scaffold_104136840137118100804.6
HYAP:scaffold_17203686204018124779.6
PHKE:scaffold_2205092951069497710.0
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYSO_348901

Length=526
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHSO:scaffold_1                                                       999        0.0   
PHCA:scaffold_84 PHYCAscaffold_84                                     941        0.0   
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  939        0.0   
PHRA:scaffold_56                                                      932        0.0   
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  923        0.0   
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  920        0.0   
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  872        0.0   
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  824        0.0   
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  817        0.0   
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  801        0.0   
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  793        0.0   
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  784        0.0   
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  756        0.0   
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  755        0.0   
APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_a...  667        0.0   
APIN:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_i...  662        0.0   
SAPA:scaffold_113 supercont2.113 dna:supercontig supercontig:ASM1...  618        0.0   
SADI:scaffold_150 supercont1.150 dna:supercontig supercontig:Sap_...  618        0.0   
SAPA:scaffold_10 supercont2.10 dna:supercontig supercontig:ASM151...  403        2e-123
SADI:scaffold_71 supercont1.71 dna:supercontig supercontig:Sap_di...  401        9e-123
SADI:scaffold_9 supercont1.9 dna:supercontig supercontig:Sap_dicl...  246        3e-69 
PHPA:scaffold_21 NW_008649007.1 Phytophthora parasitica INRA-310 ...  243        5e-68 
PYAP:scaffold_739 pag1_scaffold_739 dna:supercontig supercontig:p...  242        8e-68 
PHCA:scaffold_8 PHYCAscaffold_8                                       241        2e-67 
PYAP:scaffold_510 pag1_scaffold_510 dna:supercontig supercontig:p...  241        3e-67 
PYAR:scaffold_544 par_scaffold_544 dna:supercontig supercontig:pa...  240        3e-67 
PHIF:NW_003303727.1 Phytophthora infestans T30-4 supercont1.32 ge...  238        3e-66 
PHSO:scaffold_13                                                      237        5e-66 
PHRA:scaffold_75                                                      235        2e-65 
HYAP:scaffold_87 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  230        9e-64 
PLHA:NW_020187271.1 Plasmopara halstedii genome assembly, contig:...  226        2e-62 
PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:p...  226        3e-62 
PHKE:scaffold_694 scf_22126_694.1 dna:supercontig supercontig:Phy...  225        6e-62 
SADI:scaffold_83 supercont1.83 dna:supercontig supercontig:Sap_di...  135        4e-61 
SADI:scaffold_39 supercont1.39 dna:supercontig supercontig:Sap_di...  135        1e-60 
PYAR:scaffold_583 par_scaffold_583 dna:supercontig supercontig:pa...  216        6e-59 
SAPA:scaffold_17 supercont2.17 dna:supercontig supercontig:ASM151...  134        4e-31 
PYIR:scaffold_236 pir_scaffold_236 dna:supercontig supercontig:pi...  124        2e-57 
PLHA:NW_020190027.1 Plasmopara halstedii genome assembly, contig:...  155        2e-55 
PYIR:scaffold_1258 pir_scaffold_1258 dna:supercontig supercontig:...  203        1e-54 
APIN:scaffold_70 supercont1.70 dna:supercontig supercontig:Apha_i...  166        3e-54 
ALCA:scaffold_523 AcNc2_CONTIG_523_length_15388 dna:supercontig s...  201        6e-54 
ALLA:FR824246 dna:supercontig supercontig:ENA1:FR824246:1:47019:1...  152        3e-53 
PYVX:scaffold_124 pve_scaffold_124 dna:supercontig supercontig:pv...  159        1e-47 
PYUU:scaffold_1352 scf1117875581352 dna:supercontig supercontig:p...  159        1e-39 
PYIW:scaffold_3390 piw_scaffold_3390 dna:supercontig supercontig:...  157        3e-39 
PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:p...  154        5e-38 
APIN:scaffold_30 supercont1.30 dna:supercontig supercontig:Apha_i...  112        3e-37 
PHRA:scaffold_60                                                      148        7e-36 
ALLA:FR824220 dna:supercontig supercontig:ENA1:FR824220:1:54737:1...  145        4e-35 
ALCA:scaffold_262 AcNc2_CONTIG_262_length_36549 dna:supercontig s...  145        6e-35 
PHKE:scaffold_8 scf_22126_8.1_contig_1 dna:supercontig superconti...  144        1e-34 
PYIR:scaffold_544 pir_scaffold_544 dna:supercontig supercontig:pi...  143        2e-34 
PHPA:scaffold_79 NW_008649065.1 Phytophthora parasitica INRA-310 ...  121        9e-34 
PHKE:scaffold_1 scf_22126_1.1_contig_1 dna:supercontig superconti...  135        9e-32 
HYAP:scaffold_208 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  134        2e-31 
PHKE:scaffold_35 scf_22126_35.1_contig_1 dna:supercontig supercon...  132        8e-31 
HYAP:scaffold_32 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_3...  129        1e-29 
PHKE:scaffold_66 scf_22126_66.1 dna:supercontig supercontig:PhyKe...  127        5e-29 
PYVX:scaffold_632 pve_scaffold_632 dna:supercontig supercontig:pv...  126        9e-29 
PHKE:scaffold_13 scf_22126_13.1_contig_1 dna:supercontig supercon...  126        1e-28 
PHSO:scaffold_4                                                       125        1e-28 
PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:p...  124        5e-28 
PHIF:NW_003303731.1 Phytophthora infestans T30-4 supercont1.28 ge...  122        2e-27 
PHCA:scaffold_20 PHYCAscaffold_20                                     122        2e-27 
PHKE:scaffold_531 scf_22126_531.1 dna:supercontig supercontig:Phy...  118        4e-26 
PHRA:scaffold_109                                                     118        5e-26 
APAS:scaffold_24 supercont1.24 dna:supercontig supercontig:Apha_a...  117        6e-26 
PLHA:NW_020187357.1 Plasmopara halstedii genome assembly, contig:...  117        7e-26 
PHSO:scaffold_2                                                       117        1e-25 
SAPA:scaffold_54 supercont2.54 dna:supercontig supercontig:ASM151...  114        8e-25 
PHIF:NW_003303722.1 Phytophthora infestans T30-4 supercont1.37 ge...  113        1e-24 
SADI:scaffold_19 supercont1.19 dna:supercontig supercontig:Sap_di...  112        4e-24 
APAS:scaffold_96 supercont1.96 dna:supercontig supercontig:Apha_a...  112        5e-24 
PHCA:scaffold_51 PHYCAscaffold_51                                     112        5e-24 
SAPA:scaffold_473 supercont2.473 dna:supercontig supercontig:ASM1...  105        7e-22 
PHIF:NW_003303667.1 Phytophthora infestans T30-4 supercont1.92 ge...  73.6       1e-20 
PYAR:scaffold_425 par_scaffold_425 dna:supercontig supercontig:pa...  99.4       5e-20 
PYVX:scaffold_675 pve_scaffold_675 dna:supercontig supercontig:pv...  89.0       1e-16 
PYIW:scaffold_3308 piw_scaffold_3308 dna:supercontig supercontig:...  96.3       4e-19 
APIN:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_inv...  96.7       4e-19 
APAS:scaffold_88 supercont1.88 dna:supercontig supercontig:Apha_a...  94.4       2e-18 
SAPA:scaffold_11 supercont2.11 dna:supercontig supercontig:ASM151...  94.0       3e-18 
PHPA:scaffold_31 NW_008649017.1 Phytophthora parasitica INRA-310 ...  90.5       4e-17 
PYAR:scaffold_1175 par_scaffold_1175 dna:supercontig supercontig:...  88.6       1e-16 
PYAP:scaffold_255 pag1_scaffold_255 dna:supercontig supercontig:p...  68.9       6e-15 
SAPA:scaffold_72 supercont2.72 dna:supercontig supercontig:ASM151...  76.3       9e-13 
SADI:scaffold_47 supercont1.47 dna:supercontig supercontig:Sap_di...  72.0       2e-11 
HYAP:scaffold_73 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  71.6       3e-11 
PYIW:scaffold_2918 piw_scaffold_2918 dna:supercontig supercontig:...  64.3       5e-09 
PHRA:scaffold_5                                                       63.9       7e-09 
PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 u...  60.5       9e-08 
PHRA:scaffold_32                                                      58.2       4e-07 
PHIF:NW_003303668.1 Phytophthora infestans T30-4 supercont1.91 ge...  57.4       8e-07 
ALLA:FR824069 dna:supercontig supercontig:ENA1:FR824069:1:177300:...  55.5       3e-06 
PHSO:scaffold_7                                                       55.5       3e-06 
PHPA:scaffold_17 NW_008649003.1 Phytophthora parasitica INRA-310 ...  55.1       4e-06 
HYAP:scaffold_298 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  55.1       4e-06 
PLHA:NW_020187364.1 Plasmopara halstedii genome assembly, contig:...  54.3       6e-06 
PHKE:scaffold_794 scf_22126_794.1_contig_1 dna:supercontig superc...  53.1       1e-05 
PHPA:scaffold_175 NW_008649161.1 Phytophthora parasitica INRA-310...  53.1       1e-05 
PHIF:NW_003303629.1 Phytophthora infestans T30-4 supercont1.130 g...  52.4       3e-05 
PHCA:scaffold_71 PHYCAscaffold_71                                     52.4       3e-05 
APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inv...  51.6       5e-05 
APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_i...  51.6       5e-05 
PYIR:scaffold_818 pir_scaffold_818 dna:supercontig supercontig:pi...  51.2       6e-05 
APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_a...  50.8       8e-05 
APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_ast...  50.8       8e-05 
PYVX:scaffold_528 pve_scaffold_528 dna:supercontig supercontig:pv...  49.3       2e-04 
PYAR:scaffold_398 par_scaffold_398 dna:supercontig supercontig:pa...  47.8       7e-04 
SAPA:scaffold_87 supercont2.87 dna:supercontig supercontig:ASM151...  47.4       0.001 
SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_di...  47.0       0.001 
PYUU:scaffold_2014 scf1117875582014 dna:supercontig supercontig:p...  46.6       0.002 
PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 gen...  45.8       0.003 
PYIW:scaffold_924 piw_scaffold_924 dna:supercontig supercontig:pi...  44.3       0.008 
ALCA:scaffold_1003 AcNc2_CONTIG_1003_length_4568 dna:supercontig ...  43.9       0.011 
PYIW:scaffold_1034 piw_scaffold_1034 dna:supercontig supercontig:...  43.5       0.012 
PYVX:scaffold_1272 pve_scaffold_1272 dna:supercontig supercontig:...  43.5       0.014 
HYAP:scaffold_26 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_2...  43.1       0.017 
PHKE:scaffold_15 scf_22126_15.1_contig_1 dna:supercontig supercon...  43.1       0.018 
PYIR:scaffold_33 pir_scaffold_33 dna:supercontig supercontig:pir_...  43.1       0.020 
ALCA:scaffold_5 AcNc2_CONTIG_5_length_245754 dna:supercontig supe...  42.7       0.021 
PHSO:scaffold_3                                                       42.7       0.021 
PYIW:scaffold_7307 piw_scaffold_7307 dna:supercontig supercontig:...  41.2       0.025 
PHKE:scaffold_65 scf_22126_65.1 dna:supercontig supercontig:PhyKe...  42.7       0.026 
PHPA:scaffold_139 NW_008649125.1 Phytophthora parasitica INRA-310...  42.4       0.032 
PLHA:NW_020187508.1 Plasmopara halstedii genome assembly, contig:...  42.0       0.040 
PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:p...  41.6       0.048 
ALLA:FR824046 dna:supercontig supercontig:ENA1:FR824046:1:580768:...  40.8       0.10  
PYUU:scaffold_1314 scf1117875581314 dna:supercontig supercontig:p...  40.0       0.16  
PYAP:scaffold_246 pag1_scaffold_246 dna:supercontig supercontig:p...  39.7       0.21  
PHSO:scaffold_5                                                       39.7       0.22  
PHIF:NW_003303230.1 Phytophthora infestans T30-4 supercont1.538 g...  39.3       0.28  
SAPA:scaffold_1351 supercont2.1351 dna:supercontig supercontig:AS...  37.0       1.1   
PHPA:scaffold_15 NW_008649001.1 Phytophthora parasitica INRA-310 ...  37.4       1.1   
PLHA:NW_020187445.1 Plasmopara halstedii genome assembly, contig:...  36.6       2.0   
PHIF:NW_003303758.1 Phytophthora infestans T30-4 supercont1.1 gen...  36.2       2.2   
SAPA:scaffold_680 supercont2.680 dna:supercontig supercontig:ASM1...  36.2       2.4   
PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 gen...  36.2       2.6   
PHRA:scaffold_1829                                                    35.4       4.2   
PHRA:scaffold_104                                                     35.4       4.6   
HYAP:scaffold_17 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1...  34.3       9.6   
PHKE:scaffold_220 scf_22126_220.1_contig_1 dna:supercontig superc...  34.3       10.0  

>PHSO:scaffold_1
Length=13391543

 Score = 999 bits (2582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/492 (100%), Positives = 492/492 (100%), Gaps = 0/492 (0%)
 Frame = -2

Query  26       TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85
                TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC
Sbjct  2796307  TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  2796128

Query  86       VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145
                VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF
Sbjct  2796127  VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  2795948

Query  146      KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205
                KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE
Sbjct  2795947  KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  2795768

Query  206      HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265
                HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN
Sbjct  2795767  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  2795588

Query  266      KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
                KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV
Sbjct  2795587  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  2795408

Query  326      AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
                AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN
Sbjct  2795407  AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  2795228

Query  386      NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
                NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT
Sbjct  2795227  NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  2795048

Query  446      AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPtta  505
                AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA
Sbjct  2795047  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  2794868

Query  506      etfttleitKSS  517
                ETFTTLEITKSS
Sbjct  2794867  ETFTTLEITKSS  2794832

 Score = 39.7 bits (91),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = -3

Query  7        SIQESALNTKKNMQIHDPST-PSAVDEAETSYDYDLVV  43
                S QESALNTKKNMQIHDPS  P      E + + +L +
Sbjct  2798565  SRQESALNTKKNMQIHDPSVWPHRNSSGEMARELNLSL  2798452

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/490 (93%), Positives = 476/490 (97%), Gaps = 0/490 (0%)
 Frame = -3

Query  28     SAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  87
              S  D  ET+YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN
Sbjct  97763  STADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  97584

Query  88     VGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKY  147
              VGCIPKKLMHQSSLIGE++HHD ANFGWN++S DG+A TF+WKQLV+NVDGYI+ INFKY
Sbjct  97583  VGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKY  97404

Query  148    KVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  207
              KVELRSKYVKYENFLGSFV+ HTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA
Sbjct  97403  KVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  97224

Query  208    ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267
              ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMA+KI
Sbjct  97223  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKI  97044

Query  268    GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
              GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT+EDGESCEEAFDTVLNATGRDPDVAK
Sbjct  97043  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAK  96864

Query  328    LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
              L LDKA VKLNEK+GRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS
Sbjct  96863  LNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  96684

Query  388    TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
              T QMDY+K+CTAVFTPIEYGCCG+SEEDSKER+GEDNIEVYH NFVPLEWSLS +TRTAA
Sbjct  96683  TVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAA  96504

Query  448    ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPttaet  507
              ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE+
Sbjct  96503  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAES  96324

Query  508    fttleitKSS  517
              FTTLE+TKSS
Sbjct  96323  FTTLEVTKSS  96294

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/492 (93%), Positives = 473/492 (96%), Gaps = 3/492 (1%)
 Frame = -1

Query  26      TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85
               T  A  E ETSYDYDLVVIGGGSGGLACSKEAAS GQKVCVLDYVKPSPQGTSWGLGGTC
Sbjct  247411  TSPADAEKETSYDYDLVVIGGGSGGLACSKEAASLGQKVCVLDYVKPSPQGTSWGLGGTC  247232

Query  86      VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145
               VNVGCIPKKLMHQSSLIGE+MHHDSANFGWN+   +GSA TF WKQLV NVDGYI+GINF
Sbjct  247231  VNVGCIPKKLMHQSSLIGEVMHHDSANFGWNV---EGSAPTFDWKQLVTNVDGYIKGINF  247061

Query  146     KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205
               KYKVELRSKYVKYENF+GSF+D HTLELWHPRKGTKQITTRDVVIAVGGRP+ELTCPGGE
Sbjct  247060  KYKVELRSKYVKYENFMGSFIDPHTLELWHPRKGTKQITTRDVVIAVGGRPRELTCPGGE  246881

Query  206     HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265
               HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMA 
Sbjct  246880  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAT  246701

Query  266     KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
               KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT+EDGESCEEAFDTVLNATGRDPDV
Sbjct  246700  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDV  246521

Query  326     AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
               AKLGLDKA VKLNEK+GRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN
Sbjct  246520  AKLGLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  246341

Query  386     NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
               NST QMDYDK+CTAVFTPIEYGCCGLSEE+S ERYGEDNIEVYH NFVPLEWSLS ETRT
Sbjct  246340  NSTVQMDYDKVCTAVFTPIEYGCCGLSEENSIERYGEDNIEVYHTNFVPLEWSLSTETRT  246161

Query  446     AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPtta  505
               AAESCY+KV+CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA
Sbjct  246160  AAESCYVKVVCDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  245981

Query  506     etfttleitKSS  517
               E+FTTLE+TKSS
Sbjct  245980  ESFTTLEVTKSS  245945

>PHRA:scaffold_56
Length=334739

 Score = 932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/491 (93%), Positives = 476/491 (97%), Gaps = 2/491 (0%)
 Frame = +1

Query  27      PSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCV  86
               PSA  E ETSYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCV
Sbjct  158872  PSADAEEETSYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCV  159051

Query  87      NVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFK  146
               NVGCIPKKLMHQSSLIGE+MHHDSANFGWN+AS +GSA TF+WKQLV+NVD YI+ INFK
Sbjct  159052  NVGCIPKKLMHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFK  159228

Query  147     YKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEH  206
               YKVELRSKYVKYENFLGSFVD HTLELWH RKGTKQITTRDVVIAVGGRPKEL+CPGGEH
Sbjct  159229  YKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEH  159408

Query  207     AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANK  266
               AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMANK
Sbjct  159409  AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANK  159588

Query  267     IGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVA  326
               IGEYMEVQSGIEFIRKTVPQSIT LENGQLLVKWT EDGESCEEAFDTVLNATGRDPDVA
Sbjct  159589  IGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVA  159768

Query  327     KLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  386
               KLGLDKA VKLNEK+GRIWVKNEQTST NIYA+GDVIDAPELTPVAIQAGRLLSRRLYNN
Sbjct  159769  KLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN  159948

Query  387     STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
               STAQMDY+K+CTAVFTPIEYGCCGLSEEDSKER+GEDN+EVYH NFVPLEWSLS ETRT+
Sbjct  159949  STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS-ETRTS  160125

Query  447     AESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPttae  506
               AESCY+KVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE
Sbjct  160126  AESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  160305

Query  507     tfttleitKSS  517
               +FTTLE+TKSS
Sbjct  160306  SFTTLEVTKSS  160338

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/492 (91%), Positives = 468/492 (95%), Gaps = 0/492 (0%)
 Frame = -2

Query  26      TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85
               T S   + E SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC
Sbjct  397526  TSSTAAKEEASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  397347

Query  86      VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145
               VNVGCIPKKLMHQSSLIGE++HHDSA+FGWN++S  GSA  F WKQLV NVDGYIRGINF
Sbjct  397346  VNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINF  397167

Query  146     KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205
               KYKVELRSKYVKYENFLGSF+D HTLELWHPRKG+KQITTRDVVIAVGGRP+ELT PGGE
Sbjct  397166  KYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGE  396987

Query  206     HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265
               HAISSDDIFWMK KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN
Sbjct  396986  HAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  396807

Query  266     KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
               KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT+EDGESCEEAFD+VLNATGRDPD+
Sbjct  396806  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDI  396627

Query  326     AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
               AKL LDKA VKLNEKTGRIWVK+EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN
Sbjct  396626  AKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  396447

Query  386     NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
               N+T QMDYDK+CTAVFTPIEYGCCGLSEEDS +R+G+D IEVYH NFVPLEWSLS ETR 
Sbjct  396446  NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRA  396267

Query  446     AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPtta  505
               AAESCY+KVICD+ RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA
Sbjct  396266  AAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  396087

Query  506     etfttleitKSS  517
               E+FTTLE+TKSS
Sbjct  396086  ESFTTLEVTKSS  396051

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/492 (90%), Positives = 466/492 (95%), Gaps = 1/492 (0%)
 Frame = -2

Query  26     TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85
              TP+   E ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC
Sbjct  63141  TPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  62962

Query  86     VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145
              VNVGCIPKKLMHQSSLIGE MHHDSANFGWN+AS +G  +TF WKQLV+NVD YI+ INF
Sbjct  62961  VNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINF  62782

Query  146    KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205
              KYKVELRSKYVKYENFLGSF+D HTLELWHPRKGTKQITTR VV+AVGGRPK+LTCPG E
Sbjct  62781  KYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAE  62602

Query  206    HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265
              +AISSDDIFWMKK  PGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN
Sbjct  62601  YAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  62422

Query  266    KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
              KIGEYMEVQ+GIEFIRKTVP+SITKLENGQLLVKWTTED ESCEE FDTVLNATGRDPDV
Sbjct  62421  KIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDV  62242

Query  326    AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
              AKLGLDKA VKLNEKTGRIW KNEQTSTPNI+AIGDVIDAPELTPVAIQAGR LSRRLYN
Sbjct  62241  AKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYN  62062

Query  386    NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
              NST QMDYDK+CTAVFTPIEYGCCGLSEEDS ER+GEDN+EVYHKNFVPLEWSLS E+RT
Sbjct  62061  NSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLS-ESRT  61885

Query  446    AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPtta  505
              ++ESCY+KVICD TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA
Sbjct  61884  SSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  61705

Query  506    etfttleitKSS  517
              E FTTLE+TKSS
Sbjct  61704  EAFTTLEVTKSS  61669

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/504 (83%), Positives = 460/504 (91%), Gaps = 0/504 (0%)
 Frame = +2

Query  14      NTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPS  73
               +T    ++++  TP  V E + SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPS
Sbjct  159152  DTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPS  159331

Query  74      PQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLV  133
               P GTSWGLGGTCVNVGCIPKKLMHQSSLIGE++HHD A+FGWN+ S +G   TF WKQLV
Sbjct  159332  PHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLV  159511

Query  134     ANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVG  193
               +NV  YI+ I+FKYKVELRSK VKYEN LGSFVD HTL+LWHP+KGTK+ITTR VVIAVG
Sbjct  159512  SNVSSYIKSISFKYKVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVG  159691

Query  194     GRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  253
               GRP++L C GGE A+SSDDIFWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRS
Sbjct  159692  GRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS  159871

Query  254     ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFD  313
               ILLRGFDQDMA+KIGEYME+QSGIEFIRKTVPQSITKL++GQLLVKW TEDG+  EE FD
Sbjct  159872  ILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFD  160051

Query  314     TVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAI  373
               TVLNATGRDPDVAKLGLD+A VKLNEKTGRIWV NEQT+TPN+YAIGDVIDAPELTPVAI
Sbjct  160052  TVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAI  160231

Query  374     QAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433
               QAGRLLSRRLYN  T QMDYDKICTAVFTPIEYGCCGLSEEDSKE YG+D++EVYHKNFV
Sbjct  160232  QAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  160411

Query  434     PLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  493
               PLEWSL+E+TR AAESCY+KV+CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ
Sbjct  160412  PLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  160591

Query  494     MVDTVGIHPttaetfttleitKSS  517
               +VDTVGIHPTTAE FTTLE TKSS
Sbjct  160592  LVDTVGIHPTTAEAFTTLETTKSS  160663

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/481 (83%), Positives = 442/481 (92%), Gaps = 0/481 (0%)
 Frame = -2

Query  37       YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
                +DYDLVVIGGG GGLACSKEAASFGQKVCVLDYVKPSPQGT+WGLGGTCVNVGCIPKKL+
Sbjct  1850912  FDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  1850733

Query  97       HQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
                HQSSLIGE++ HDSA FGW   +   +   F WKQLVANVDGYI+ INFKYKV+LRSK V
Sbjct  1850732  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  1850553

Query  157      KYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWM  216
                KYENFLGSFVD HT++L HPRKGTKQITTR+VVIAVG RP+ELTCPGGE+A+SSDDIFWM
Sbjct  1850552  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  1850373

Query  217      KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  276
                K+KEPGKTLV+GASYVALECAGFLKGMGY+VKVMVRSILLR FDQ+MA+KIGEYMEVQSG
Sbjct  1850372  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSG  1850193

Query  277      IEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVK  336
                I+FIRKTVPQSI++LEN QLLVKW  E G++CEEAF+TVLNATGRDP+VA LGLDKA VK
Sbjct  1850192  IKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVK  1850013

Query  337      LNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKI  396
                LNEKTGRI VKNEQTST NIYAIGDV+DAPELTPVAIQ+GRLLS+RLYNNS+ QMDYDK+
Sbjct  1850012  LNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKV  1849833

Query  397      CTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVIC  456
                CT VFTPIEYGCCGLSEE SK RYGEDNIE+YH NFVPLEWSLS ETRTA+ SCY+KV+C
Sbjct  1849832  CTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVC  1849653

Query  457      DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPttaetfttleitKS  516
                DK+RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQMV+TVGIHP TAE+ T LE+TKS
Sbjct  1849652  DKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTILEVTKS  1849473

Query  517      S  517
                S
Sbjct  1849472  S  1849470

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/502 (78%), Positives = 430/502 (86%), Gaps = 6/502 (1%)
 Frame = -3

Query  1        MAKLRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF  60
                +A +R SI   A +    M+       +  D    +YDYDLVVIGGGSGGLACSKEAA +
Sbjct  1305545  LATIRGSISVRAFDASPVMREAPVKQDNKQDADAVTYDYDLVVIGGGSGGLACSKEAAKY  1305366

Query  61       GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA  120
                G+KVCVLDYVKPS  GTSWGLGGTCVNVGCIPKKLMHQSSLIGE +H DS  FGW +   
Sbjct  1305365  GKKVCVLDYVKPSLVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDSKAFGWTVGE-  1305189

Query  121      DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGT  180
                     TF W Q++ +V+ YI+ INFKYKVELR K VKYEN LGSF+DAHTLELWHP+KGT
Sbjct  1305188  ----QTFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFIDAHTLELWHPKKGT  1305021

Query  181      KQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFL  240
                K +TTRDVVIAVGGRPK L C GG+ AISSDDIFW +K+ PGKTLVVGASYVALECAGF+
Sbjct  1305020  KTVTTRDVVIAVGGRPKPLACEGGDLAISSDDIFW-RKEAPGKTLVVGASYVALECAGFM  1304844

Query  241      KGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKW  300
                KGMGYDVK+MVRSILLRGFDQDMA+KIGE+MEV+S IEFIR  VPQSI KLENGQLLVKW
Sbjct  1304843  KGMGYDVKIMVRSILLRGFDQDMADKIGEFMEVESKIEFIRGCVPQSIMKLENGQLLVKW  1304664

Query  301      TTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIG  360
                TT DGE+CEEAFDTVLNATGRDPDVAKLGLDKA VKLN KTGRIWV+NEQTSTPN+YAIG
Sbjct  1304663  TTADGEACEEAFDTVLNATGRDPDVAKLGLDKAGVKLNPKTGRIWVENEQTSTPNVYAIG  1304484

Query  361      DVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERY  420
                DVIDAPELTPVAIQAGRLL+RRLYNN T  MDYDK+CTAVFTPIEYGCCGLSEE S E++
Sbjct  1304483  DVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKVCTAVFTPIEYGCCGLSEEASIEKF  1304304

Query  421      GEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQA  480
                GEDN+E+YH+NF PLEWSLS  TR AA SCY+KVICDK+RDK+VVGFHYLGPNAGEVTQA
Sbjct  1304303  GEDNLEIYHQNFTPLEWSLSSATRPAASSCYVKVICDKSRDKYVVGFHYLGPNAGEVTQA  1304124

Query  481      MGLAMKLGFTYDQMVDTVGIHP  502
                MGLAMKLGFTYDQMV+ VGIHP
Sbjct  1304123  MGLAMKLGFTYDQMVNVVGIHP  1304058

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/477 (79%), Positives = 428/477 (90%), Gaps = 8/477 (2%)
 Frame = -1

Query  26     TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85
              TP AVDE++T YDYDLVVIGGGSGGLACSKEAA +G+KVCVLDYVKPSP GT+WGLGGTC
Sbjct  18459  TPVAVDESKT-YDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTC  18283

Query  86     VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145
              VNVGCIPKKLMHQS+LIGELMH D+  FGWN+         F+W QLV +V+ YI+GINF
Sbjct  18282  VNVGCIPKKLMHQSALIGELMHKDAGAFGWNMGE-----QKFTWTQLVESVNNYIKGINF  18118

Query  146    KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205
              KYKVELR K VKYENFLGSFVD HT+ELWH +KGTK ITTR VV+AVGGRP++L+CPGGE
Sbjct  18117  KYKVELRDKKVKYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGRPRQLSCPGGE  17938

Query  206    HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265
              HAISSDDIFW +K EPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFD+DMAN
Sbjct  17937  HAISSDDIFW-RKTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMAN  17761

Query  266    KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
              +IG++M+ +S IEFIR  VP+SI KLENGQLLVKW + DGE+ EE FD+VLNATGRDPDV
Sbjct  17760  RIGDFMQDESKIEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDV  17581

Query  326    AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
              +KL LDKA V+LN KTGRI V NEQTSTPN++AIGDVIDAPELTPVAIQAGRLL+RRLYN
Sbjct  17580  SKLNLDKAGVQLNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYN  17401

Query  386    NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
              N T  MDYDK+CTAVFTPIEYGCCGLSEE +K++YGEDN+E+YH++F+PLEWSLS++ R 
Sbjct  17400  NETTLMDYDKVCTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQD-RV  17224

Query  446    AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              AA +CY+KVICDKTRDK+VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHP
Sbjct  17223  AANTCYVKVICDKTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHP  17053

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/490 (80%), Positives = 432/490 (88%), Gaps = 7/490 (1%)
 Frame = +1

Query  37      YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
               YDYDL+VIGGGSGGLACSKEA+ +G+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLM
Sbjct  104563  YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  104742

Query  97      HQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
               HQSSLIGE +H D+  FGW +        TF W Q++ +V+ YI+ INFKYKVELR K V
Sbjct  104743  HQSSLIGETIHKDAKAFGWTVGE-----QTFDWSQMLKSVNSYIKSINFKYKVELRDKKV  104907

Query  157     KYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWM  216
               KYEN LGSFVDAHTLELWHP+KGTK +TTRDVVIAVGGRPK L+C GG+ AISSDDIFW 
Sbjct  104908  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-  105084

Query  217     KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  276
               +K+ PGKTLVVGASYVALECAGF+KGMGYDVK+MVRSILLRGFDQDMANKIGE+ME +S 
Sbjct  105085  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESK  105264

Query  277     IEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVK  336
               IEFIR  VPQSITKLE+GQLLVKW + DGE+CEEAFDTVLNATGRDPDVAKLGLDK  VK
Sbjct  105265  IEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVK  105444

Query  337     LNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKI  396
               LN KTGRI V NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLL+RRLYNN TA MDYDK+
Sbjct  105445  LNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKV  105624

Query  397     CTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVIC  456
               CTAVFTPIEYGCCGLSEE S E+YGE+N+E+YH+NF PLEWSLS + R AA SCY+KVIC
Sbjct  105625  CTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCYVKVIC  105801

Query  457     DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPttaetfttleitKS  516
               D  R+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYDQMV+ VGIHPTTAE FTTLE+TKS
Sbjct  105802  DTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKS  105981

Query  517     SggtttgggC  526
               SG +   GGC
Sbjct  105982  SGESAASGGC  106011

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/476 (79%), Positives = 417/476 (88%), Gaps = 8/476 (2%)
 Frame = +3

Query  27     PSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCV  86
              P  VD+ E +YDYDLVVIGGGSGGLACSKEAA  G+KV VLDYVKPSP GT+WGLGGTCV
Sbjct  18348  PMDVDD-EATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCV  18524

Query  87     NVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFK  146
              NVGCIPKKLMHQS+L+GELMH D+  FGW        A +F+W QLVA+V+ YI+GINFK
Sbjct  18525  NVGCIPKKLMHQSALLGELMHKDAPAFGWTTG-----AQSFTWTQLVASVNNYIKGINFK  18689

Query  147    YKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEH  206
              YKVELR K VKYENFLGSFVDAHT+ELWH +K  K +TTR VVIAVGGRP+ LTCPGGEH
Sbjct  18690  YKVELRDKKVKYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEH  18869

Query  207    AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANK  266
              AISSDDIFW +K EPGKTLVVGASYVALECAGFLKGMGYDVK+MVRSILLRGFDQDMAN+
Sbjct  18870  AISSDDIFW-RKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANR  19046

Query  267    IGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVA  326
              IG++M+ +S IEFIR  VP+SI K ENG+LLVKW + DG+  EE FDTVLNATGRDPDV 
Sbjct  19047  IGDFMQDESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVT  19226

Query  327    KLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  386
              KL LDKA V+LN K+GRI   NEQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+RRLYNN
Sbjct  19227  KLNLDKAGVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN  19406

Query  387    STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
               T  MDYDKICTAVFTPIEYGCCGLSEED+K +YGE+N+E+YH++F+PLEWSLSEE R A
Sbjct  19407  ETTLMDYDKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEE-RVA  19583

Query  447    AESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              A +CY+KVICDKTRDK VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHP
Sbjct  19584  AATCYVKVICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHP  19751

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/499 (77%), Positives = 433/499 (87%), Gaps = 7/499 (1%)
 Frame = -2

Query  28    SAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  87
             + V +   +YDYDL+VIGGGSGGLACSKEAA +G+KVCVLDYVKPSP GT+WGLGGTCVN
Sbjct  8856  APVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVN  8677

Query  88    VGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKY  147
             VGCIPKKLMHQSSLIGE +H D+A FGW++         F W Q++ +V+ YI+ INFKY
Sbjct  8676  VGCIPKKLMHQSSLIGETIHKDAAAFGWSVGE-----QKFDWAQMLKSVNSYIKSINFKY  8512

Query  148   KVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  207
             KVELR K VKYEN LGSFVDAHTLELWHP+KGTK +TTRDVVIAVGGRPK L+C GGE A
Sbjct  8511  KVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELA  8332

Query  208   ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267
             ISSDDIFW +K+ PGKTLV+GASYVALECAGF+KGMGYDVK+MVRSILLRGFDQDMA+KI
Sbjct  8331  ISSDDIFW-RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKI  8155

Query  268   GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
             GE+MEV+S IEFIR  VPQSITKLE+GQLLVKW + DG+ CEEAFDTVLNATGRDPDVAK
Sbjct  8154  GEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAK  7975

Query  328   LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
             L LD   V+LN KTGRI V NEQTS PNI+AIGDVIDAPELTPVAIQAGR+L+RRLYNN 
Sbjct  7974  LNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNE  7795

Query  388   TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
             TA MDYDK+CTAVFTPIEYGCCGLSEE S E++GED +E+YH+NF PLEWSLS + R AA
Sbjct  7794  TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAA  7618

Query  448   ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPttaet  507
              SCY+KVICD TR+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYD MV+ VGIHPTTAE 
Sbjct  7617  GSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEI  7438

Query  508   fttleitKSSggtttgggC  526
             FTTLE+TKSSG +   GGC
Sbjct  7437  FTTLEVTKSSGESAAAGGC  7381

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/489 (79%), Positives = 429/489 (88%), Gaps = 5/489 (1%)
 Frame = +3

Query  38    DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
             DYDLVVIGGGSGGLACSKEA+ FGQKV VLDYVKPSPQGT WGLGGTCVNVGCIPKKLMH
Sbjct  4218  DYDLVVIGGGSGGLACSKEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMH  4397

Query  98    QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
             QS+LIGE+MH D+A FGW   +A      F W QL ++V  YI+ +NFKYKV+LR K VK
Sbjct  4398  QSALIGEVMHKDAALFGWQFENA----PKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVK  4565

Query  158   YENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMK  217
             YENFLG+FVD HT+EL +PRK +K +TTR VV+AVGGRP+ L CPGGE +I+SDDIFW +
Sbjct  4566  YENFLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFW-R  4742

Query  218   KKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGI  277
             K  PGKTLVVGASYVALECAGFLKG GYDVKVMVRSILLRGFDQDMAN+IGEYMEV++GI
Sbjct  4743  KTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGI  4922

Query  278   EFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL  337
             EFIR+TVP SITKLE+G+LLVKWT  DG + EEAFDTVLNATGR+PDV KL LDKA VKL
Sbjct  4923  EFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKL  5102

Query  338   NEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKIC  397
             N KTGRI V NEQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+RRLYNN T  MDY+K+C
Sbjct  5103  NPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVC  5282

Query  398   TAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICD  457
             TAVFTPIEYGCCGLSEE+S ER+GEDNIEVYH+NF PLEW+LS++TR +  +CYLKVICD
Sbjct  5283  TAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICD  5462

Query  458   KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPttaetfttleitKSS  517
             KTRD FVVGFHYLGPNAGEVTQA+GLAMKLGFTY+QMV  VGIHPTTAETFTTLE+TKSS
Sbjct  5463  KTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSS  5642

Query  518   ggtttgggC  526
             G +  GG C
Sbjct  5643  GASAAGGNC  5669

>APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.18:1:978767:1 
REF
Length=978767

 Score = 667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/504 (65%), Positives = 389/504 (77%), Gaps = 18/504 (4%)
 Frame = +1

Query  1       MAKLRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF  60
               +A  R   Q +      +  IH   T     +A+  YD+DLVVIGGGSGGLACSKEA+  
Sbjct  945454  LAFFRARTQSAPSAPASSASIHANDT----SDADVKYDWDLVVIGGGSGGLACSKEASKL  945621

Query  61      GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA  120
               GQKV VLDYVKPSP G++WGLGGTCVNVGCIPKKLMHQSS+IGE++H D+  FGW++++A
Sbjct  945622  GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNA  945801

Query  121     DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWH--PRK  178
                    TF W +LV++V  YI G+NFKY+V+LR K VKYEN LG+F DAHTL L +   +K
Sbjct  945802  -----TFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKK  945966

Query  179     GTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAG  238
               G   +T R  VIAVGGRPK L+CPG EHA+SSDDIF  K   PGKTLVVGASYVALECAG
Sbjct  945967  GPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAG  946143

Query  239     FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLV  298
               FLKG G+DV +MVRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KLENGQ  V
Sbjct  946144  FLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQV  946323

Query  299     KWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYA  358
                 TT      ++ +DT+LNATGR PDV KL LD A V LN K+GRI V NEQTSTPNIYA
Sbjct  946324  THTTG-----QDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYA  946488

Query  359     IGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKE  418
               +GDVIDAPELTPVAIQAG+LLSRRL+ N T  MDY KICTAVFTP+EYGCCGLSEED+  
Sbjct  946489  LGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIA  946668

Query  419     RYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
                 G +N+EVYH+NF PLEWSLS + R  A+ CY K+I D T+ K V+GFHYLGPNAGEVT
Sbjct  946669  SAGRENVEVYHQNFTPLEWSLSHD-RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVT  946845

Query  479     QAMGLAMKLGFTYDQMVDTVGIHP  502
               QA+G+A+KL  TYD  ++TVGIHP
Sbjct  946846  QAIGIAIKLNATYDDFINTVGIHP  946917

>APIN:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.18:1:1130244:1 
REF
Length=1130244

 Score = 662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/471 (70%), Positives = 377/471 (80%), Gaps = 14/471 (3%)
 Frame = -2

Query  34     ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
              ET YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKPSP G++WGLGGTCVNVGCIPK
Sbjct  69209  ETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  69030

Query  94     KLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRS  153
              KLMHQSS+IGEL+H D+  FGW +++A     +F W +LV++V  YI G+NFKY+++LR 
Sbjct  69029  KLMHQSSIIGELLHKDAEQFGWTVSNA-----SFDWTKLVSSVQDYIHGLNFKYRIDLRD  68865

Query  154    KYVKYENFLGSFVDAHTLELWH--PRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSD  211
              K VKYEN LG+F DAHTL L +   +KG   +T R  VIAVGGRPK L+CPG EHAISSD
Sbjct  68864  KKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSD  68685

Query  212    DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYM  271
              DIF  K + PGKTLVVGASYVALECAGFLKG G+DV +MVRSILLRGFDQD+A +IGEYM
Sbjct  68684  DIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYM  68508

Query  272    EVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLD  331
              E +SGI FI+++VP SI KL NGQL V  T  +G      +DTVLNATGR PDV  L L 
Sbjct  68507  ENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLP  68343

Query  332    KARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQM  391
               A V LN K+GRI V NEQTSTP+IYAIGDVIDAPELTPVAIQAG+LL+RRL+ N TA M
Sbjct  68342  AAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALM  68163

Query  392    DYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCY  451
              DY KICTAVFTP+EYGCCGLSEED+    G DNI+VYH+NF PLEWSLS E R  A+ CY
Sbjct  68162  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-RPLAKECY  67986

Query  452    LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               K+I D T+ K VVGFHYLGPNAGEVTQA+G+AMKL  TYD  V+TVGIHP
Sbjct  67985  AKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHP  67833

>SAPA:scaffold_113 supercont2.113 dna:supercontig supercontig:ASM15154v2:supercont2.113:1:101906:1 
REF
Length=101906

 Score = 618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 371/475 (78%), Gaps = 15/475 (3%)
 Frame = -2

Query  30     VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
              VD+  T YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKPSPQG++WGLGGTCVNVG
Sbjct  87958  VDDGAT-YDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVG  87782

Query  90     CIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKV  149
              CIPKKLMHQS+++GEL+H D+  FGW + +A     TF W +LV +V  YI G+NFKY+V
Sbjct  87781  CIPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLVTSVQDYIHGLNFKYRV  87617

Query  150    ELRSKYVKYENFLGSFVDAHTLELWHPRKG--TKQITTRDVVIAVGGRPKELTCPGGEHA  207
              +LR K VKYENFLG+F DAHTL L +P KG   K +T R  +IAVGGRPK L CPG + A
Sbjct  87616  DLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLA  87437

Query  208    ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267
              ISSDDIF  +   PGKTLVVGASYVALECAGFLK  G+DV VMVRSILLRGFD DMA +I
Sbjct  87436  ISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAARI  87260

Query  268    GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
              G YME ++ I+FI+  VP SI +L NGQL V  T  +G      +DTVLNATGR+PDV+ 
Sbjct  87259  GTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-----IYDTVLNATGRNPDVSG  87095

Query  328    LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
              L L  A V LN KTGRI V +EQTS P+IYA+GDVID PELTPVAIQAGRLL++RL++NS
Sbjct  87094  LNLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNS  86915

Query  388    TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
                 M YDK+CTAVFTPIEYGCCGLSE+ + E  G DN+ VYH++F PLEWSLS + R  A
Sbjct  86914  ATLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHD-RALA  86738

Query  448    ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              + CY K+I D+T++  VVGFHYLGPNAGEVTQA+G+AMKL  +YD  V TVGIHP
Sbjct  86737  KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHP  86573

>SADI:scaffold_150 supercont1.150 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.150:1:81170:1 
REF
Length=81170

 Score = 618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 371/475 (78%), Gaps = 15/475 (3%)
 Frame = -3

Query  30    VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
             VD+  T YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKPSPQG++WGLGGTCVNVG
Sbjct  9963  VDDGAT-YDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVG  9787

Query  90    CIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKV  149
             CIPKKLMHQS+++GEL+H D+  FGW + +A     TF W +L+ +V  YI G+NFKY+V
Sbjct  9786  CIPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLITSVQDYIHGLNFKYRV  9622

Query  150   ELRSKYVKYENFLGSFVDAHTLELWHPRKG--TKQITTRDVVIAVGGRPKELTCPGGEHA  207
             +LR K VKYENFLG+F DAHTL L +P KG   K +T R  +IAVGGRPK L CPG + A
Sbjct  9621  DLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLA  9442

Query  208   ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267
             ISSDDIF  +   PGKTLVVGASYVALECAGFLKG G+DV VMVRSILLRGFD DMA +I
Sbjct  9441  ISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARI  9265

Query  268   GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
             G YME ++ I FI+  VP SI +L NGQL V  T  +G      +DTVLNATGR PDV+ 
Sbjct  9264  GTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSG  9100

Query  328   LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
             L L  A V LN KTGRI V +EQTSTP+IYA+GDVID PELTPVAIQAGRLLS+RL++NS
Sbjct  9099  LNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNS  8920

Query  388   TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
                M YDK+CTAVFTPIEYGCCGLSE+ + E  G DN+ VYH++F PLEWSLS + R  A
Sbjct  8919  ATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALA  8743

Query  448   ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             + CY K+I D+T++  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+  V TVGIHP
Sbjct  8742  KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHP  8578

>SAPA:scaffold_10 supercont2.10 dna:supercontig supercontig:ASM15154v2:supercont2.10:1:790954:1 
REF
Length=790954

 Score = 403 bits (1036),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 308/487 (63%), Gaps = 29/487 (6%)
 Frame = +1

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK
Sbjct  668014  SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  668193

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
               +MH S ++G  + HD+A+ GW +          +W+ LV  V  +++ +NF Y+V LRS 
Sbjct  668194  IMHYSGILGAGL-HDAAHLGWQVP----EKVEHNWETLVEAVQAHVKKLNFSYRVGLRSN  668358

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPK-ELTCPG-GEHAISSDD  212
                V+Y N L  F D HTL        T+ +T   ++IA GGRP      PG  E+AI+SDD
Sbjct  668359  KVQYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDD  668538

Query  213     IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYME  272
               +F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M 
Sbjct  668539  LFSLSTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-  668712

Query  273     VQSGIEFIRKTVPQSITKLE-NGQLLVKW-TTEDGESCEEAFDTVLNATGRDPDVAKLGL  330
               V  G++F   T+P SI K E  GQL V +  +E  E+  EAFDTVL A GR  D   +GL
Sbjct  668713  VAQGMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGL  668892

Query  331     DKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLSRRLYN-NST  388
               +KA VK     G+    NE T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N T
Sbjct  668893  EKAGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYT  669069

Query  389     AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAE  448
                 M+YD I T VFTP+EYG  GLSEE++  RYG+D+I VY   F  LEW      R  AE
Sbjct  669070  KTMNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVH--RKKAE  669243

Query  449     S-------------CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
               S             C  K++C K+ ++ V+GFH++GPNAGEVTQ   +A+ +G T +   
Sbjct  669244  SAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFD  669423

Query  496     DTVGIHP  502
               + +GIHP
Sbjct  669424  NVIGIHP  669444

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 59/127 (46%), Gaps = 18/127 (14%)
 Frame = +3

Query  4       LRLSIQESALNTKKNMQIHDPSTPSAVDEAETSY----DYDLVVIGGGSGGLACSKEAAS  59
               ++LS   S++ TK   + H  S   A   A T+     +YDLVVIG G   + C+ E+  
Sbjct  755499  VQLSPDASSMLTKLTRRPHLRSL--AARHATTASLQLKEYDLVVIGSGPSAVQCAIESVK  755672

Query  60      FGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIAS  119
                G+ V V+D           G+GG CV+ G IP K   +S L      H     G+   +
Sbjct  755673  KGKTVAVID--------KKAGIGGVCVHTGTIPSKTFRESVLHLSGFRHQ----GYAPPA  755816

Query  120     ADGSAST  126
               A  SAS+
Sbjct  755817  ASRSASS  755837

>SADI:scaffold_71 supercont1.71 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.71:1:282769:1 
REF
Length=282769

 Score = 401 bits (1031),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 234/489 (48%), Positives = 310/489 (63%), Gaps = 33/489 (7%)
 Frame = +2

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK
Sbjct  165125  SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  165304

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
               +MH S ++G  + HD+A+ GW +          +W+ LV  V  +++ +NF Y+V LRS 
Sbjct  165305  IMHYSGILGAGL-HDAAHLGWQLP----EKVEHNWETLVETVQAHVKKLNFSYRVGLRSN  165469

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR---PKELTCPG-GEHAISS  210
                V+Y N L  F D HTL        T+ +T   ++IA GGR   PKE+  PG GE+AI+S
Sbjct  165470  KVQYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEI--PGVGEYAITS  165643

Query  211     DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  270
               DD+F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + 
Sbjct  165644  DDLFSLTTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDI  165820

Query  271     MEVQSGIEFIRKTVPQSITKLE-NGQLLVKW-TTEDGESCEEAFDTVLNATGRDPDVAKL  328
               M V  G++F   T+P SI K +  GQL V +  +E  E+  E FDTVL A GR  D   +
Sbjct  165821  M-VAQGMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNI  165997

Query  329     GLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLSRRLYN-N  386
               GL+K  VK     G+    NE T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N
Sbjct  165998  GLEKVGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPN  166174

Query  387     STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
                T  M+YD I T VFTP+EYG  GLSEE++  RYG+D++ VY   F  LEW      R  
Sbjct  166175  YTKTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVH--RQK  166348

Query  447     AES-------------CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  493
               AES             C  K++C K+ ++ V+GFH++GPNAGEVTQ   +A+ +G T + 
Sbjct  166349  AESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKED  166528

Query  494     MVDTVGIHP  502
                 + +GIHP
Sbjct  166529  FDNVIGIHP  166555

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 8/64 (13%)
 Frame = +3

Query  38      DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
               +YDLVVIG G   + C+ E+   G+ V V+D           G+GG CV+ G IP K   
Sbjct  252786  EYDLVVIGSGPSAVQCAIESVKKGKTVAVIDK--------KAGIGGVCVHTGTIPSKTFR  252941

Query  98      QSSL  101
               +S L
Sbjct  252942  ESVL  252953

>SADI:scaffold_9 supercont1.9 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.9:1:1129835:1 
REF
Length=1129835

 Score = 246 bits (629),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 165/483 (34%), Positives = 245/483 (51%), Gaps = 33/483 (7%)
 Frame = -1

Query  39      YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
               YD +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  433205  YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  433035

Query  99      SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
               ++L  E++H   A     +   D     F W  + A  D Y++ +N  Y   +    V  
Sbjct  433034  AALHAEMLHSARAYAFKGV--QDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  432861

Query  159     ENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  218
                     FVD HT+E+   R   K I     +IAVGG P     PG EHAISSD  F + +
Sbjct  432860  VMGAAKFVDNHTVEVNGDRYAAKHI-----LIAVGGVPAMPPLPGIEHAISSDGFFAL-E  432699

Query  219     KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD---QDMANKIGEYMEV-  273
                +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD   +D+ N   E  ++ 
Sbjct  432698  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEMEQYDLL  432519

Query  274     ------------QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGR  321
                            +G+ F+R++   SI K E+G L ++ T          F+TVL A GR
Sbjct  432518  LDIATCS***MDSAGVRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGR  432339

Query  322     DPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLS  380
                P    LGL+   + L+          E T+ PN++A+GDV     ELTPVAI AGR L+
Sbjct  432338  TPRTHDLGLETTDIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLA  432159

Query  381     RRLYNNS-TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSL  439
                RL+ N   A ++Y +I T VF+    G  GL+E  +  +YG  N+  +  +F  + +++
Sbjct  432158  DRLFGNEPNACVNYHQIPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAM  431979

Query  440     SEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  499
               S E      +  +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V 
Sbjct  431978  SAEKDKVQTA--MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVA  431808

Query  500     IHP  502
               IHP
Sbjct  431807  IHP  431799

 Score = 246 bits (627),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 170/487 (35%), Positives = 254/487 (52%), Gaps = 33/487 (7%)
 Frame = +1

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               T+  YD +VIGGGSGG + ++ AA++G KV V++           G+GGTCVNVGC+PKK
Sbjct  433942  TTTTYDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKK  434112

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
               +M  +++  E++H   A    NI   D    +F W  L    D Y+  +N  Y+  L + 
Sbjct  434113  VMFNAAMHAEMLHSAHAYTFKNI--QDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNN  434286

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
                +        FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD  F
Sbjct  434287  KIPLIYGAAKFVDNHTIEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFF  434451

Query  215     WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD---QDMANKIGEY  270
                + + +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD   +D+ N   E 
Sbjct  434452  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEMEQ  434628

Query  271     MEV-------------QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLN  317
                ++              +G+ F+R++   SI K E+G L ++ T          F+TVL 
Sbjct  434629  YDILIDIATCS***MDSAGVRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLF  434808

Query  318     ATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAG  376
               A GR P    LGL+   + L+          E T+ PN++A+GDV     ELTPVAI AG
Sbjct  434809  AIGRTPRTHDLGLETTDIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAG  434988

Query  377     RLLSRRLYNNS-TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPL  435
               R L+ RL+ N   A ++Y +I T VF+    G  GL+E  + E+YG  N++VY   F  +
Sbjct  434989  RRLADRLFGNEPNACVNYHQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNM  435168

Query  436     EWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
                +++SE+     +   +K++C    ++ V+G H  G  A E+ Q  G+A+K+G       
Sbjct  435169  FYAMSEQDEK--QKTAMKLMC-IGEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFD  435339

Query  496     DTVGIHP  502
               + V IHP
Sbjct  435340  NIVAIHP  435360

>PHPA:scaffold_21 NW_008649007.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.21, whole genome shotgun 
sequence
Length=1058518

 Score = 243 bits (619),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 172/472 (36%), Positives = 253/472 (54%), Gaps = 19/472 (4%)
 Frame = -1

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               T   YD +VIGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  277939  TDVVYDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  277769

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
               +M  ++   E ++ +  ++  N AS D     F W  +    D YI+ +N  Y+  L + 
Sbjct  277768  VMFNTAAHVEHLNRNK-DYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNA  277592

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
                V +   +   V    +E+       +  T + V++A GG P     PG EH I SD  F
Sbjct  277591  KVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFF  277427

Query  215     WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
                +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  277426  KLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-  277253

Query  274     QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
               ++G++F+R +    + K ENG+L    T    E     FDT++ A GR+P    LGL++ 
Sbjct  277252  KAGVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEI  277073

Query  334     RVKLNEKTGRIWV-KNEQTSTPNIYAIGD-VIDAPELTPVAIQAGRLLSRRLYNNST-AQ  390
                VKL+E  G I V   E TS P +YAIGD  +   ELTPVAI AGR LS RL+     A 
Sbjct  277072  GVKLSEG-GFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDAC  276896

Query  391     MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
               ++Y +I T +F+    G  G +E ++  +YGE+NI+VY   FV L  S+++  R    + 
Sbjct  276895  LNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTAM  276716

Query  451     YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                L  + +K   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  276715  KLVTVGEK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  276569

>PYAP:scaffold_739 pag1_scaffold_739 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_739:1:14927:1 
REF
Length=14927

 Score = 242 bits (618),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 169/472 (36%), Positives = 249/472 (53%), Gaps = 19/472 (4%)
 Frame = -2

Query  35    TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
             T   YD VVIGGGSGG+A ++ AA++G KV +++  +        GLGGTCVN GC+PKK
Sbjct  1654  TDMVYDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKK  1484

Query  95    LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
             +M  ++   E +  +  ++  N A        F W  +    D YI  +N  Y+  + + 
Sbjct  1483  VMFNAAAHVEHLARNG-DYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNA  1307

Query  155   YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
              +     + + V ++ +E+       K  T + V++AVGG P     PG EHAI SD  F
Sbjct  1306  GIDLVQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFF  1142

Query  215   WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
              ++  +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME 
Sbjct  1141  KLES-QPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-  968

Query  274   QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
             + G+ F+R++  + I K  +G+L +    +  +   E FD VL A GR+P    LGLDKA
Sbjct  967   KHGVNFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKA  788

Query  334   RVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQ  390
              VKLN+  G I V   E TS P +YAIGD      ELTPVAI AGR L+ RL+ N   A 
Sbjct  787   GVKLNDG-GFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDAC  611

Query  391   MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
             + Y +I T VF+    G  G +E ++  ++G D ++VY   FV L  S+++       + 
Sbjct  610   LHYHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTAM  431

Query  451   YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              L  + D   D+ VVG H  G  A E+ Q  G+AMK+  T     + V IHP
Sbjct  430   KLVCVGD---DEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHP  284

>PHCA:scaffold_8 PHYCAscaffold_8
Length=1194346

 Score = 241 bits (615),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 169/472 (36%), Positives = 253/472 (54%), Gaps = 19/472 (4%)
 Frame = +2

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               T   YD +VIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  676616  TDVVYDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  676786

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
               +M  ++   E ++ +  ++  N A  +     F W  +    D YI+ +N  Y+  L + 
Sbjct  676787  VMFNTAAHVEHLNRNK-DYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNA  676963

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
                V +   +   V    +++     G K  T + V++A GG P     PG E+ I SD  F
Sbjct  676964  NVDHVQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFF  677128

Query  215     WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
                +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  677129  KLEQ-QPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-  677302

Query  274     QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
               ++G++F+R      + K +NG+L    T    E     FDT+L A GR+P    LGL++ 
Sbjct  677303  KAGVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEV  677482

Query  334     RVKLNEKTGRIWVK-NEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQ  390
                VKL+E  G I V   E TS P +YAIGD  +   ELTPVAI AGR LS RL+     A 
Sbjct  677483  GVKLSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDAC  677659

Query  391     MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
               ++Y +I T +F+    G  G +E ++ E+YGE+N++VY   FV L  S+++  R    + 
Sbjct  677660  LNYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTAM  677839

Query  451     YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                L  + +K   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  677840  KLVTVGEK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  677986

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 106/234 (45%), Gaps = 34/234 (15%)
 Frame = +1

Query  183     ITTRDVVIAVGGRP-KELTCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGF  239
               +T    ++ VG RP +    P  GE    SD + W K K  P + ++VGA  V +E A  
Sbjct  170890  LTADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASM  171069

Query  240     LKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLL  297
               +  + G DV V+  R  +L   D++++  +  Y   Q+G  F+     +S+ K   G++ 
Sbjct  171070  MTIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEVF  171246

Query  298     VKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNI  356
               V    E G++     D +L   GR  +V  L L+   ++  +K GRI V N  QT+ P++
Sbjct  171247  VHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLE-PDKRGRIKVDNNFQTAVPHM  171411

Query  357     YA----------------------IGDVIDAPELTPVAIQAGRLLSRRLYNNST  388
               YA                       GD+I  P L   +++ GRL S  +  + T
Sbjct  171412  YARVIVHK*VQGLTAMFLCWDSYAAGDIIGFPGLASTSMEQGRLASVHMRTSKT  171573

 Score = 44.3 bits (103),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 35/67 (52%), Gaps = 8/67 (12%)
 Frame = +2

Query  29      AVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNV  88
               A+ E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            +GG CV+ 
Sbjct  170282  ALRELRASEHFDLIVIGSGPAGQKCAIDSAKSGKSVAIIDKRD--------MMGGVCVHT  170437

Query  89      GCIPKKL  95
               G +P K+
Sbjct  170438  GTVPSKV  170458

 Score = 37.0 bits (84),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 5/65 (8%)
 Frame = -1

Query  4       LRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQK  63
               L L+     L+T +N  + D     A+ E   S  +DL+VIG G  G  C+ ++A  G+ 
Sbjct  936817  LLLAAFAPPLSTTQNKPLTD-----ALHELRASEHFDLIVIGSGPAGQKCAIDSAKCGKS  936653

Query  64      VCVLD  68
               V ++D
Sbjct  936652  VSIID  936638

>PYAP:scaffold_510 pag1_scaffold_510 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_510:1:23801:1 
REF
Length=23801

 Score = 241 bits (614),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 165/497 (33%), Positives = 261/497 (53%), Gaps = 52/497 (10%)
 Frame = -1

Query  39    YDLVVIGGGSGGLACSKEAASFGQ-KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
             YD +VIG GSGG+A S+ AA++   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  4085  YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  3933

Query  98    QSSLIGELMHHDSANFGWNIASADGSA--STFSWKQLVANVDGYIRGINFKYKV--ELRS  153
              ++ +G  +H D  ++G+     +  A  + F WK+L    D Y+  +N  Y     +R 
Sbjct  3932  LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGR*DSMRM  3753

Query  154   KYVKYE------NFLGSFVDAHTLELWHPRKGT-------------KQITTRDVVIAVGG  194
               +         +F+ S +D   ++L+   +GT             K+I  ++V+IAVGG
Sbjct  3752  DMIDTRKA*WPCSFVCSNLDNSKVDLF---RGTATFNAKGNVEVDGKEIAAKNVLIAVGG  3582

Query  195   RPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  254
             +P     PG EH I SD  F + +++P K  VVGA Y+A+E AG L G+G D  +  R  
Sbjct  3581  KPLIPDIPGKEHCIDSDGFFEL-EEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKE  3405

Query  255   -LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFD  313
              +LRGFD+ +   + + M  + G+     +    + K  +G   +     DG S    FD
Sbjct  3404  GVLRGFDELIRTTLHDAM-AKEGVNLRPHSSVTKVIKAADGTKTL--VLADG-SEHSGFD  3237

Query  314   TVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTP--NIYAIGDVIDAPELTPV  371
             +V+ A GR P    L L+ A ++ ++  G I +   Q +T   NI+A+GDV   P LTPV
Sbjct  3236  SVIYAAGRVPLTESLNLEAAGIETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPV  3060

Query  372   AIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHK  430
             AI AGR L+ RL+     A+  Y+ I T VF+    G  GL+E+ ++ ++G+D I+VY  
Sbjct  3059  AIAAGRRLADRLFGGMKDAKASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTS  2880

Query  431   NFVPLEWSLSEE-----TRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAM  485
              FV + + +  E      +       +K++C + +D+ VVG H +G  A E+ Q  G+A+
Sbjct  2879  RFVNMHYGIINEFGEDGQQKPKPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAV  2703

Query  486   KLGFTYDQMVDTVGIHP  502
             K+G T       V IHP
Sbjct  2702  KMGATKADFDSCVAIHP  2652

>PYAR:scaffold_544 par_scaffold_544 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_544:1:16696:1 
REF
Length=16696

 Score = 240 bits (613),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 169/523 (32%), Positives = 264/523 (50%), Gaps = 77/523 (15%)
 Frame = +1

Query  38    DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
             +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  2074  EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIM  2226

Query  97    HQSSLIGELMHHDSANFGWNIASADG---SASTFSWKQLVANVDGYIRGINFKYK-----  148
             + ++ +G L+H D  ++G+      G     + F W +L    D Y+  +N  Y+     
Sbjct  2227  YLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERYVPD  2406

Query  149   --------------------------------------VELRSKYVKYENFLGSFVDAHT  170
                                                   VE+  K +  +N L +      
Sbjct  2407  NESDWFTS**CGMECGRNLGNSKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXN  2586

Query  171   LELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGAS  230
              +      G K+I+ ++V+IAVGG+P     PG EH I SD  F +++  P K  VVGA 
Sbjct  2587  AQGNVEVDG-KEISAKNVLIAVGGKPLIPNIPGKEHCIDSDGFFELEEM-PKKVAVVGAG  2760

Query  231   YVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSIT  289
             Y+A+E AG L G+G D  +  R   +LRGFD+ + + + + M+ + G++    ++   +T
Sbjct  2761  YIAVELAGVLHGLGSDTTIFCRKDGVLRGFDELIRSTLHDAMD-KDGLKLRPHSLVAKVT  2937

Query  290   KLENGQ--LLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVK  347
             K  +G   L+++  TE        FDTV+ A GR P    L L+ A V+ + + G I + 
Sbjct  2938  KQADGTKTLVLQDGTE-----HAGFDTVIYAAGRVPLTQSLNLEGAGVETDAQ-GFIKID  3099

Query  348   NEQTSTP--NIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPI  404
               Q +T   NI+A+GDV   P LTPVAI AGR LS RL+     A+M Y+ I T VF+  
Sbjct  3100  EYQRTTAKKNIFAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHP  3279

Query  405   EYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES-----CYLKVICDKT  459
               G  GL+E++++ ++G+D ++VY   FV + + +  E     +        +K++C   
Sbjct  3280  PIGTVGLTEKEARAKHGDDAVKVYSSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGK  3459

Query  460   RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              +K VVG H +G  A E+ Q  G+A+K+G T       V IHP
Sbjct  3460  EEK-VVGVHLIGMAADEILQGFGVAVKMGATKADFDSCVAIHP  3585

>PHIF:NW_003303727.1 Phytophthora infestans T30-4 supercont1.32 
genomic scaffold, whole genome shotgun sequence
Length=1926061

 Score = 238 bits (607),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 167/468 (36%), Positives = 249/468 (53%), Gaps = 19/468 (4%)
 Frame = +2

Query  39      YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
               YD +VIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  581996  YDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  582166

Query  99      SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
               ++   E ++ +  ++  N AS D     F W  +    D YI+ +N  Y+  L +  V +
Sbjct  582167  AAAHVEHLNRNK-DYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKVDH  582343

Query  159     ENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  218
                  +   V    +E+       +  T + V++A GG P     PG EH I SD  F +++
Sbjct  582344  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFFKLEQ  582508

Query  219     KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  277
                +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  582509  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  582682

Query  278     EFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL  337
                F+R +    + K +NG+L    T +  E     FD+++ A GR P    LGL++  VKL
Sbjct  582683  NFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVGVKL  582862

Query  338     NEKTGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYD  394
                E  G I V   E TS   +YAIGD  +   ELTPVAI AGR LS RL+     A ++Y 
Sbjct  582863  AEG-GFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  583039

Query  395     KICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKV  454
               +I T +F+    G  G +E ++  +YGE+N++VY   FV L  S+++  R    +  L  
Sbjct  583040  QIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMKLVT  583219

Query  455     ICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               + DK   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  583220  VGDK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  583354

>PHSO:scaffold_13
Length=2041583

 Score = 237 bits (604),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 173/502 (34%), Positives = 261/502 (52%), Gaps = 21/502 (4%)
 Frame = +1

Query  5       RLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKV  64
               R +IQ++  ++ +  +   P   S +    T   YD VVIGGGSGG+A ++ AA++G KV
Sbjct  697549  RHTIQKAPKSSAR--KTPPPLFHSTLYRMSTDVVYDYVVIGGGSGGMASARRAATYGAKV  697722

Query  65      CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSA  124
                V   V+   +    GLGGTCVN GC+PKK+M  ++   E +  +  ++  N A+ D   
Sbjct  697723  LV---VERGREFEGMGLGGTCVNFGCVPKKVMFNAAAHVEHLARNK-DYSINTAAKDFEF  697890

Query  125     STFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQIT  184
                 F W  +    D YI+ +N  Y+  L +  V +   +   V    +E+       K  T
Sbjct  697891  GDFDWANMKTKRDAYIKRLNGIYERNLGNAQVDHVQGIAKLVAKDKVEV-----AGKVFT  698055

Query  185     TRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMG  244
                + V++A GG P     PG EH I SD  F + +++P K  VVGA Y+A+E AG    + 
Sbjct  698056  GKHVLVAPGGVPSVPDLPGMEHVIDSDGFFKL-EQQPKKVAVVGAGYIAVEMAGIFNVLK  698232

Query  245     YDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE  303
                D  +  R   +LR FD  + + + E ME ++G++F+R      + K  +G+L    T  
Sbjct  698233  SDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGVKFVRNMRAARVEKQADGKLTFVVTIN  698409

Query  304     DGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDV  362
                 E     FD +L A GR+P    LGL++  VKL+E  G I V   E TS P +YAIGD 
Sbjct  698410  GEEHKFPDFDAILYAVGREPRTKDLGLEEVGVKLSE-GGFIEVDAQENTSVPGVYAIGDA  698586

Query  363     -IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERY  420
                I   ELTPVAI AGR LS RL+     A ++Y +I T +F+    G  G +E ++  +Y
Sbjct  698587  TITGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIGTIGYTEPEAVAKY  698766

Query  421     GEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQA  480
               GE+N++ Y   FV L  S+++  R    +  L  + ++   + VVG H  G  A E+ Q 
Sbjct  698767  GEENVKCYTSKFVNLLHSMADPERKGKTAMKLVTVGEQ---ETVVGVHVAGEGADEMIQG  698937

Query  481     MGLAMKLGFTYDQMVDTVGIHP  502
                G+A+K+  T     + V IHP
Sbjct  698938  FGVAVKMNATKADFDNIVAIHP  699003

>PHRA:scaffold_75
Length=257998

 Score = 235 bits (600),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 169/483 (35%), Positives = 254/483 (53%), Gaps = 21/483 (4%)
 Frame = +1

Query  24      PSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGG  83
               PST       +  YDY  VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGG
Sbjct  120328  PSTTYLTMSTDVVYDY--VVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGG  120492

Query  84      TCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGI  143
               TCVN GC+PKK+M  ++   E +H +  ++    A+ D +   F W  +    D YI  +
Sbjct  120493  TCVNFGCVPKKVMFNAAAHVEHLHRNE-DYSIKTATRDFAFGDFDWANMKKKRDAYILRL  120669

Query  144     NFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  203
               N  Y+  L +  V +   + + V    +E+       K  T + V++A GG P     PG
Sbjct  120670  NGIYERNLGNAKVDHVQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPG  120834

Query  204     GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQD  262
                EH   SD  F +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  
Sbjct  120835  MEHVTDSDGFFRLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPI  121011

Query  263     MANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRD  322
               + + + + ME ++G++F+R T    + K ++G+L    T +  E     FD +L A GR+
Sbjct  121012  VRDLVNDEME-KAGVKFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGRE  121188

Query  323     PDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLS  380
               P    LGL+K  VKL +  G I V   E TS P +YAIGD      ELTPVAI AGR LS
Sbjct  121189  PRTKDLGLEKVGVKLADG-GFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLS  121365

Query  381     RRLYNNST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSL  439
                RL+     A ++Y +I T +F+    G  G +E ++  ++GE+N++VY   FV L  S+
Sbjct  121366  DRLFGGEKDACLNYHQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSM  121545

Query  440     SEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  499
               ++  R    +  L  + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V 
Sbjct  121546  ADPERKGKTAMKLVTVGEQ---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVA  121716

Query  500     IHP  502
               IHP
Sbjct  121717  IHP  121725

>HYAP:scaffold_87 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_87:1:280800:1 
REF
Length=280800

 Score = 230 bits (587),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 161/468 (34%), Positives = 250/468 (53%), Gaps = 21/468 (4%)
 Frame = -1

Query  39      YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
               YD +VIGGGSGG+A ++ AA++G KV V++  +   Q    GLGGTCVN GC+PKK+M  
Sbjct  122613  YDYIVIGGGSGGMASARRAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFN  122443

Query  99      SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
               ++    + H + A   ++I +A+ +   F W ++    D YI  +   Y+  L +  V +
Sbjct  122442  TA--AHVEHLNRAK-DYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDH  122272

Query  159     ENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  218
                  +  FV  + +++       +  T + V+IA GG P +   PG  H I SDD F + +
Sbjct  122271  VEGIAKFVAKNKVQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRL-E  122110

Query  219     KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  277
               ++P K  VVGA Y+A+E AG    +  D  +  R   +LR F+  + + + E ME ++G+
Sbjct  122109  QQPQKVAVVGAGYIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGV  121933

Query  278     EFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL  337
                F+R      + K  +G+L +     + E     FDT+L A GR P    LGL+   VKL
Sbjct  121932  TFVRNMSAVGVEKQLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKL  121753

Query  338     NEKTGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYD  394
                E  G I V   E TS P +YAIGD  +   ELTPVAI AGR L+ RL+     A ++Y 
Sbjct  121752  AEG-GFIQVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYH  121576

Query  395     KICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKV  454
               +I + +F+    G  G +E ++  +YGE+N++VY   FV L  S+++       +  L  
Sbjct  121575  QIPSVIFSHPPIGTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVT  121396

Query  455     ICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  121395  VGEQ---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  121261

>PLHA:NW_020187271.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_350, whole genome shotgun sequence
Length=864042

 Score = 226 bits (577),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 167/489 (34%), Positives = 254/489 (52%), Gaps = 22/489 (4%)
 Frame = +3

Query  20      QIHDPST--PSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGT  77
               + H P +  P  VD + T   YD +VIGGGSGG+A ++ AA+ G KV V   V+   +  
Sbjct  415251  KFHKPQSFAPLPVDMS-TDMVYDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFD  415418

Query  78      SWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVD  137
                 GLGGTCVN GC+PKK+M  +++  E ++ +  ++  N  + D     F W  +    D
Sbjct  415419  GMGLGGTCVNFGCVPKKVMFNTAVHVEHLNRNK-DYSINTCAKDFEFGDFDWANMKTKRD  415595

Query  138     GYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPK  197
                YI+ +N  Y+  L +  V     +   V    +++          T + V++A GG P 
Sbjct  415596  AYIQRLNGIYERNLSNAQVDVIQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPN  415760

Query  198     ELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILL  256
                   PG EH I SD  F + +++P K  VVGA Y+A+E AG    +  D  +  R   +L
Sbjct  415761  IPDIPGKEHVIDSDGFFKL-EQQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVL  415937

Query  257     RGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVL  316
               R FD  + + + E ME ++G+EF+R      I K  + +L    T    E     FDT+L
Sbjct  415938  RKFDPIVRDLVNEEME-KAGVEFVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTIL  416114

Query  317     NATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQ  374
                A GR P    LGL++  VKL +  G I V   E T+ P +YAIGDV +   ELTPVAI 
Sbjct  416115  FAVGRVPRTKDLGLEEIGVKLADG-GYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIA  416291

Query  375     AGRLLSRRLYNNST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433
               AGR L+ RL+     A ++Y +I T +F+    G  G +E ++  R+G++NI++Y   FV
Sbjct  416292  AGRRLADRLFGGEKDACLNYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFV  416471

Query  434     PLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  493
                L  ++++  R    +  L  + +   ++ VVG H  G  A E+ Q  G+A+K+  T   
Sbjct  416472  NLLHAMADPERKGKTAMKLVTVGE---EETVVGVHVAGEGADEMIQGFGVAVKMNATKAD  416642

Query  494     MVDTVGIHP  502
                 + V IHP
Sbjct  416643  FDNIVAIHP  416669

>PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:pug:scf1117875582035:1:696189:1 
REF
Length=696189

 Score = 226 bits (576),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 160/479 (33%), Positives = 243/479 (51%), Gaps = 31/479 (6%)
 Frame = +1

Query  33      AETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSW---GLGGTCVNVG  89
               A+T YDY  +  G G   +A ++ AA++G KV V++      +G  +   GLGGTCVN G
Sbjct  427324  ADTVYDYIAIGGGSGG--MASARRAATYGAKVLVVE------RGRKYDGAGLGGTCVNYG  427479

Query  90      CIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKV  149
               C+PKK+M  ++   E +H + A++     +       F WK +    D YI  +N  Y+ 
Sbjct  427480  CVPKKVMFNAASHVEHLHRN-ADYSITTTTKPFEFGDFDWKNMKTKRDAYIARLNGIYER  427656

Query  150     ELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAIS  209
                L +  +     +   V    +E+          T + +++AVGG P     PG EH I 
Sbjct  427657  NLGNAQIDLVEGVAKLVAKDKVEV-----DGVVYTGKHILVAVGGVPSLPPIPGIEHVID  427821

Query  210     SDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD---QDMAN  265
               SDD F +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD   +D+ N
Sbjct  427822  SDDFFKLEE-QPKKVAVVGAGYIAIEIAGIFNALKSDTSLFCRFDHVLRTFDPIVRDLIN  427998

Query  266     KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
               + GE    ++GI F+R +  + I K  +G L +       E     F+ +L A GR+P  
Sbjct  427999  EEGE----KAGINFVRNSRIERIDKQADGTLQITAKVNGEEQVIGGFNQILYAIGREPRT  428166

Query  326     AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY  384
                 LGL++  VKLNEK   +    E TS   IYAIGD      ELTPVAI AGR LS RL+
Sbjct  428167  KDLGLEEVGVKLNEKGFIVVDAQENTSVSGIYAIGDATTTGWELTPVAIAAGRRLSDRLF  428346

Query  385     NNS-TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                    A + Y +I T VF+    G  G +E ++ E++G +N++ Y   FV L +++++  
Sbjct  428347  GGEPNACLHYHQIPTVVFSHPPLGTIGYTEPEAIEKFGAENVKTYSSKFVNLLYAMADPD  428526

Query  444     RTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                    +  L  + +   D+ VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  428527  HKGKTAMKLVTVGE---DEVVVGIHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  428694

>PHKE:scaffold_694 scf_22126_694.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_694.1:1:11588:1 
REF
Length=11588

 Score = 225 bits (573),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 167/488 (34%), Positives = 254/488 (52%), Gaps = 25/488 (5%)
 Frame = -3

Query  25    STPSAVDEAETSYD------YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTS  78
             + P A  EA TS        YD VVIGGGSGG+A ++ AA++G KV V   V+   +   
Sbjct  6165  TLPRAHSEARTSTRMSTDVVYDYVVIGGGSGGMASARRAATYGAKVLV---VERGRKYDG  5995

Query  79    WGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDG  138
              GLGGTCVN GC+PKK+M  +++  E +  +  ++  N A  D     F W  +    D 
Sbjct  5994  MGLGGTCVNYGCVPKKVMFNTAMHVEHLARNR-DYSINTAQRDFQFGDFDWSNMKTKRDA  5818

Query  139   YIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKE  198
             YI  +N  Y+  L+++ V +   +   V    +++       +  T +++++A GG P  
Sbjct  5817  YILRLNGIYERNLQNQQVDHVQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTI  5653

Query  199   LTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLR  257
                PG EH I SD  F +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR
Sbjct  5652  PDFPGNEHVIDSDGFFKLEQ-QPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLR  5476

Query  258   GFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLN  317
              FD  + + + E ME ++G++F+R +    + K  +G+L    T +  E     FDT+L 
Sbjct  5475  KFDPIVRDLVNEEME-KAGVKFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILY  5299

Query  318   ATGRDPDVAKLGLDKARVKLNEKTGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQA  375
             A GR P    LGL++  VKL++  G I V   E TS   +YAIGD      ELTPVAI A
Sbjct  5298  AVGRTPRTKDLGLEEINVKLSQD-GFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAA  5122

Query  376   GRLLSRRLYNNST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVP  434
             GR LS RL+     A ++Y +I T +F+    G CG +E ++ E++G++NI+ Y   FV 
Sbjct  5121  GRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVN  4942

Query  435   LEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  494
             L  S+++  R    +  L  + ++     V      G  A E+ Q  G+AMK+  T    
Sbjct  4941  LLHSMADPERKGKTAMKLVCVGEEEVVVGVH---VAGEGADEMIQGFGVAMKMNATKADF  4771

Query  495   VDTVGIHP  502
              + V IHP
Sbjct  4770  DNIVAIHP  4747

>SADI:scaffold_83 supercont1.83 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.83:1:225395:1 
REF
Length=225395

 Score = 135 bits (340),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 128/239 (54%), Gaps = 14/239 (6%)
 Frame = -3

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               T+YDY  +V+G GSGG++ +  A ++G KV V   V+   +    GLGGTCVNVGC+PKK
Sbjct  128856  TTYDY--IVLGAGSGGVSTAHRAVAYGAKVLV---VERGRENDGAGLGGTCVNVGCVPKK  128692

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
               +M  ++L  E++H   A + +   S D     F W  + A  D Y+  +N  Y   +   
Sbjct  128691  IMFNAALHAEMLHSARA-YAFKGVS-DIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLED  128518

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
                V        FVD HT+E+       ++ T + ++IAVGG P     PG EHAISSD  F
Sbjct  128517  KVDLVMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFF  128353

Query  215     WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYME  272
                + + +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME
Sbjct  128352  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME  128179

 Score = 124 bits (311),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 121/230 (53%), Gaps = 5/230 (2%)
 Frame = -2

Query  275     SGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKAR  334
               +G++F+R++   +I K  +G L ++ T          F+TVL A GR P    LGL+   
Sbjct  128116  AGVQFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTD  127937

Query  335     VKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TAQMD  392
               + L+ +        E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N   A ++
Sbjct  127936  IALSTEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVN  127757

Query  393     YDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYL  452
               Y +I T VF+    G  GL+E  + E+YG  N+  +  +F  + +++  E      +  +
Sbjct  127756  YSQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--M  127583

Query  453     KVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  127582  KLVCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  127436

>SADI:scaffold_39 supercont1.39 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.39:1:589803:1 
REF
Length=589803

 Score = 135 bits (340),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 128/239 (54%), Gaps = 14/239 (6%)
 Frame = -3

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               T+YDY  +V+G GSGG++ +  A ++G KV V   V+   +    GLGGTCVNVGC+PKK
Sbjct  364162  TTYDY--IVLGAGSGGVSTAHRAVAYGAKVLV---VERGRENDGAGLGGTCVNVGCVPKK  363998

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
               +M  ++L  E++H   A + +   S D     F W  + A  D Y+  +N  Y   +   
Sbjct  363997  IMFNAALHAEMLHSARA-YAFKGVS-DIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLED  363824

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
                V        FVD HT+E+       ++ T + ++IAVGG P     PG EHAISSD  F
Sbjct  363823  KVDLVMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFF  363659

Query  215     WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYME  272
                + + +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME
Sbjct  363658  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME  363485

 Score = 122 bits (307),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 120/230 (52%), Gaps = 5/230 (2%)
 Frame = -2

Query  275     SGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKAR  334
               +G++F+R++   +I K  +G L ++ T          F+TVL A GR P    LGL+   
Sbjct  363422  AGVQFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTD  363243

Query  335     VKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TAQMD  392
               + L+ +        E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N   A ++
Sbjct  363242  IALSTEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVN  363063

Query  393     YDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYL  452
               Y +I T VF+    G  GL+E  +  +YG  N+  +  +F  + +++  E      +  +
Sbjct  363062  YSQIPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--M  362889

Query  453     KVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  362888  KLVCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  362742

>PYAR:scaffold_583 par_scaffold_583 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_583:1:16086:1 
REF
Length=16086

 Score = 216 bits (550),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 164/480 (34%), Positives = 250/480 (52%), Gaps = 30/480 (6%)
 Frame = -2

Query  34    ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
             ET YDY  +VIGGGSGG+A ++ AA  G KV +++  + +      GLGGTCVN GC+PK
Sbjct  1523  ETVYDY--IVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPK  1359

Query  94    KLMHQSSLIGELMHHDSANFGWNIAS-ADGSASTFSWKQLVANVDGYIRGINFKYKVELR  152
             K+M  ++     + H + N  ++I S A+     F W  + A  D YI  +N  Y+  + 
Sbjct  1358  KVMWNAA---SHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIG  1188

Query  153   SKYVKYENFLGSFV--DAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISS  210
             +  +     + S    DA T++       T     + +++AVGG P     PG EHAI S
Sbjct  1187  NAKIDLIEGIASLTAKDAVTVD-----GKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDS  1023

Query  211   DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGE  269
             DD F +K  +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + +  
Sbjct  1022  DDFFKLKT-QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNA  846

Query  270   YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLG  329
              M+ + G+ F+R++   +I K  +G+L V+ T +  ++    FD VL A GR+P    LG
Sbjct  845   EMD-KHGVHFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLG  669

Query  330   LDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLS-----RR  382
             L+   VKL++  G I V K E TS   +YAIGD      ELTPVAI AGR LS       
Sbjct  668   LESVGVKLSD-AGFIEVDKFENTSVDGVYAIGDATTTGYELTPVAIAAGRRLSXXXXXXX  492

Query  383   LYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEE  442
                          I T VF+    G  G +E ++ E++G D+++VY   FV L +++++ 
Sbjct  491   XXXXXXXXXXXXXIPTVVFSHPPIGTIGYTEPEAVEKFGADHVKVYTSTFVNLLYAMADP  312

Query  443   TRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                +  +  +K++C    ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  311   DHKSKTA--MKLVCVGENEQ-VVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHP  141

>SAPA:scaffold_17 supercont2.17 dna:supercontig supercontig:ASM15154v2:supercont2.17:1:533194:1 
REF
Length=533194

 Score = 127 bits (318),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 129/241 (54%), Gaps = 14/241 (6%)
 Frame = +3

Query  33      AETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  92
               A T YDY  +VIGGGSGG + ++ AA++G KV +   ++        G+GGTCVNVGC+P
Sbjct  379245  ATTVYDY--IVIGGGSGGNSSARRAAAYGAKVLL---IERGHANDGAGMGGTCVNVGCVP  379409

Query  93      KKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELR  152
               KK+M  ++L  E++H   A    NI   D    +F W  L    D Y+  +N  Y+  L 
Sbjct  379410  KKIMFNAALHAEMLHSAHAYTFKNI--QDVEYGSFDWAALKKKRDAYVARLNGIYERNLG  379583

Query  153     SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  212
               +  +        FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD 
Sbjct  379584  NNQIPLVYGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDG  379748

Query  213     IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYM  271
                F + + +P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   M
Sbjct  379749  FFAL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEM  379925

Query  272     E  272
               E
Sbjct  379926  E  379928

 Score = 122 bits (307),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 125/233 (54%), Gaps = 11/233 (5%)
 Frame = +2

Query  275     SGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAF---DTVLNATGRDPDVAKLGLD  331
               +G+ F+R++   SI K  +G       + DG    ++F   +TVL A GR P    LGL+
Sbjct  379985  AGVHFVRESGITSIEKAVDGY---ADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLE  380155

Query  332     KARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TA  389
                  + L+          E TS PN+YA+GDV     ELTPVAI AGR L+ RL+ N   A
Sbjct  380156  TTDIALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNA  380335

Query  390     QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES  449
                ++Y +I T VF+    G  GL+E  +  +YG +N++VY  +F  + +++SE+     + 
Sbjct  380336  CINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDDK--QK  380509

Query  450     CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                 +K+IC    ++ VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  380510  TAMKLIC-IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  380665

 Score = 134 bits (336),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 124/241 (51%), Gaps = 12/241 (5%)
 Frame = -2

Query  33      AETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  92
               A +   YD +V+G GSGG++ +  A ++G KV V++           GLGGTCVNVGC+P
Sbjct  378543  ARSMATYDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVNVGCVP  378373

Query  93      KKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELR  152
               KK+M  ++L  E++H   A     +   D     F W  + A  D Y++ +N  Y   + 
Sbjct  378372  KKIMFNAALHAEMLHSARAYAFKGV--QDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGML  378199

Query  153     SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  212
                  V        FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD 
Sbjct  378198  EDKVDLVMGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDG  378034

Query  213     IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYM  271
                F + + +P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   M
Sbjct  378033  FFAL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEM  377857

Query  272     E  272
               E
Sbjct  377856  E  377854

 Score = 34.7 bits (78),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 32/62 (52%), Gaps = 6/62 (10%)
 Frame = -2

Query  441     EETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  500
               E+ +TA     +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V I
Sbjct  377130  EKVQTA-----MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAI  376969

Query  501     HP  502
               HP
Sbjct  376968  HP  376963

>PYIR:scaffold_236 pir_scaffold_236 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_236:1:38383:1 
REF
Length=38383

 Score = 124 bits (311),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 126/250 (50%), Gaps = 40/250 (16%)
 Frame = -2

Query  39     YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
              YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  36093  YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  35941

Query  98     QSSLIGELMHHDSANFGWNIASADGSA----STFSWKQLVANVDGYIRGIN---------  144
               ++ +   +H D+  +G+   S DGS       F W +L    D YI  +N         
Sbjct  35940  LAANMNHTLHRDAFYYGFE--SKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERYACA  35767

Query  145    ----FKYKVELRSKY----VKYENFLGSFVDAHTLELWHPRKGT-----KQITTRDVVIA  191
                   +Y     ++Y    V   N   S VD          +G      K I+ R+V+IA
Sbjct  35766  SAI*IRYTCAAANQYVWCCVMDRNLGNSKVDLIQGTAAFNAQGEVEVDGKVISARNVLIA  35587

Query  192    VGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMV  251
              VGG+P     PG EH I SD  F +++  P K  VVGA Y+A+E AG L G+G D  +  
Sbjct  35586  VGGKPLIPDIPGKEHCIDSDGFFELEEL-PNKVAVVGAGYIAVELAGVLHGLGSDTTIFC  35410

Query  252    RSI-LLRGFD  260
              R   +LR FD
Sbjct  35409  RKDGVLRTFD  35380

 Score = 122 bits (307),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/255 (35%), Positives = 132/255 (52%), Gaps = 20/255 (8%)
 Frame = -3

Query  255    LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDT  314
              L+R    D   K G  +  QS +  I KT       L+  + LV     DG S    FDT
Sbjct  35285  LVRDTLHDAMAKDGIVVRPQSNVARIEKT-------LDGKKTLV---LADG-SEHAGFDT  35139

Query  315    VLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPN-IYAIGDVIDAPELTPVAI  373
              V+ A GR P  + L +  A ++  +K G I V   QT++ N ++A+GDV     LTPVAI
Sbjct  35138  VIYAAGRIPLTSNLNISAAGIE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAI  34962

Query  374    QAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNF  432
               AGR LS RL+     A++ Y+ I T VF+    G  GL+E++++E+YG+  I+ Y   F
Sbjct  34961  AAGRRLSDRLFGGMEDAKISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRF  34782

Query  433    VPLEWSLSEETRTAAES-----CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKL  487
              V + + L  E      +       +K++C   +D+ VVG H +G  A E+ Q  G+A+K+
Sbjct  34781  VNMYYGLVNELDAEGNTKPKPMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKM  34605

Query  488    GFTYDQMVDTVGIHP  502
              G T     + V IHP
Sbjct  34604  GATKADFDNCVAIHP  34560

>PLHA:NW_020190027.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3124, whole genome shotgun sequence
Length=220491

 Score = 155 bits (392),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/329 (33%), Positives = 167/329 (51%), Gaps = 34/329 (10%)
 Frame = -1

Query  203    GGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQ  261
              G E  I SD  F ++   P K  +VGA Y+A+E AG L  +G    V  R   +LR FD 
Sbjct  55947  GKELCIDSDGFFELETL-PTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDV  55771

Query  262    D-------MANKIGEYMEVQSGIEFIRKTVPQ-------------SITKLENGQLLVKWT  301
                      +AN I  ++   +    +R T+ +             ++ +++      K  
Sbjct  55770  GINYSLFALANSI--FLIFFTAKNILRTTLEEAMANDGVHLRPNSTVARVKEAADGTKTL  55597

Query  302    TEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIG  360
                   S    FD V+ ATGR P  + L L+KA +  ++  G I V   ++T+  N+YA+G
Sbjct  55596  VLTNGSEHRGFDVVICATGRVPLTSTLNLEKAGITTDDN-GYIRVNEFQETTKNNVYAVG  55420

Query  361    DVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKER  419
              DV + P LTPVAI AGR LS RL+     A++ Y+ I T +F+    G  GL+EE ++++
Sbjct  55419  DVCNTPALTPVAIAAGRRLSDRLFGGMKDAKLSYENIPTVIFSHPPIGTIGLTEEGARKK  55240

Query  420    YGEDNIEVYHKNFVPLEWSLSEETRTAA------ESCYLKVICDKTRDKFVVGFHYLGPN  473
              YG++NI+VY   FV + + L  ET  A           +K++C   ++K VVG H +G  
Sbjct  55239  YGDNNIKVYSSRFVNMYYGLINETIEATGVPKEKPKTAMKLVCAGNKEK-VVGLHMIGMA  55063

Query  474    AGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              A E+ Q  G+A+K+G T     + + IHP
Sbjct  55062  ADEILQGFGVAVKMGATKADFDNCIAIHP  54976

 Score = 85.1 bits (209),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 98/198 (49%), Gaps = 42/198 (21%)
 Frame = -2

Query  38     DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
              +YD +VIG GSGG+A ++ AAS+ G +V +++  +         LGGTCVNVGC+PKKLM
Sbjct  56567  EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  56415

Query  97     HQSSLIGELMHHDSANFGWNIASADGSAS---TFSWKQLVANVDGYIRGINFKYKV----  149
              + ++ +   +HHD   +G+  A+  G  S    F+W +L A  D Y+  +N  Y+     
Sbjct  56414  YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYET*E*A  56235

Query  150    ----ELRSKYV---------------KYENFLGSFVD-----AHTLELWHPRKGTKQITT  185
                  E R +Y+               +  N   S VD     A   E  +     K++  
Sbjct  56234  KKC*ETR-EYL*ILGAV*GLTWYNLNENRNLANSKVDLIRGSAKFNERGNVEVDDKEVRA  56058

Query  186    RDVVIAVGGRPKELTCPG  203
              + ++IAVGGRP     PG
Sbjct  56057  KKILIAVGGRPLIPDIPG  56004

>PYIR:scaffold_1258 pir_scaffold_1258 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1258:1:8745:1 
REF
Length=8745

 Score = 203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 149/454 (33%), Positives = 222/454 (49%), Gaps = 23/454 (5%)
 Frame = +1

Query  55    KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFG  114
             + AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  +S     + H + N  
Sbjct  6355  RRAATYGAKVLV---VERGRKYDGMGLGGTCVNYGCVPKKVMFNAS---AHVEHLNRNAD  6516

Query  115   WNIASADGSAS----TFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHT  170
             ++I + +GS       F W  +    D YI  +N  Y+  L +  V     +   V  + 
Sbjct  6517  YSITT-NGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQ  6693

Query  171   LELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGAS  230
             +E+          T + +++AVGG+P     PG EH I SD  F ++  +P K  VVGA 
Sbjct  6694  IEV-----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEA-QPKKVAVVGAG  6855

Query  231   YVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSIT  289
             Y+A+E AG    +  D  +  R   +LR FD  + + I E  E ++GI F+R +  + I 
Sbjct  6856  YIAIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERID  7032

Query  290   KLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE  349
             K  +G L +    +  E     FDT+L A GR+P    LGL++  VKL +    +    E
Sbjct  7033  KQADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQE  7212

Query  350   QTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGC  408
              TS P IYAIGD  I   ELTPVAI AG              + Y +I T VF+    G 
Sbjct  7213  NTSVPGIYAIGDATITGWELTPVAIAAGXXXXXXXXXXXXXLLHYHQIPTVVFSHPPLGT  7392

Query  409   CGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFH  468
              G +E  + E++G +N++VY   FV L +++++       +  L        D+ VVG H
Sbjct  7393  IGYTEPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTAMKL---VTVGEDEVVVGVH  7563

Query  469   YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  7564  VAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  7665

>APIN:scaffold_70 supercont1.70 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.70:1:209556:1 
REF
Length=209556

 Score = 166 bits (421),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 125/368 (34%), Positives = 196/368 (53%), Gaps = 33/368 (9%)
 Frame = -3

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               TSYDY  +V+GGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+PKK
Sbjct  140998  TSYDY--IVVGGGSGGVSSASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCVPKK  140834

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
               +M+ + +  E++H  + ++ +     +    +F W  + A  D Y+  ++  Y+  L  +
Sbjct  140833  IMYNAGVHAEILH-SAKDYSFKDV-VNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEE  140660

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
                + +      FVD HT+E+       ++ T   ++IAVGG P+    PG EHA+SSD  F
Sbjct  140659  NIDHVIGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHAVSSDGFF  140495

Query  215     WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYME-  272
                +   +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + + + M  
Sbjct  140494  DLPT-QPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEMAK  140318

Query  273     -------------VQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEE--AFDTVLN  317
                             ++G+ F+     +SI K  +G L V    + GE+  E   FD +++
Sbjct  140317  *VS*PVQ*RS*RVARAGVAFVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVS  140144

Query  318     ATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAG  376
               A GR P    +GLDK  V+L++    +    E T+   +YAIGDV     ELTPVAI AG
Sbjct  140143  AIGRIPRTQDVGLDKTHVELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAG  139964

Query  377     RLLSRRLY  384
               R L+ RL+
Sbjct  139963  RRLADRLF  139940

 Score = 70.1 bits (170),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 65/121 (54%), Gaps = 2/121 (2%)
 Frame = -1

Query  382     RLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSE  441
               R Y+ + A + Y +I T VF+    G  GL+E D+  +YG DN+ VY   F  + ++L+ 
Sbjct  139893  RRYH*TNACIHYHQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALAT  139714

Query  442     ETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  501
                +    ++  +K++C    ++ V+G H  G  A E+ Q  G+A+KLG       + V IH
Sbjct  139713  HSAHKPQTA-MKLVCIGV-EETVIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIH  139540

Query  502     P  502
               P
Sbjct  139539  P  139537

>ALCA:scaffold_523 AcNc2_CONTIG_523_length_15388 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_523_length_15388:1:15388:1 
REF
Length=15388

 Score = 201 bits (512),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 153/493 (31%), Positives = 240/493 (49%), Gaps = 56/493 (11%)
 Frame = +1

Query  55     KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFG  114
              + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++   E +   S    
Sbjct  12154  RRAATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  12324

Query  115    WNIASADGSASTFS-----WKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAH  169
                  S + ++ +FS     W ++    D YI  +N  Y   L +  +     +   +   
Sbjct  12325  RPFTSKECASHSFSFGDFDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIAKD  12504

Query  170    TLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGA  229
               +++            + ++IAVGG P   + PG EHAI SD  F ++  +P K  VVGA
Sbjct  12505  RVQVNQ----DSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLET-QPKKVAVVGA  12669

Query  230    SYVALECAG-FLKGMGYDVKVM-----------------VRSILLRGFDQD---------  262
               Y+A+E AG F   + Y  K M                 + S  L  F ++         
Sbjct  12670  GYIAVEIAGLFAILILYTTKQMTMKCCL*ASLTRSSRTPLYSAALIKF*ENSIHW*GIWS  12849

Query  263    MANKIGEYME----------VQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAF  312
              M      Y +          ++ G+ F+RK+  + ITK ++ +L +     +       F
Sbjct  12850  MKRWKSAYFQSLHRSLLTTFLRDGVNFVRKSHLEKITKAKDDKLAITARIGEENQTFSDF  13029

Query  313    DTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTP  370
              D ++ A GR P    LGL++  V LNE TG I V   E TS P +YA+GDV     ELTP
Sbjct  13030  DQIVMAVGRSPRTVGLGLEEVGVALNE-TGHIIVDAQENTSVPGVYALGDVTTTGWELTP  13206

Query  371    VAIQAGRLLSRRLYNNST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYH  429
              VAI AGR L+ RL+NN   A + Y +I T VF+    G  G +E ++  +YGE+N++ Y 
Sbjct  13207  VAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHPPLGTIGYTEPEAIAKYGEENVKCYS  13386

Query  430    KNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  489
                FV L +S++E+     ++  +K++C  +++  VVG H  G  A E+ Q  G+AMK+G 
Sbjct  13387  SKFVNLLYSMAEDPEKKKKTA-MKLVCVGSKET-VVGLHVAGDGADEMVQGFGVAMKMGA  13560

Query  490    TYDQMVDTVGIHP  502
              T     + V IHP
Sbjct  13561  TKADFDNIVAIHP  13599

>ALLA:FR824246 dna:supercontig supercontig:ENA1:FR824246:1:47019:1 
REF
Length=47019

 Score = 152 bits (385),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 145/267 (54%), Gaps = 22/267 (8%)
 Frame = -3

Query  255    LLRGFDQDMANKIGEYME----------------VQSGIEFIRKTVPQSITKLENGQLLV  298
              +LR FD  + + + E ME                +++G+ F+RK+  + I K E+ +L +
Sbjct  33583  VLRKFDPLVRDLVNEEMEKCVVSMVCYSLLTISLLRNGVNFVRKSHLEKIVKSEDDKLAI  33404

Query  299    KWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIY  357
                   D       FD ++ A GR P    LGL+   V+LNE TG I V   E TS P +Y
Sbjct  33403  TARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNE-TGHIIVDAQENTSIPGVY  33227

Query  358    AIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQMDYDKICTAVFTPIEYGCCGLSEED  415
              A+GDV     ELTPVAI AGR L+ RL+NN   A + Y +I T VF+    G  G +E +
Sbjct  33226  ALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHPPLGTIGYTEPE  33047

Query  416    SKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAG  475
              +  +YGE+N++ Y   FV L +S++E+     ++C +K++C  +++  VVG H  G  A 
Sbjct  33046  AIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTC-MKLVCVGSKET-VVGLHVAGDGAD  32873

Query  476    EVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              E+ Q  G+AMK+G T     + V IHP
Sbjct  32872  EMVQGFGVAMKMGATKADFDNIVAIHP  32792

 Score = 80.5 bits (197),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 106/206 (51%), Gaps = 13/206 (6%)
 Frame = -2

Query  39     YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
              YD +VIGGGSGG+A ++ AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ 
Sbjct  34280  YDYIVIGGGSGGVASARRAATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYN  34110

Query  99     SSLIGELMHHDSANFGWNIASADGSASTFS-----WKQLVANVDGYIRGINFKYKVELRS  153
              ++   E +           AS   ++ +FS     W ++    D YI  +N  Y   L +
Sbjct  34109  AAAHVEHIERAPDYSIRPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLAN  33930

Query  154    KYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  213
                +     +   +    +++            + ++IAVGG P   + PG EHAI SD  
Sbjct  33929  AKIDTVTGIAKLIAKDRVQV----NQDSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGF  33762

Query  214    FWMKKKEPGKTLVVGASYVALECAGF  239
              F + + +P K  VVGA Y+A+E AG 
Sbjct  33761  FKL-ETQPKKVAVVGAGYIAVEIAGL  33687

>PYVX:scaffold_124 pve_scaffold_124 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_124:1:48871:1 
REF
Length=48871

 Score = 159 bits (402),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 124/358 (35%), Positives = 184/358 (51%), Gaps = 16/358 (4%)
 Frame = +2

Query  28     SAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  87
              SA    ET+YDY ++  G G   +A ++ AAS G KV +++  + +      GLGGTCVN
Sbjct  38180  SATMSTETTYDYVVLGGGSGG--VASARRAASHGAKVLLVERGRAN---DGAGLGGTCVN  38344

Query  88     VGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKY  147
               GC+PKK+M  ++   E ++         +         F W  +    D YI  +N  Y
Sbjct  38345  YGCVPKKVMFNAAAHVEHLNRAGDYSVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIY  38524

Query  148    KVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  207
              +  L +  +     +   V  + LE+       K  T +++++A GG P     PG EHA
Sbjct  38525  ERNLGNAKIDVVQGVARVVARNQLEV-----DGKVYTGKNLLLAPGGVPTLPPIPGIEHA  38689

Query  208    ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANK  266
              I SD  F +++ +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + 
Sbjct  38690  IDSDGFFKLEQ-QPRKVAVVGAGYIAVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDL  38866

Query  267    IGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVA  326
              +   ME ++G++F+R++    I KLE+G+L +    +        FDTVL A GR+P  A
Sbjct  38867  VNAEME-KNGVQFVRRSHITRIDKLEDGKLQITAEVDGATQTIGGFDTVLFAIGREPRTA  39043

Query  327    KLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRR  382
               LGL+   V L++K G I V   E TS   +YAIGD      ELTPVAI AGR LS R
Sbjct  39044  DLGLEAIGVDLDDK-GFIKVDAQENTSAAGVYAIGDATTTGWELTPVAIAAGRRLSDR  39214

 Score = 55.1 bits (131),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 3/96 (3%)
 Frame = +3

Query  407    GCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVG  466
              G  G +E D+  +YG +N++VY   FV L  ++++       +  L  +  +   + VVG
Sbjct  39327  GTIGYTEPDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTAMKLVTVGAQ---ETVVG  39497

Query  467    FHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               H  G  A E+ Q  G+A+KLG T     + V IHP
Sbjct  39498  VHVAGEGADEMIQGFGVAVKLGATKADFDNIVAIHP  39605

>PYUU:scaffold_1352 scf1117875581352 dna:supercontig supercontig:pug:scf1117875581352:1:165876:1 
REF
Length=165876

 Score = 159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/354 (32%), Positives = 173/354 (49%), Gaps = 35/354 (10%)
 Frame = -1

Query  181     KQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFL  240
               K++  ++++IAVGG+P     PG EH I SD  F ++   P K  VVGA Y+A+E AG L
Sbjct  133809  KEVKAKNILIAVGGKPLIPDIPGKEHCIDSDGFFELEVL-PKKVAVVGAGYIAVELAGVL  133633

Query  241     KGMGYDVKVMVRSI-LLRGFDQD---------------------MANKIGEYMEVQSGIE  278
                G+G D  +  R   +LR FD                       M + + + +      +
Sbjct  133632  NGLGSDTTIFCRKHGVLRTFDVSRSVLLDVHLTLMYPALNLSIFM*DSVRDMLHDAMAKD  133453

Query  279     FIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLN  338
                I      ++ ++E      K       S    FDT++ A GR P  + L L  A +K +
Sbjct  133452  GITLRANSNVARVELAADGTKTLALQDGSEHTGFDTIIYAAGRVPLTSSLNLSAAGIKTD  133273

Query  339     EKTGRIWVKNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY---NNSTAQMDYD  394
                  G I V   Q TS  N++A+GDV     LTPVAI AGR LS RL+    ++ A++ YD
Sbjct  133272  SH-GFIKVDAYQATSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGERHADAKISYD  133096

Query  395     KICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC----  450
                I T VF+    G  GL+E +++++YG+  I+ Y   FV + + L  E     ++     
Sbjct  133095  NIPTVVFSHPPIGTIGLTEIEARKKYGDAAIKTYTSRFVNMYYGLVNEVADDGKAAKPKP  132916

Query  451     --YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                  +K++C    D+ VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  132915  MTAMKLVC-LGDDEKVVGLHIIGMAADEMLQGFGVAVKMGATKADFDNCIAIHP  132757

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 72/127 (57%), Gaps = 14/127 (11%)
 Frame = -2

Query  25      STPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGG  83
               ST S   + +  YDY  +VIG GSGG+A S+ AAS+   +V V++  +         LGG
Sbjct  134324  STRSLSSQQQDEYDY--LVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGG  134178

Query  84      TCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASAD--GSASTFSWKQLVANVDGYIR  141
               TCVNVGC+PKK+M+ ++ +  ++H D+ ++G+        G   +F W +L    D Y+ 
Sbjct  134177  TCVNVGCVPKKIMYLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVL  133998

Query  142     GINFKYK  148
                +N  Y+
Sbjct  133997  RLNGIYE  133977

>PYIW:scaffold_3390 piw_scaffold_3390 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3390:1:3223:1 
REF
Length=3223

 Score = 157 bits (397),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 119/364 (33%), Positives = 175/364 (48%), Gaps = 57/364 (16%)
 Frame = +1

Query  181   KQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFL  240
             K+I  ++++IAVGG+P     PG E  I SD  F +++  P K  VVGA Y+A+E AG L
Sbjct  811   KEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFFELEQL-PKKVAVVGAGYIAVELAGVL  987

Query  241   KGMGYDVKVMVRSI-LLRGFD---------------------------------QDMANK  266
              G+G +  +  R   +LR FD                                  D   K
Sbjct  988   HGLGSNTTIFCRKDGVLRTFDV*YLWLTMPSGKWSLTW*YDLI*YEQELVRDTLHDAMAK  1167

Query  267   IGEYMEVQSGIEFIRKTVPQSITK-LENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
              G  +  QS +  + +T     T  L+NG            S    FDTV+ A GR P  
Sbjct  1168  DGIVVRPQSNVARVEQTADGKKTLFLQNG------------SEHAGFDTVIYAAGRVPLT  1311

Query  326   AKLGLDKARVKLNEKTGRIWVKNEQT-STPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY  384
             ++L L  A +   +K G I V   QT S  N++A+GDV     LTPVAI AGR LS RL+
Sbjct  1312  SELNLSAAGIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLF  1488

Query  385   NN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                + A++ YD I T VF+    G  GL+E +++E++G+  I+ Y   FV + + L  + 
Sbjct  1489  GGMADAKISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDV  1668

Query  444   RTAAES-----CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  498
                  +       +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V
Sbjct  1669  DADGAAKPKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCV  1845

Query  499   GIHP  502
              IHP
Sbjct  1846  AIHP  1857

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 66/115 (57%), Gaps = 16/115 (14%)
 Frame = +3

Query  39   YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            YD +VIG GSGG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  342  YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  494

Query  98   QSSLIGELMHHDSANFGWN----IASADGSASTFSWKQLVANVDGYIRGINFKYK  148
             ++ +  ++H D+ ++G+     +   D  A  F W +L    D YI  +N  Y+
Sbjct  495  LAANMNHMLHRDAFHYGFEGKDGVRIGDNVA--FHWDKLKERRDAYILRLNDIYE  653

>PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_610:1:19546:1 
REF
Length=19546

 Score = 154 bits (389),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 146/480 (30%), Positives = 219/480 (46%), Gaps = 44/480 (9%)
 Frame = +3

Query  36     SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
              S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  12456  SSEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKA  12611

Query  96     MHQSSLIGELMHHDSANFGWNIASA----DGSASTFSWKQLVANVDGYIRGINFKYKVEL  151
              +  ++ +     HD + +G  ++      DG     S ++ V  + G I G+  K KV  
Sbjct  12612  LLHATHMYHAAQHDFSKYGIEVSDVKMNFDGMMK--SKEKAVKTLTGGIEGLFKKNKV--  12779

Query  152    RSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEH  206
                 YVK     G  V A+ + +     G + +  ++++IA G       P  +    G+ 
Sbjct  12780  --TYVK---GFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKI  12944

Query  207    AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMAN  265
                S+  +    KK P   +V+G   + LE     K +G  V V+     +  G DQ++  
Sbjct  12945  VDSTGALEL--KKVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGK  13118

Query  266    KIGEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPD  324
              +  + ++ Q G++F   T V  S    +   L V+       S  EA DTVL ATGR P 
Sbjct  13119  EFTKLLKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPF  13292

Query  325    VAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  383
                 LGL++  ++  +K GRI V N  +T  PNI+AIGDVI  P L   A + G      +
Sbjct  13293  TKGLGLEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENI  13469

Query  384    YNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                     ++YD I   ++T  E    G +EE  KE       E    N        +   
Sbjct  13470  AGLH-GHVNYDAIPGVIYTYPEVASVGKTEEQLKE-------EGVAYNVGKFPMMANSRA  13625

Query  444    RTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              R  AES  ++KVI DKT D+ ++G H +  NAGE+     L M+ G   + +  T   HP
Sbjct  13626  RAVAESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHP  13802

>APIN:scaffold_30 supercont1.30 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.30:1:728126:1 
REF
Length=728126

 Score = 112 bits (281),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 138/260 (53%), Gaps = 18/260 (7%)
 Frame = -1

Query  25      STPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGT  84
               S P  +    ++  YD +V+GGGSGG+A ++ AAS+G KV V   V+        GLGGT
Sbjct  476876  SFPQLLRRPMSTTSYDYIVLGGGSGGIASARRAASYGAKVLV---VERGRTLGGAGLGGT  476706

Query  85      CVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADG-SASTFSWKQLVANVDGYIRGI  143
               CVNVGC+PKK+M+ ++ + E+MH       +      G    +F W  + +  D Y+  +
Sbjct  476705  CVNVGCVPKKVMYNAAFLAEIMHSAKT---YTFKGVQGVEFGSFDWPAMKSKRDAYVTRL  476535

Query  144     NFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  203
               +  Y+  L    +   + + +FVD HT+ +     G K  T   +++AVGG P+  + PG
Sbjct  476534  HGIYERNLAKDGISLVSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIPG  476370

Query  204     GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD--  260
                E AISSD  F + + +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  
Sbjct  476369  IELAISSDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPL  476193

Query  261     -QDMANK-IGEYMEVQSGIE  278
                +D  NK +  Y+  +  +E
Sbjct  476192  VRDHVNKEMRRYVATRPSLE  476133

 Score = 67.4 bits (163),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 11/143 (8%)
 Frame = -3

Query  274     QSGIEFIRKTVPQSITKLENGQLLVKWT--TEDGESCEEAF---DTVLNATGRDPDVAKL  328
               ++G+ F+ ++   SI K  NG L ++ T   E+G +  + F   D V+ A GR P     
Sbjct  476106  RAGVAFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDC  475927

Query  329     GLDKARVKLNEKTGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNN  386
               G D+  +  + K G I V   E T+ P +YAIGD      ELTPVAI AGR L+ RL+  
Sbjct  475926  GFDRTDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGG  475750

Query  387     STAQMDYDKICTAVFTPIEYGCC  409
                  ++     C A  + I  G C
Sbjct  475749  ---EVHSTVTCPARRSRIRLGWC  475690

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -1

Query  378     LLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEW  437
               LL+ R      A ++Y +I T VF+    G  G +E D+  +YG  N++VY  +FV L +
Sbjct  475679  LLTWRRVL*PDACINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFY  475500

Query  438     SLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  497
               +L         S  +KV+C   +++ VVG H  G  A E+ Q  G+A+K+G     + + 
Sbjct  475499  TLLPPKDM--PSTAMKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNV  475329

Query  498     VGIHP  502
               + IHP
Sbjct  475328  IAIHP  475314

>PHRA:scaffold_60
Length=327626

 Score = 148 bits (373),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 111/328 (34%), Positives = 159/328 (48%), Gaps = 31/328 (9%)
 Frame = +3

Query  203     GGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQ  261
               G E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD 
Sbjct  187239  GKELCIDSDGFFELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDV  187415

Query  262     -----DMANKIGEYMEVQSGIEFIRKTV-------------PQS-ITKLENGQLLVKWTT  302
                    D+   I   + +   I+ I +T              P S +T++E      K   
Sbjct  187416  SWINVDLFRSILNVLLIMHWIQGIVRTTLEDAMAKDGVHLRPHSNVTRVEQVADGTKTLV  187595

Query  303     EDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGD  361
                   S    +D V+ A GR P  + L LD A +   +K G I V   ++TS   + A+GD
Sbjct  187596  LADGSEHSGYDVVIYAAGRVPLTSNLQLDNADIA-TDKHGFIQVNEFQETSNSKVLAVGD  187772

Query  362     VIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERY  420
               V   P LTPVAI AGR LS RL+     A++ Y+ I T VF+    G  GL+EE ++ +Y
Sbjct  187773  VCGTPALTPVAIAAGRRLSDRLFGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQY  187952

Query  421     GEDNIEVYHKNFVPLEWSLSEETRTAA------ESCYLKVICDKTRDKFVVGFHYLGPNA  474
               G+DN +VY   FV + + L  E   A           +K++C    +K VVG H +G  A
Sbjct  187953  GDDNTKVYASRFVNMYYGLINEVDEATGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAA  188129

Query  475     GEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                E+ Q  G+A+K+G T     + + IHP
Sbjct  188130  DEILQGFGVAVKMGATKADFDNCIAIHP  188213

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = +3

Query  7       SIQESALNTKKNMQIHDPSTPSAVDEAET-SYDYDLVVIGGGSGGLACSKEAASF-GQKV  64
               S Q   L TK   ++  P    A   + T   +YD +VIG GSGG+A ++ AAS+ G +V
Sbjct  186555  STQLKMLRTKLVSRV--PRFARARSSSRTLQTEYDYLVIGAGSGGMASARRAASYPGTRV  186728

Query  65      CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASAD---  121
                V++  +         LGGTCVNVGC+PKKLM  ++ +   + HD  ++G+   +     
Sbjct  186729  AVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHDFLHYGFEDEATGGHL  186881

Query  122     GSASTFSWKQLVANVDGYIRGINFKYK  148
               G  + F W +L A  D Y+  +N  Y+
Sbjct  186882  GQRTHFDWPKLKARRDAYVLRLNGIYE  186962

>ALLA:FR824220 dna:supercontig supercontig:ENA1:FR824220:1:54737:1 
REF
Length=54737

 Score = 145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 136/480 (28%), Positives = 218/480 (45%), Gaps = 40/480 (8%)
 Frame = -1

Query  35     TSYDYDLVVIGGGSGGLACSKEAASFGQK-VCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
              +S +YDL+VIGGG GG   + +AA  G K VC+        +GT   LGGTC+NVGCIP 
Sbjct  26078  SSTEYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPS  25926

Query  94     KLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRS  153
              K +  SS +     HD    G      + S    ++ +++   +  ++ +    +   + 
Sbjct  25925  KALLHSSHMFHTAQHDFKAIGI-----EASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKK  25761

Query  154    KYVKYENFLGSFV--DAHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCP--GGEHAI  208
                V Y    G+ V  D  ++      KG + I  ++++IA G     L  CP    +  I
Sbjct  25760  NKVAYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRI  25581

Query  209    SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  267
                     + K  P + +VVGA  + LE     + +G +V V+   + +  G D ++  + 
Sbjct  25580  VDSTGALVLKSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREF  25401

Query  268    GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEA---FDTVLNATGRDPD  324
               + ++ Q G +F   T    +T  +  +  V  T ED +   E     D VL ATGR P 
Sbjct  25400  AKTLQKQ-GFKFKFAT---KVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPF  25233

Query  325    VAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  383
                 LGL+   ++  +K GRI V N  +T  PNIYAIGDVI  P L   A + G + +  +
Sbjct  25232  TQNLGLENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEI  25059

Query  384    YNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                     ++Y+ I   ++T  E  C G +EE  KE       E    N        +   
Sbjct  25058  MLGKQGHVNYNAIPGVIYTFPEVACVGRTEEQLKE-------EGVSYNVGKFPMIANSRA  24900

Query  444    RTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              R   E+  ++KV+  K  D+ ++G H +  NAGE+     L ++ G + + +  T   HP
Sbjct  24899  RAVGETDGFVKVLAQKDNDR-ILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHP  24723

>ALCA:scaffold_262 AcNc2_CONTIG_262_length_36549 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_262_length_36549:1:36549:1 
REF
Length=36549

 Score = 145 bits (366),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 141/484 (29%), Positives = 220/484 (45%), Gaps = 50/484 (10%)
 Frame = -3

Query  36     SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
              S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  18145  SSEYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKA  17990

Query  96     MHQSSLIGELMHHDSANFGWNIASADGS------ASTFSWKQLVANVDGYIRGINFKYKV  149
              +  SS +     HD  + G  ++    +      A   S K L + ++G  +    K KV
Sbjct  17989  LLHSSHLFHTAQHDFKSIGIEVSDLRLNFGKMMKAKEKSVKVLTSGIEGLFK----KNKV  17822

Query  150    ELRSKYVKYENFLGSFVDAH--TLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCP--GG  204
                   Y+K     G  V  +  ++ L    KG + IT ++++IA G     L  CP    
Sbjct  17821  ----AYIKGH---GKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNE  17663

Query  205    EHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDM  263
              +  I       + K  P + +VVGA  + LE     + +G +V V+   + +  G D ++
Sbjct  17662  KGKIVDSTGALVLKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMEL  17483

Query  264    ANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAF---DTVLNATG  320
                +  + ++ Q G++F   T   S TK+      V  T ED +   E     D VL ATG
Sbjct  17482  GREFAKTLQKQ-GLKFKFATRVTS-TKVNGDN--VTITMEDAKGGNETSMECDVVLVATG  17315

Query  321    RDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLL  379
              R P    LGL+   ++  +K GRI V +  +T+ P+IYAIGDVI  P L   A + G + 
Sbjct  17314  RRPFTNGLGLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IA  17141

Query  380    SRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSL  439
              +  +       ++Y+ I   ++T  E  C G +EE  KE       E    N        
Sbjct  17140  AVEIMLGKHGHVNYNAIPGVIYTHPEVACVGKTEEQLKE-------EGISYNVGKFPMIA  16982

Query  440    SEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  498
              +   R   E+  ++KV+  K  D+ ++G H +  NAGE+     L ++ G   + +  T 
Sbjct  16981  NSRARAVGETDGFVKVLAQKDNDR-ILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTC  16805

Query  499    GIHP  502
                HP
Sbjct  16804  HAHP  16793

>PHKE:scaffold_8 scf_22126_8.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_8.1_contig_1:1:276008:1 
REF
Length=276008

 Score = 144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 139/482 (29%), Positives = 231/482 (48%), Gaps = 50/482 (10%)
 Frame = -3

Query  34      ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
               + S    L+VIGGGSGG   +  AA  G+KV +++  +         LGG C+N GC+P 
Sbjct  165372  DASMHTQLLVIGGGSGGYVAAIRAAQLGKKVLLVEKSE---------LGGVCLNCGCVPS  165220

Query  94      KLMHQSSLIGELMHHDSANFGWNIASADGSASTFS----WKQL-VANVDGYIRGINFKYK  148
               K +  ++   E M       G +   A G    FS    WKQ  V N          + K
Sbjct  165219  KALISAAHRYEQMLES----GISGLKAKGVDIDFSQIQQWKQTKVVN----------RLK  165082

Query  149     VELRSKYVKYE--NFLGS--FVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTC-PG  203
                 ++S   K+E   F G   F++     L++ ++  +     D ++AVG RP EL   P 
Sbjct  165081  TGIQSLLKKHEISVFKGEALFINDREARLYNEQESLRY-QFDDCIVAVGSRPIELKAFPY  164905

Query  204     GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS-ILLRGFDQD  262
               G   +SS +   + +  P + +V+G  Y+ +E        G  V ++  S  +L GF+ +
Sbjct  164904  GNRILSSTEALTLTEI-PERMVVIGGGYIGIELGQMYAKFGTKVTILEGSPSILPGFESE  164728

Query  263     MANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRD  322
               +   + + ++   G+      + QS  +  + ++ V +T +  E    A D VL   GR 
Sbjct  164727  ITRIVKKNLD-SLGVTVYTNAMAQSAQQSAD-EITVTFTVDQTEQQVTA-DYVLVTVGRR  164557

Query  323     PDV-AKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  380
               P+   +LGLD+  VK+ E+ G + V  + +TS P+IYAIGD+I  P L   A   G++++
Sbjct  164556  PNTDGELGLDRIGVKIGER-GLVEVDQQGRTSIPHIYAIGDIIAGPALAHKASYEGKVVA  164380

Query  381     RRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLS  440
                 +    +A  DY  I   VF+  E    GLSE D+KE+ G D I V    F     +LS
Sbjct  164379  EAIAGQPSA-FDYKVIPAVVFSDPEIASVGLSEPDAKEK-GYD-IMVGKFPFAANARALS  164209

Query  441     EETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  500
                    +A   ++K++ DK +   ++G   +G NA ++   + LA+++G T + +  T+  
Sbjct  164208  ----LSASEGFVKLVGDK-KTGLILGGQIVGTNASDLIPEIALAIEMGTTMEDLALTIHA  164044

Query  501     HP  502
               HP
Sbjct  164043  HP  164038

 Score = 140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 127/479 (27%), Positives = 213/479 (44%), Gaps = 61/479 (13%)
 Frame = -1

Query  38      DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
               DYD ++IG G    + + +A  +G KV +++      +GT   +GGTCVN+GC+P K + 
Sbjct  156545  DYDFLIIGSGGAAFSAAIQAVEYGAKVAIIE------RGT---VGGTCVNIGCVPSKTLL  156393

Query  98      QSSLIGELMHHDSAN--FGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKY  155
               ++   GE+ H    N   G N      SA      QLV   +  +         E+R + 
Sbjct  156392  RA---GEINHFAKNNPFLGLNT-----SAVAVDLDQLVEQKNELV--------AEMREQ-  156264

Query  156     VKYENFLGS-----------FVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGG  204
                KYE+ +G            FVD  T+ +     G +++T +  ++A G  P     PG 
Sbjct  156263  -KYEHLIGEYGFELIRGEAKFVDEKTIVV-----GGRKLTAKRFLLATGAAPSIPDIPGL  156102

Query  205     EHA--ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQ  261
                    ++S  +  +K+  P    V+G+ Y+A+E       +G +V ++ RS  + + +D 
Sbjct  156101  TDVDYLTSTSLLDLKQL-PKTLAVIGSGYIAMELGQLFHNLGTEVTLIQRSPRIFKEYDP  155925

Query  262     DMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGR  321
               +++  + + +  + GI  I       +     G L     + +GE      + +L ATGR
Sbjct  155924  EISEAVTKAL-TEQGIHLITGATYDRVET--TGNLKHVHLSVNGEKKVIEAEQLLIATGR  155754

Query  322     DPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  380
                P+   L L  A V +  K G I V +  +TS P IYA GDV   P+   VA   GR+ +
Sbjct  155753  KPNTEALNLRAANVIIGSK-GEIVVDDVLKTSNPRIYAAGDVTMGPQFVYVAAYEGRIAA  155577

Query  381     RRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLS  440
                        +++ + +    FT       GL+EE +K +  E    +   + VP      
Sbjct  155576  DNAVGGLEKKVNLETVPGVTFTSPALATVGLTEEQAKAKGYEVKTSILPLDSVPRALVNR  155397

Query  441     EETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  499
               E T         K++ D    K V+G H +  NAG+V  A  LA+K G T + + D++ 
Sbjct  155396  ETT------GVFKLVADSKSLK-VLGVHIVAENAGDVIYAATLAVKFGLTVEDLRDSLA  155241

 Score = 105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 109/472 (23%), Positives = 206/472 (44%), Gaps = 48/472 (10%)
 Frame = -3

Query  40     DLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQS  99
              + +VIG G GG   +  +   G K  +++  +         LGG C +VGCIP K     
Sbjct  91089  NTLVIGSGPGGYVAALRSVQLGMKTAIVERKQ---------LGGVCTHVGCIPSK-----  90952

Query  100    SLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYE  159
              +LI E   +D       + +A    +  ++KQ V N      G+++     L++  V   
Sbjct  90951  ALIAESHRYDLFKPFNPVDAAATFKNAQNFKQGVVNKQA--GGVHYL----LKNAGVTIL  90790

Query  160    NFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTC-PGGEHAISSDDIFWMKK  218
                  S VD HT  L         I+ +++++A G RP EL   P G   +SS +   + +
Sbjct  90789  EGEASLVDEHT-ALIQQAGQDHSISFKNLILATGSRPIELPAFPVGGRILSSTEALSLAE  90613

Query  219    KEPGKTLVVGASYVALECAGFLKGMGYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGI  277
                P   +V+G  Y+ +E        G  V ++   + +L GF+ + A  + + ++   GI
Sbjct  90612  V-PSSLVVIGGGYIGVELGQMYAKFGTKVTILEGGAQVLPGFETEFAAPVVKQLKA-DGI  90439

Query  278    EFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV-AKLGLDKARVK  336
              + +   + + +   +N   +    ++  E  +   + VL   GR P+   +LGL++  + 
Sbjct  90438  QIVTGAIAEKVE--QNADSITLHYSKSQEQHQVTAEYVLVTIGRKPNTDGQLGLERMGLP  90265

Query  337    LNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDK  395
              +  K G +    + +T  P+IYAIGD+   P L   A    ++ +  +    T+++DY  
Sbjct  90264  VTSK-GLVETDEQCRTMIPHIYAIGDITAGPALAHKASYEAKVAAEAI-AGLTSKVDYKV  90091

Query  396    ICTAVFTPIEYGCCGLSEEDSKER-----YGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
              I   VF+  E    G+SE ++K +      G+ +  +  +     E              
Sbjct  90090  IPLVVFSDPELSSVGVSETEAKAQAIPVVIGKSSFGINGRALALRET-----------EG  89944

Query  451    YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              ++K++ D      V+G   +G  A  +   + LA+++G T + +  T+  HP
Sbjct  89943  FVKIVADPASG-IVIGAQIVGVEASTLISELALAIEMGATVEDLAMTIHPHP  89791

>PYIR:scaffold_544 pir_scaffold_544 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_544:1:21581:1 
REF
Length=21581

 Score = 143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 135/490 (28%), Positives = 212/490 (43%), Gaps = 42/490 (9%)
 Frame = -1

Query  28    SAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  87
             SA   +  S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+N
Sbjct  6323  SARAFSSASTEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLN  6168

Query  88    VGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKY  147
             VGCIP K +  S+ +     HD A +G  +     S  + ++ +++ + +  ++ +    
Sbjct  6167  VGCIPSKALLHSTHLYHSAQHDFAKYGIEV-----SEVSMNFGKMMKSKEKAVKTLTGGI  6003

Query  148   KVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR-----PKELTCP  202
             +   +   V Y    G  V  + + +     G + +T ++++IA G       P  +   
Sbjct  6002  EQLFKKNKVTYIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNA  5823

Query  203   GGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLR---GF  259
              G+   S+  +    KK P   +VVGA  + LE     K +G   KV V   L R   G 
Sbjct  5822  AGKIVDSTGALEL--KKVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGL  5655

Query  260   DQDMANKIGEYMEVQS-GIEFIRKTVPQSIT----KLENGQLLVKWTTEDGESCEEAFDT  314
             D ++  +  + ++ Q  G EF  K     +      L             G +     D 
Sbjct  5654  DLELGKEFTKLLKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDA  5475

Query  315   VLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAI  373
             VL ATGR P    LGL+   ++  +K GRI V +  +T  PNI+AIGDVI  P L   A 
Sbjct  5474  VLVATGRRPYTNGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAE  5298

Query  374   QAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433
             + G   +  +       ++Y+ I   ++T  E    G +EE  KE       E    N  
Sbjct  5297  EEGIACAETIAGKH-GHVNYNAIPGVIYTFPEVASVGKTEEQLKE-------EGVTYNVG  5142

Query  434   PLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  492
                   +   R   E+   +KVI DK  DK ++G H +  NAGE+     L M+ G + +
Sbjct  5141  KFPMLANSRARAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSE  4965

Query  493   QMVDTVGIHP  502
              +  T   HP
Sbjct  4964  DIARTCHAHP  4935

>PHPA:scaffold_79 NW_008649065.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.79, whole genome shotgun 
sequence
Length=269151

 Score = 121 bits (303),  Expect(3) = 9e-34, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 129/252 (51%), Gaps = 17/252 (7%)
 Frame = +3

Query  261     QDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATG  320
               QD+     E   V+ G+     +    + +  +G   V  T  DG S    +D V+ A G
Sbjct  100443  QDIVRTTLEDAMVKDGVHLRPHSNVARVEQAADGTKTVVLT--DG-SEYNGYDVVMYAAG  100613

Query  321     RDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLL  379
               R P  + L LDKA V  +E  G I V   ++TS   + A+GDV   P LTPVAI AGR L
Sbjct  100614  RVPLTSNLQLDKAGVTTDEH-GFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRL  100790

Query  380     SRRLY---NNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLE  436
               S RL+   NNS  ++ Y+ I T VF+    G  GL+E+ ++ +YG+D ++VY   FV + 
Sbjct  100791  SDRLFGGLNNS--KVSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMY  100964

Query  437     WSLSEETRTAA------ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  490
               + L  E   +           +K++C    +K VVG H +G  A E+ Q  G+A+K+G T
Sbjct  100965  YGLINEVDESTGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGAT  101141

Query  491     YDQMVDTVGIHP  502
                    + + IHP
Sbjct  101142  KADFDNCIAIHP  101177

 Score = 42.0 bits (97),  Expect(3) = 9e-34, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 34/63 (54%), Gaps = 2/63 (3%)
 Frame = +2

Query  199     LTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLR  257
               L+  G E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR
Sbjct  100190  LSLAGKELCIDSDGFFELEIL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLR  100366

Query  258     GFD  260
                FD
Sbjct  100367  SFD  100375

 Score = 25.4 bits (54),  Expect(3) = 9e-34, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  181     KQITTRDVVIAVGGRPKELTCPG  203
               K++  ++V+IAVGG+P     PG
Sbjct  100069  KELLAKNVLIAVGGKPLIPDIPG  100137

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 71/125 (57%), Gaps = 15/125 (12%)
 Frame = +2

Query  28     SAVDEAETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCV  86
              SA    +T YDY  +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCV
Sbjct  99557  SASRAPQTEYDY--LVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCV  99703

Query  87     NVGCIPKKLMHQSSLIGELMHHDSANFGWNIASAD---GSASTFSWKQLVANVDGYIRGI  143
              NVGC+PKKLM  ++ +   + HD  ++G+   +     G  + F W +L A  D Y+  +
Sbjct  99704  NVGCVPKKLMFIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRL  99883

Query  144    NFKYK  148
              N  Y+
Sbjct  99884  NGIYE  99898

>PHKE:scaffold_1 scf_22126_1.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_1.1_contig_1:1:510348:1 
REF
Length=510348

 Score = 135 bits (341),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 128/474 (27%), Positives = 226/474 (48%), Gaps = 35/474 (7%)
 Frame = -1

Query  34      ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
               + S + D +VIG G GG   +  AA  GQ V ++D  +         LGG C+N GCIP 
Sbjct  393441  DASLNIDTLVIGAGPGGYVAAIRAAQLGQSVLIVDKSE---------LGGVCLNRGCIPS  393289

Query  94      KLMHQSSLIGELMHHDSANFGWNIA-SADGSASTFSWKQLVANVDGYIRGINFKYKVELR  152
               K     +LI     ++SA  G     SA+     FS  Q   N  G ++ +       L+
Sbjct  393288  K-----ALISAAHQYESALHGEAFGISAENVKVDFSKTQEFKN--GVVKKMTGGVAGLLK  393130

Query  153     SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELT-CPGGEHAISSD  211
                  V+  N    F++ +   +++  + + +   ++ +IA G RP EL   P G   +SS 
Sbjct  393129  GNKVEVFNGECMFINENEARVFNDHE-SPRYKFKNAIIATGSRPIELKPFPFGGRILSST  392953

Query  212     DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMV-RSILLRGFDQDMANKIGEY  270
               +   + +  P   +V+G  Y+  E        G  V ++     +L GFD+DM + + + 
Sbjct  392952  EALNLPEV-PKSMIVIGGGYIGAELGQMYSKFGAKVTIIEGLDTVLPGFDKDMTSLVAKN  392776

Query  271     MEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV-AKLG  329
               M+ ++GIE +     +S  + +   + VK++  +GES E   D +L   GR P+   +LG
Sbjct  392775  MK-KTGIEIVTGAKAESAEQTDK-DVTVKYSV-NGESKEVTADYLLVTVGRRPNTDGELG  392605

Query  330     LDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNST  388
               LD   V ++E+ G + V ++ +TS P+I+AIGD++    L   A   G++ +  +    +
Sbjct  392604  LDLIGVDVDER-GFVKVDHQGRTSIPHIFAIGDIVSGLALAHKASYEGKVAAEAIAGQPS  392428

Query  389     AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAE  448
                 +DY  +   VFT  E    G +E+++KE+      +V    F P   +    +   AE
Sbjct  392427  V-VDYKCMPAVVFTDPECSSVGYTEKEAKEK----GYKVKAGKF-PYAGNGRAVSLNHAE  392266

Query  449     SCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                 ++K++ D+     V+G   +G  A  +   +GLA+++G T + +  T+  HP
Sbjct  392265  G-FVKIVADE-ESGLVLGCQIVGLEASNLIAELGLAIEMGATLEDLALTIHAHP  392110

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/264 (25%), Positives = 121/264 (46%), Gaps = 34/264 (13%)
 Frame = -3

Query  141    RGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELT  200
              +G+  ++++++R+K       +    D  T+++    +G  + +  +++++ G RP    
Sbjct  99052  KGMADRFRIDVRTK----SEVIAINPDNRTVQVQSHERGQYEESYDELILSPGARPIIPD  98885

Query  201    CPGGEHAI-----SSDDIFWMKKK----EPGKTLVVGASYVALECAGFLKGMGYDVKVMV  251
               PG ++ +     S  DI  +K++         +V+G  ++ +E A  LK  G DV ++ 
Sbjct  98884  LPGKDNPLIFTVRSIPDIDRIKEQVNSDNNASVIVIGGGFIGVEMAENLKEAGLDVTLVE  98705

Query  252    -RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEE  310
                  LL  FD ++A  + + ME Q G++ +     Q     E G   +     DG     
Sbjct  98704  GNGQLLTPFDPELAASLAQEME-QHGVKLLFSQRVQGFQSREQG---IGVELADGRVL--  98543

Query  311    AFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVID-----  364
              A D V+ A G  PD + L    + V L  + G I V    ++S P+IYA+GD I+     
Sbjct  98542  AADLVILAIGVAPDTSFL--QHSGVSLGAR-GHIMVNEALESSVPHIYAVGDAIEVKDYI  98372

Query  365    -----APELTPVAIQAGRLLSRRL  383
                   A  L   A + GR+++ R+
Sbjct  98371  HGTKTAIPLAGPANKQGRIVADRI  98300

>HYAP:scaffold_208 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_208:1:99469:1 
REF
Length=99469

 Score = 134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 131/477 (27%), Positives = 211/477 (44%), Gaps = 41/477 (9%)
 Frame = +2

Query  38     DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
              DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  38045  DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  38200

Query  98     QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
               S+ +     H+  ++G      D    T ++ Q++   +  +R +    +       V 
Sbjct  38201  HSTHLLHTAQHEFKSYGI-----DAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  38365

Query  158    YENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSD  211
              Y   +G       + +    R+G   +T +++++A G       P  +    G+   S+ 
Sbjct  38366  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  38545

Query  212    DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEY  270
               +   +   P   +VVGA  + LE     K +G  V V+        G D+    +  + 
Sbjct  38546  ALALTRV--PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKL  38719

Query  271    MEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDPDVAK  327
              ++ Q G+EF   T    +T  E    +V  TTE    G+      DTVL ATGR    A 
Sbjct  38720  LKKQ-GLEFQFGT---KVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAG  38887

Query  328    LGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  386
              LGL++  ++  +K GRI V +  QT  P ++AIGDVI    L   A + G      +   
Sbjct  38888  LGLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGK  39064

Query  387    STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
                  ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   RT 
Sbjct  39065  H-GHVNYGAIPNVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PMMA--NSRARTV  39220

Query  447    AES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  39221  AEADGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  39388

>PHKE:scaffold_35 scf_22126_35.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_35.1_contig_1:1:159504:1 
REF
Length=159504

 Score = 132 bits (333),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 127/482 (26%), Positives = 224/482 (46%), Gaps = 52/482 (11%)
 Frame = +2

Query  40      DLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK-LMHQ  98
               D+ ++GGG+GG   +  AA  G++V +++  K         LGGTC++ GCIP K L+  
Sbjct  106043  DVAILGGGTGGYVAAIRAAQLGKQVVIIEKDK---------LGGTCLHRGCIPSKALLRS  106195

Query  99      SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
               + +  E+   +S  +G   A A     T  + ++ A  D  +  ++   +  ++   ++ 
Sbjct  106196  AEVYAEI--QESEAYGIETAGA-----TLVFPKVQARKDAIVEQLHQGVQYLMKKNKIQV  106354

Query  159     ENFLGSFVDAHTLELWHPRKGTKQITTRD----------VVIAVGGRPKELTC--PGGEH  206
                +  G  +      ++ P+ G   +   D          ++IA G RP+ L    P G +
Sbjct  106355  VHANGRVIGP---SIFSPQSGAVAVEFEDGEMDTVVPTNLIIATGSRPRVLPGLEPDGRY  106525

Query  207     AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMAN  265
                +SSD+   M +  P   ++VG   + LE A  L   G +V V+   + +L   D+D+A 
Sbjct  106526  IMSSDEALRMDEL-PASLIIVGGGVIGLEWASMLNDFGVEVTVVEAAAHVLPAEDEDVAK  106702

Query  266     KIGEYMEVQSGIEFIR--KTVPQSITKLENG-QLLVKWTTEDGESCEEAFDTVLNATGRD  322
               ++   +  + G+ F+     + ++ +  ++G Q+ VK   E  E+     D +L + GR 
Sbjct  106703  EMQRLLG-KRGVRFLTGASVLTETYSVEKDGIQIDVKLGDEKQETLRA--DKMLVSVGRQ  106873

Query  323     PDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  381
                +V  +GL+   +KL+   G I V N  QT   +IYAIGDVI   +L   A   G L   
Sbjct  106874  ANVENIGLENTDIKLDR--GFIAVNNHLQTGEGHIYAIGDVIGGLQLAHAASHEGILAVN  107047

Query  382     RLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSE  441
                L   +   ++  +I   V+T  E    G +E ++KER      EV    F P + ++ +
Sbjct  107048  HLAGETVHAVESHRIPRCVYTRPEAASIGFTEREAKER----GYEVKTGKF-PFQ-AIGK  107209

Query  442     ETRTAAESCYLKVICD-KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  500
                    +   ++KVI D KT D  ++G H +G +  E+     LA  L  T  ++  T+  
Sbjct  107210  SLVHGSRDGFVKVIADAKTND--ILGVHMIGTHVTELIAEASLAQMLDATPWEVGQTIHP  107383

Query  501     HP  502
               HP
Sbjct  107384  HP  107389

>HYAP:scaffold_32 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_32:1:492606:1 
REF
Length=492606

 Score = 129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 10/204 (5%)
 Frame = -2

Query  307     SCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDA  365
               S    FD V+ A GR P   KL LD A V  N K G I V   ++TS   ++A+GDV   
Sbjct  182705  SAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KHGYIVVNEFQETSNSKVFAVGDVCGT  182529

Query  366     PELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDN  424
               P LTPVA+ AGR LS RL+ N   A++ Y+ I T VF+    G  GL+E+ ++ +YG+D+
Sbjct  182528  PALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTVVFSHPPIGTIGLTEKQAQGKYGDDD  182349

Query  425     IEVYHKNFVPLEWSLSEETRTAA------ESCYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
               I+VY  +FV + + L  E   A           +K++C   ++K VVG H +G  A E+ 
Sbjct  182348  IKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIKLVCAGKKEK-VVGLHMIGMAADEIL  182172

Query  479     QAMGLAMKLGFTYDQMVDTVGIHP  502
               Q  G+A+K+G T     + + IHP
Sbjct  182171  QGFGVAVKMGATKADFDNCIAIHP  182100

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%), Gaps = 13/115 (11%)
 Frame = -3

Query  38      DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
               +YD +VIGGGSGG+A ++ AAS+   +V V+++ +         LGGTCVNVGC+PKKLM
Sbjct  183745  EYDYLVIGGGSGGIASARRAASYPNTRVAVVEHAR---------LGGTCVNVGCVPKKLM  183593

Query  97      HQSSLIGELMHHDSANFGWNIASADGSAST---FSWKQLVANVDGYIRGINFKYK  148
                 ++ +   + HD  ++G+      GS      F W +L    D Y+R +N  Y+
Sbjct  183592  FLAADMSHKLQHDVVHYGFEKEGTGGSLGAQMHFDWTKLKTRRDAYVRRLNGIYE  183428

 Score = 38.1 bits (87),  Expect(2) = 0.006, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 31/59 (53%), Gaps = 2/59 (3%)
 Frame = -3

Query  203     GGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  260
               G E  I SD  F +    P K  V+GA Y+A+E AG L  +G +  +  R   +LR FD
Sbjct  183073  GKELCIDSDGFFELDTL-PKKVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFD  182900

 Score = 25.4 bits (54),  Expect(2) = 0.006, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  181     KQITTRDVVIAVGGRPKELTCPG  203
               K++  ++V+IAVGG+P     PG
Sbjct  183215  KEVLAKNVMIAVGGKPMIPDIPG  183147

>PHKE:scaffold_66 scf_22126_66.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_66.1:1:120469:1 
REF
Length=120469

 Score = 127 bits (319),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 116/204 (57%), Gaps = 10/204 (5%)
 Frame = -2

Query  307     SCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDA  365
               S    +D V+ A GR P  + L LDKA +   +K G I V K ++TS   + A+GDV   
Sbjct  106803  SEHSGYDVVIYAAGRVPLTSTLKLDKAGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGT  106627

Query  366     PELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDN  424
               P LTPVAI AGR LS RL+     A++ Y+ I T VF+    G  GL+EE ++++YG+D+
Sbjct  106626  PALTPVAIAAGRRLSDRLFGGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDS  106447

Query  425     IEVYHKNFVPLEWSL-SEETRTAAE-----SCYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
               I+VY   FV + + L +E   T  E        +K++C   +D+ VVG H +G  A E+ 
Sbjct  106446  IKVYTSRFVNMYYGLINEMDETTGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEIL  106270

Query  479     QAMGLAMKLGFTYDQMVDTVGIHP  502
               Q  G+A+K+G T     + + IHP
Sbjct  106269  QGFGVAVKMGATKADFDNCMAIHP  106198

 Score = 108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 132/298 (44%), Gaps = 71/298 (24%)
 Frame = -3

Query  22      HDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWG  80
               H     SA    +T YDY  +VIG GSGG+A ++ AAS+ G +V V++  +         
Sbjct  107867  HLARALSASRALQTEYDY--LVIGAGSGGMASARRAASYPGTRVAVVEQAR---------  107721

Query  81      LGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSAST---FSWKQLVANVD  137
               LGGTCVNVGC+PKKLM  ++ +G  +HHD  ++G+  A++ G  S    F W +L    D
Sbjct  107720  LGGTCVNVGCVPKKLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRD  107541

Query  138     GYIRGINFKYK------------------VELRSKYVKY---ENFLGSFVDAHTLELWHP  176
                Y+  +N  Y+                  V   S +V      N   S V+         
Sbjct  107540  AYVLRLNGIYERLEHNRSKTKGDQLSDTNVVFASLFVALGGCRNLANSKVELIRGSAAFN  107361

Query  177     RKGT-----KQITTRDVVIAVGGRPK---------------------------ELTC-PG  203
                 G      K++  ++V+IAVGG+P                             L C  G
Sbjct  107360  DNGNVVVDGKEVRAKNVLIAVGGKPMIPDIPGTCLVG*QIAADCED*TGSWYLLLAC*TG  107181

Query  204     GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  260
                E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD
Sbjct  107180  KELCIDSDGFFELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFD  107010

>PYVX:scaffold_632 pve_scaffold_632 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_632:1:17512:1 
REF
Length=17512

 Score = 126 bits (317),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 125/434 (29%), Positives = 198/434 (46%), Gaps = 33/434 (8%)
 Frame = +1

Query  81    LGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNI--ASADGSASTFSWKQLVANVDG  138
             LGGTC+NVGCIP K +  S+ +     HD A +G  +    A+      + ++ V  + G
Sbjct  8434  LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKANLGGMMKAKEKAVTTLTG  8613

Query  139   YIRGINFKYKVELRSKYVKYENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGRPK  197
              I  +  K KV     Y+K     G  V  + + +  +  KG + +T ++++IA G  P 
Sbjct  8614  GIESLFKKNKV----TYIKGH---GKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSEPA  8772

Query  198   EL---TCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  254
              L        +  I          K P   +VVGA  + LE     K +G   KV V   
Sbjct  8773  PLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVVEF  8946

Query  255   LLR---GFDQDMANKIGEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTTEDGESCEE  310
             L R   G D +++ +  + ++ Q G+EF   T V  S  K +N  L V+ +   G +   
Sbjct  8947  LDRACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVEPSA-GGSAASI  9120

Query  311   AFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELT  369
               DTVL ATGR P    LGL++  ++  +K GR+ V +  +T  PNIYA GDVI    L 
Sbjct  9121  ECDTVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHFRTQIPNIYAFGDVIKGAMLA  9297

Query  370   PVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYH  429
               A + G +    + +     ++YD I   ++T  E    G +EE+ K        E   
Sbjct  9298  HKAEEEG-VACAEIISGKHGHVNYDAIPGVIYTTPEVASVGKTEEELKN-------EGVT  9453

Query  430   KNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  488
              N        +   RT AE+  ++K++ DK  D+ ++G H +  NAGE+     L ++ G
Sbjct  9454  YNVGKFPMMANSRARTIAEADGFVKILADKATDR-ILGVHIIAGNAGEMVAEGVLGLEYG  9630

Query  489   FTYDQMVDTVGIHP  502
              + + +  T   HP
Sbjct  9631  ASSEDIARTCHAHP  9672

>PHKE:scaffold_13 scf_22126_13.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_13.1_contig_1:1:238434:1 
REF
Length=238434

 Score = 126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 126/472 (27%), Positives = 205/472 (43%), Gaps = 55/472 (12%)
 Frame = +2

Query  35     TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
              T   YDL+ IG GS   +     A  G K+ V+D  +          GGTC   GC PKK
Sbjct  17480  TQQPYDLIAIGTGSAASSVISRCAEAGWKIAVIDERE---------FGGTCALRGCDPKK  17632

Query  95     LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
              ++  ++   EL+  +    G  +   +G+AS   W +L+A    +   +      E + K
Sbjct  17633  VLAGAA---ELIDWNERMKGKGV---EGNAS-IRWSELMAFKRTFTESV--PRASEDKFK  17785

Query  155    YVKYENFLG--SFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  212
                  + F G  SFVD       H R G + +  + ++IA G RP  L   G EH I SDD
Sbjct  17786  QAGMDTFHGKASFVDED-----HIRVGDEILQGKHILIATGARPAPLPIDGAEHLIYSDD  17950

Query  213    IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMAN------  265
               F   ++ P K ++VG  Y+A E A      G +V ++ R    L+ FD ++ +      
Sbjct  17951  -FLDLEQLPDKLVLVGGGYIAFEFAHIAARAGTEVHIIHRGEEPLKQFDSELVDLLLKKS  18127

Query  266    -KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPD  324
               ++G ++ + + ++ IR          + G   V   T +G   +     V++  GR P+
Sbjct  18128  EEVGIHVHLNAEVKAIR----------QQGNTYVVSGTRNGADHQWQCGLVVHGAGRIPN  18277

Query  325    VAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDV--IDAPELTPVAIQAGRLLSRR  382
              +  L L+K  V   +K   +    +  S   ++A GDV   +   LTP+A Q  R +S  
Sbjct  18278  IEGLELEKGNVSYTKKGIIVNEYLQSESNSRVFAAGDVSATEGLPLTPLAGQESRAVSLN  18457

Query  383    LYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEE  442
              L   +  + +Y  + + VFT    G  GL  E +K+   E  +    K +          
Sbjct  18458  LLEGNHHKPNYKVMPSIVFTVPSLGSVGLDVEQAKKEGYEVKVNDMSKWYT--------Y  18613

Query  443    TRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  494
               RT  +    KVI DK   + ++G H LG    E+     +A++   T DQ+
Sbjct  18614  KRTNEKFAMAKVITDKASGR-ILGAHVLGGKTEELINLFAMAIQFDLTTDQL  18766

>PHSO:scaffold_4
Length=7609242

 Score = 125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 109/199 (55%), Gaps = 10/199 (5%)
 Frame = +1

Query  312     FDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELTP  370
               +D V+ A GR P  + L LDKA V   +K G I V   ++TS   + A+GDV   P LTP
Sbjct  400513  YDVVIYAAGRVPLTSNLQLDKAGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTP  400689

Query  371     VAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYH  429
               VAI AGR LS RL+     A++ Y+ I T VF+    G  GL+EE ++ +YG+D I+VY 
Sbjct  400690  VAIAAGRRLSDRLFGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYT  400869

Query  430     KNFVPLEWSLSEETRTAA------ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGL  483
                 FV + + L  E   A           +K++C    +K VVG H +G  A E+ Q  G+
Sbjct  400870  SRFVNMYYGLINEMDEATGEPKDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGV  401046

Query  484     AMKLGFTYDQMVDTVGIHP  502
               A+K+G T     + V IHP
Sbjct  401047  AVKMGATKADFDNCVAIHP  401103

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 72/132 (55%), Gaps = 14/132 (11%)
 Frame = +1

Query  22      HDPSTPSAVDEAET-SYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSW  79
               H P    A+  +     +YD +VIG GSGG+A ++ AAS+ G +V V++  +        
Sbjct  399436  HAPRLARALSASRALQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR--------  399591

Query  80      GLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGW---NIASADGSASTFSWKQLVANV  136
                LGGTCVNVGC+PKKLM  ++ +   +HHD  ++G+         G  + F W +L A  
Sbjct  399592  -LGGTCVNVGCVPKKLMFIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARR  399768

Query  137     DGYIRGINFKYK  148
               D Y+  +N  Y+
Sbjct  399769  DAYVLRLNGIYE  399804

 Score = 40.8 bits (94),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +3

Query  203     GGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  260
               G E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD
Sbjct  400128  GKELCIDSDGFFELETL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD  400301

 Score = 26.2 bits (56),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  181     KQITTRDVVIAVGGRPKELTCPG  203
               K+I  ++V+IAVGG+P     PG
Sbjct  399989  KEILAKNVMIAVGGKPLIPDIPG  400057

>PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:pug:scf1117875582032:1:863081:1 
REF
Length=863081

 Score = 124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 138/481 (29%), Positives = 215/481 (45%), Gaps = 46/481 (10%)
 Frame = +3

Query  36      SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
               S DYD+VVIGGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K 
Sbjct  652233  SSDYDVVVIGGGPGGYVAAIKAAQLGLKTACIE-----SRGT---LGGTCLNVGCIPSKA  652388

Query  96      MHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKY  155
               +  S+ +     HD + +G  +     S  +  + +L+ + D  ++ +    +   +   
Sbjct  652389  LLHSTHLYHSAQHDFSKYGIEV-----SGVSMDFGKLMKSKDKAVKTLTGGIEQLFKKNK  652553

Query  156     VKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISS  210
               V Y    G  V  + + +     G + ++ ++++IA G       P  +    G+   S+
Sbjct  652554  VTYIKGHGKIVAKNEIAVTLNDSGNQTVSAKNILIATGSEVTPLPPVPVDNAAGKIVDST  652733

Query  211     DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLR---GFDQDMANKI  267
                 +    KK P   +V+GA  + LE     K +G   KV V   L R   G D ++  + 
Sbjct  652734  GALEL--KKVPEHLVVIGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEF  652901

Query  268     GEYMEVQS-GIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDP  323
                + ++ Q  G EF  K    + +K++  +  V  TTE    G +     D VL ATGR P
Sbjct  652902  TKLLKKQGLGFEFSTKV---TASKVDGDK--VTLTTEPAAGGAASTIECDAVLVATGRRP  653066

Query  324     DVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRR  382
                   LGL+   ++  +K GRI V    +T  PNI+AIGDVI  P L   A + G +    
Sbjct  653067  FTGGLGLENMGIQ-TDKFGRIQVDEHFRTQIPNIFAIGDVIAGPMLAHKAEEEG-IACVE  653240

Query  383     LYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEE  442
                       ++Y+ I   ++T  E    G +EE  KE       E    N        +  
Sbjct  653241  TIAGKHGHVNYNAIPGVIYTFPEVASVGKTEEQLKE-------EGVAYNVGKFPMLANSR  653399

Query  443     TRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  501
                R   E+   +KVI DK  DK ++G H +  NAGE+     L M+ G   + +  T   H
Sbjct  653400  ARAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAH  653576

Query  502     P  502
               P
Sbjct  653577  P  653579

>PHIF:NW_003303731.1 Phytophthora infestans T30-4 supercont1.28 
genomic scaffold, whole genome shotgun sequence
Length=2122445

 Score = 122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 110/199 (55%), Gaps = 10/199 (5%)
 Frame = +3

Query  312      FDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELTP  370
                +D V+ A GR P  + L LDKA +  +E  G I V   ++TS   + A+GDV   P LTP
Sbjct  1898991  YDVVIYAAGRVPLTSNLQLDKAGITTDEH-GFIPVNELQETSNSKVLAVGDVCGTPALTP  1899167

Query  371      VAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYH  429
                VAI AGR LS RL+   + A++ Y+ I T VF+    G  GL+EE ++ +YG+D I+VY 
Sbjct  1899168  VAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDAIKVYT  1899347

Query  430      KNFVPLEWSLSEETRTAA------ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGL  483
                  FV + + L  E   +           +K++C    +K VVG H +G  A E+ Q  G+
Sbjct  1899348  SRFVNMYYGLINEVDESTGEPKDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGV  1899524

Query  484      AMKLGFTYDQMVDTVGIHP  502
                A+K+G T     + + IHP
Sbjct  1899525  AVKMGATKADFDNCIAIHP  1899581

 Score = 81.6 bits (200),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 97/204 (48%), Gaps = 52/204 (25%)
 Frame = +2

Query  38       DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
                +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  1897976  EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  1898128

Query  97       HQSSLIGELMHHDSANFGWNIASAD---GSASTFSWKQLVANVDGYIRGINFKYK-----  148
                  ++ +   + HD  ++G+   +     G  + F W +L A  D Y+  +N  Y+     
Sbjct  1898129  FIAADMSHKLRHDLLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYER*RID  1898308

Query  149      ------VE-----------------------LRSKYVKYENFLGSFVDAHTLELWHPRKG  179
                      VE                       L +  V+    L +F +   +E+     G
Sbjct  1898309  EGISTTVEKATNRCNVNGDIILMLLLYASRNLANSKVELIRGLATFNEKGNVEV-----G  1898473

Query  180      TKQITTRDVVIAVGGRPKELTCPG  203
                 K++  ++V+IAVGG+P     PG
Sbjct  1898474  GKELLAKNVLIAVGGKPLIPDLPG  1898545

 Score = 40.4 bits (93),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +1

Query  203      GGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  260
                G E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD
Sbjct  1898614  GKELCIDSDGFFELETL-PKKVAVVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD  1898787

>PHCA:scaffold_20 PHYCAscaffold_20
Length=899172

 Score = 122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 110/199 (55%), Gaps = 10/199 (5%)
 Frame = +1

Query  312     FDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELTP  370
               ++ V+ A GR P    L LDKA V   +  G I V   +QTS  N++A+GD    P LTP
Sbjct  776398  YEVVIYAAGRVPLTTSLQLDKAGVT-TDNHGFIQVDEYQQTSNSNVFAVGDACGTPALTP  776574

Query  371     VAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYH  429
               VAI AGR LS RL+     A++ Y+ I T VF+    G  GL+E  ++ +YG+D I+VY 
Sbjct  776575  VAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSHPPIGTIGLTEAQARCKYGDDEIKVYT  776754

Query  430     KNFVPLEWSL----SEETRTAAE--SCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGL  483
                 FV + + L     EET    +     +K++C   +D+ VVG H +G  A E+ Q  G+
Sbjct  776755  SRFVNMYYGLINEIDEETGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGV  776931

Query  484     AMKLGFTYDQMVDTVGIHP  502
               A+K+G T     D + IHP
Sbjct  776932  AVKMGATKADFDDCIAIHP  776988

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 80/148 (54%), Gaps = 16/148 (11%)
 Frame = +1

Query  6       LSIQESALNTKKNMQI-HDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF-GQK  63
               L +Q   L TK  +Q  H     +A    ET YDY  +VIG GSGG+A ++ AAS+ G +
Sbjct  775321  LRLQFKMLRTKLTLQTPHLARALNASRTLETKYDY--LVIGAGSGGMASARRAASYPGTR  775494

Query  64      VCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWN---IASA  120
               V V++  +         LGGTCVNVGC+PKKLM  ++ +   +HHD  ++G+        
Sbjct  775495  VAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHDFLHYGFEDEVTGGH  775647

Query  121     DGSASTFSWKQLVANVDGYIRGINFKYK  148
                G  + F W +L A  D Y+  +N  Y+
Sbjct  775648  LGKRTHFDWPKLKARRDAYVLRLNGIYE  775731

 Score = 45.4 bits (106),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 46/99 (46%), Gaps = 20/99 (20%)
 Frame = +2

Query  181     KQITTRDVVIAVGGRP------------------KELTCPGGEHAISSDDIFWMKKKEPG  222
               K+I   +V+IAVGG+P                   +    G E  I SD  F ++   P 
Sbjct  775892  KEILADNVMIAVGGKPLIPDIPGAYLFTTGKLGGTDFVLAGKELCIDSDGFFELETL-PK  776068

Query  223     KTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  260
               K  VVGA Y+A+E AG L  +G +  +  R   +LR FD
Sbjct  776069  KVAVVGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFD  776185

>PHKE:scaffold_531 scf_22126_531.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_531.1:1:20776:1 
REF
Length=20776

 Score = 118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 132/490 (27%), Positives = 222/490 (45%), Gaps = 41/490 (8%)
 Frame = -1

Query  25    STPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGT  84
             + P       +S +YD+VVIGGG GG   + +AA  G K   ++        +   LGGT
Sbjct  4498  AAPMTARTFSSSSEYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGT  4343

Query  85    CVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGIN  144
             C+NVGCIP K +  S+ +     HD  ++G      D      ++ Q++   +  ++ + 
Sbjct  4342  CLNVGCIPSKALLHSTHLLHTAQHDFKSYGI-----DAPGVKANFPQMMKAKEKAVKTLT  4178

Query  145   FKYKVELRSKYVKYENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKE  198
                ++  +   V Y    G       + +     KG + +  ++++IA G       P  
Sbjct  4177  GGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPLPPVP  3998

Query  199   LTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLR  257
             +    G+   S+  +    K+ P   +VVGA  + LE     K +G  V V+  +     
Sbjct  3997  VDNEAGKIIDSTGALVL--KRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACP  3824

Query  258   GFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAF---DT  314
             G D++   +  + ++ Q G++F   T    +T  E    +VK TTE  +  +EA    DT
Sbjct  3823  GMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASIECDT  3656

Query  315   VLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAI  373
             VL ATGR    A LGL++  ++  +K GR+ V +  +T  P I+AIGDVI    L   A 
Sbjct  3655  VLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAMLAHKAE  3479

Query  374   QAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433
             + G      +       ++Y  I   ++T  E+   G +EE+ K    E N+  +     
Sbjct  3478  EEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----  3317

Query  434   PLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  492
             P+    +   RT AE+   +KV+ DK  DK  +G H +  NAGE+     +A++ G + +
Sbjct  3316  PMMA--NSRARTVAEADGLVKVLSDKKTDKM-LGVHIIASNAGEMIAEGVIALEYGASSE  3146

Query  493   QMVDTVGIHP  502
              +  T   HP
Sbjct  3145  DIARTCHAHP  3116

>PHRA:scaffold_109
Length=149230

 Score = 118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 147/512 (29%), Positives = 229/512 (45%), Gaps = 55/512 (11%)
 Frame = +1

Query  6      LSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVC  65
              LS + SAL +        P T  A   A  S DYD+VVIGGG GG   + +AA  G K  
Sbjct  67291  LSRRSSALRSA------SPLTARAFSSA--SSDYDVVVIGGGPGGYVAAIKAAQLGFKTA  67446

Query  66     VLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSAS  125
               ++        +   LGGTC+NVGCIP K +  S+ +     HD  ++G +   A G  +
Sbjct  67447  CVE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGID---APGVTA  67593

Query  126    TF-----SWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGT  180
               F     + ++ V  + G I  +  K KV     Y K                 +  KG 
Sbjct  67594  NFPQMMKAKEKAVTTLTGGIESLFKKNKVTYIKGYGKVS------AQGEVSVALNDNKGN  67755

Query  181    KQITTRDVVIAVGGRPKELTCPGGEHA----ISSDDIFWMKKKEPGKTLVVGASYVALEC  236
              + +  ++++IA G     L     ++A    I S     + +  P   +VVGA  + LE 
Sbjct  67756  ETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALALTRV-PEHLVVVGAGVIGLEL  67932

Query  237    AGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ  295
                  K +G  V V+  +     G D++   +  + ++ Q G++F   T    +T  E   
Sbjct  67933  GSVYKRLGSKVTVVEFQDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KVTASEVNG  68100

Query  296    LLVKWTTEDGESCEEAF---DTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QT  351
               +VK TTE  +    A    DTVL ATGR    A LGL++  ++  +K GRI V +  +T
Sbjct  68101  DVVKLTTEAAKGGNAATIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDDAFRT  68277

Query  352    STPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGL  411
                P I+AIGDVI    L   A + G      +       ++Y  I   ++T  E+   G 
Sbjct  68278  QVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGK  68454

Query  412    SEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYL  470
              +EE+ K    E N+  +     P+    +   RT AE+   +KV+ DK  DK ++G H +
Sbjct  68455  TEEELKAEGIEYNVGKF-----PMMA--NSRARTVAEADGLVKVLADKKTDK-MLGVHII  68610

Query  471    GPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                NAGE+     +A++ G + + +  T   HP
Sbjct  68611  ASNAGEMISEGVIALEYGASSEDIARTCHAHP  68706

>APAS:scaffold_24 supercont1.24 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.24:1:781221:1 
REF
Length=781221

 Score = 117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/237 (36%), Positives = 131/237 (55%), Gaps = 17/237 (7%)
 Frame = -3

Query  33      AETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  92
               + TSYDY  +V+GGGSGG++ ++ AAS+G  V V++  +   QG + GLGGTCVNVGC+P
Sbjct  417907  STTSYDY--IVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVP  417743

Query  93      KKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELR  152
               KK+M+ ++   E++H   A     +   D    +F W  +    D Y+  ++  Y+  L 
Sbjct  417742  KKVMYNAAFHAEILHSAKAYAFKGV--QDVGFGSFDWATMKTKRDSYVARLHGIYERNLA  417569

Query  153     SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  212
                  +   +   SFVD HT+ +          T   +++AVGG P+  + PG EHAISSD 
Sbjct  417568  KDNITLVSGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISSDG  417404

Query  213     IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD---QDMAN  265
                F + + +P K  V+GA Y+A+E AG    +  +  V  R   +LR FD   +D+ N
Sbjct  417403  FFGL-ETQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVN  417236

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 10/119 (8%)
 Frame = -1

Query  274     QSGIEFIRKTVPQSITKLENGQLLVK--WTTEDGESCEE----AFDTVLNATGRDPDVAK  327
               +SG++F+  +  QSI K  +G L ++   TTEDG S        FD ++ A GR P  + 
Sbjct  417069  RSGVQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSG  416890

Query  328     LGLDKARVKLNEKTGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY  384
                 ++   +  NEK G I V   E TS P +YAIGDV +   ELTPVAI AGR L+ RL+
Sbjct  416889  F-MEHTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLF  416719

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = -3

Query  389     AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWS-LSEETRTAA  447
               A + Y +I T VF+    G  G +E D+  ++G  N++VY  +FV L +S L+ E +   
Sbjct  415825  ACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPENKPKT  415646

Query  448     ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                   +K+IC   +++ VVG H  G  A E+ Q  G+A+K+G     + + V IHP
Sbjct  415645  A---MKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHP  415493

>PLHA:NW_020187357.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_437, whole genome shotgun sequence
Length=396479

 Score = 117 bits (294),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 134/480 (28%), Positives = 214/480 (45%), Gaps = 41/480 (9%)
 Frame = -1

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               +S +YD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  300500  SSSEYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  300345

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
                +  S+ +     H+  N+G      D    T ++ Q++   D  ++ +    +   +  
Sbjct  300344  ALLHSTHLLHTAQHEFKNYGI-----DAPEVTANFPQMMKAKDKAVKTLTSGIESLFKKN  300180

Query  155     YVKYENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAI  208
                V Y    G       + +  H  KG + +  ++++IA G       P  +    G+   
Sbjct  300179  KVTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIVD  300000

Query  209     SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  267
               S+  +    K+ P   +VVGA  + LE     K +G  V V+        G D+      
Sbjct  299999  STGALEL--KRIPDHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDDACTGMDKGSVKDF  299826

Query  268     GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDPD  324
                + ++ Q G+EF   T    +T  E    +VK TTE    G++     DTVL ATGR   
Sbjct  299825  IKLLKKQ-GLEFKFGT---KVTASEINGDVVKLTTEPSQGGDAASIECDTVLVATGRRAF  299658

Query  325     VAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  383
                A LGL++  ++  +K GRI V    +T  P I+AIGDVI    L   A + G +    +
Sbjct  299657  TAGLGLEQMGIQ-TDKFGRIEVDEAFRTQVPGIFAIGDVIKGAMLAHKAEEEG-IACAEI  299484

Query  384     YNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                      ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   
Sbjct  299483  IAGKHGHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMA--NSRA  299325

Query  444     RTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               RT  ES   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  299324  RTVGESDGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDVARTSHAHP  299148

>PHSO:scaffold_2
Length=11587142

 Score = 117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 134/476 (28%), Positives = 214/476 (45%), Gaps = 39/476 (8%)
 Frame = -3

Query  38       DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
                DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  1302051  DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  1301896

Query  98       QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
                 S+ +     HD  ++G      D      ++ Q++   +  ++ +    +   +   V 
Sbjct  1301895  HSTHLLHTAQHDFKSYGI-----DAPEVKANFPQMMKAKEKAVKTLTGGIESLFKKNKVT  1301731

Query  158      YENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA---ISSDD  212
                Y    G       + +  +  KG + +  ++++IA G     L   P    A   I S  
Sbjct  1301730  YIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDSTG  1301551

Query  213      IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYM  271
                   +K+  P   +VVGA  + LE     K +G  V V+  +     G D++   +  + +
Sbjct  1301550  ALSLKRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKLL  1301374

Query  272      EVQSGIEFIRKTVPQSITKLENGQLLVKWTTED---GESCEEAFDTVLNATGRDPDVAKL  328
                + Q G+EF   T    +T  E    +VK TTE    G++     DTVL ATGR    A L
Sbjct  1301373  KKQ-GLEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGL  1301206

Query  329      GLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
                GL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A + G      +    
Sbjct  1301205  GLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGKH  1301029

Query  388      TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
                   ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   RT A
Sbjct  1301028  -GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMA--NSRARTVA  1300873

Query  448      ES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                ES   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  1300872  ESDGLVKVLADKKTDKL-LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHP  1300708

>SAPA:scaffold_54 supercont2.54 dna:supercontig supercontig:ASM15154v2:supercont2.54:1:242776:1 
REF
Length=242776

 Score = 114 bits (285),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 137/487 (28%), Positives = 220/487 (45%), Gaps = 55/487 (11%)
 Frame = +2

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               T  DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K
Sbjct  116582  TGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSK  116737

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
                +  ++       HD  N G  +   DG    F+  +L+A+ D  ++ +    +   +  
Sbjct  116738  ALLSATHKYHAAQHDFKNVGIEV---DGLRIDFA--KLMASKDKSVKILTGGIEGLFKKN  116902

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA---ISS  210
                V Y    G  V  + + +     G K ++T++++IA G     L   P    A   I S
Sbjct  116903  KVDYIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDS  117082

Query  211     DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  270
                    +K+  P   +V+G   + LE       +G  + V+           + A+KI   
Sbjct  117083  TGALSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPT  117226

Query  271     MEVQSGIEFIRKTVPQSITKLENGQLL---------VKWTTE---DGESCEEAFDTVLNA  318
               M+ ++G EF +K + +     + GQ +         V  T E    GE+     DTVL A
Sbjct  117227  MDFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVA  117403

Query  319     TGRDPDVAKLGLDKARVKLNEKTGRIWV--KNEQTSTPNIYAIGDVIDAPELTPVAIQAG  376
               TGR P    LGL++  ++  +K GRI V   N +T+  NI+AIGD I+   L   A + G
Sbjct  117404  TGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEG  117580

Query  377     RLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLE  436
                     +       ++Y+ I   V+T  E    G +EE+ K      N+  Y+    P+ 
Sbjct  117581  ISCVESIAGGH-GHVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPMM  117742

Query  437     WSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
                  +   RT  E+  ++K++  K  DK ++G H +  NAGE+     L ++ G + + + 
Sbjct  117743  A--NSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIG  117913

Query  496     DTVGIHP  502
                T   HP
Sbjct  117914  RTCHAHP  117934

>PHIF:NW_003303722.1 Phytophthora infestans T30-4 supercont1.37 
genomic scaffold, whole genome shotgun sequence
Length=1588622

 Score = 113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 135/480 (28%), Positives = 217/480 (45%), Gaps = 41/480 (9%)
 Frame = -2

Query  35     TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
              +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  56233  SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  56078

Query  95     LMHQSSLIGELMHHDSANFGWNIASADGSASTF--SWKQLVANVDGYIRGINFKYKVELR  152
               +  S+ +     HD  ++G +      +      S ++ V  + G I  +  K KV   
Sbjct  56077  ALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIESLFKKNKV---  55907

Query  153    SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA----I  208
                Y+K    + +          +  KG + +  ++++IA G     L     ++A    I
Sbjct  55906  -TYIKGHGKISA--QGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKII  55736

Query  209    SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  267
               S     +K+  P   +VVGA  + LE     K +G  V V+        G D++   + 
Sbjct  55735  DSTGALELKRV-PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEF  55559

Query  268    GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDPD  324
               + ++ Q G++F   T    +T  E    +VK TTE    G++     DTVL ATGR   
Sbjct  55558  TKLLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAF  55391

Query  325    VAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  383
               + LGL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A + G      +
Sbjct  55390  TSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENI  55214

Query  384    YNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                     ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   
Sbjct  55213  AGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMA--NSRA  55058

Query  444    RTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              RT AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  55057  RTIAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHP  54881

>SADI:scaffold_19 supercont1.19 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.19:1:748253:1 
REF
Length=748253

 Score = 112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 135/487 (28%), Positives = 219/487 (45%), Gaps = 55/487 (11%)
 Frame = +3

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               T  DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K
Sbjct  491562  TGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSK  491717

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
                +  ++       HD  N G  +   DG    F+  +L+A+ D  ++ +    +   +  
Sbjct  491718  ALLSATHKYHAAQHDFKNVGIEV---DGLRIDFA--KLMASKDKSVKILTGGIEGLFKKN  491882

Query  155     YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA---ISS  210
                + Y    G  V  + + +     G K ++T++++IA G     L   P    A   I S
Sbjct  491883  KIDYIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDS  492062

Query  211     DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  270
                    +K+  P   +V+G   + LE       +G  + V+           + A+KI   
Sbjct  492063  TGALSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPT  492206

Query  271     MEVQSGIEFIRKTVPQSITKLENGQLL---------VKWTTE---DGESCEEAFDTVLNA  318
               M+ ++G EF +K + +     + GQ +         V  T E    GE+     DTVL A
Sbjct  492207  MDFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVA  492383

Query  319     TGRDPDVAKLGLDKARVKLNEKTGRIWV--KNEQTSTPNIYAIGDVIDAPELTPVAIQAG  376
               TGR P    LGL++  ++  +K GRI V   N +T+  NI+AIGD I+   L   A + G
Sbjct  492384  TGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEG  492560

Query  377     RLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLE  436
                     +       ++Y+ I   V+T  E    G +EE+ K      N+  +     P+ 
Sbjct  492561  ISCVESIAGGH-GHVNYNAIPGVVYTFPEVASVGKTEEELKAAGVAYNVGKF-----PMM  492722

Query  437     WSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
                  +   RT  E+  ++K++  K  DK ++G H +  NAGE+     L ++ G + + + 
Sbjct  492723  A--NSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIG  492893

Query  496     DTVGIHP  502
                T   HP
Sbjct  492894  RTCHAHP  492914

>APAS:scaffold_96 supercont1.96 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.96:1:223693:1 
REF
Length=223693

 Score = 112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 133/253 (53%), Gaps = 18/253 (7%)
 Frame = -3

Query  25      STPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGT  84
               ST + +    ++YDY ++  G G    A    A  +G KV V++  +    G + G+GGT
Sbjct  203348  STLATMSTTNSAYDYIVIGGGSGGVSSA--SRAVEYGAKVLVIE--RGRANGGA-GMGGT  203184

Query  85      CVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGIN  144
               CVNVGC+PKK+M+ +    E++ H + ++ +     +    +F W  + A  D Y+  + 
Sbjct  203183  CVNVGCVPKKIMYNAGFHAEIL-HSAKDYSFK-EVVNVKFGSFDWAAMKAKRDAYVNWLT  203010

Query  145     FKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGG  204
                 Y+  L  + + +     +FVD HT+E+   R      T   ++IAVGG P+  T PG 
Sbjct  203009  GAYEEGLGEENIDHVIGAATFVDDHTVEVNGLR-----FTAPHILIAVGGVPQLPTIPGI  202845

Query  205     EHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS-ILLRGFD---  260
               EHAISSD  F +   +P K  VVGA Y+A+E AG    +  D  V  R   +LR FD   
Sbjct  202844  EHAISSDGFFDL-PTQPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGDQVLRKFDPLV  202668

Query  261     QDMAN-KIGEYME  272
               +D+ N ++ +Y++
Sbjct  202667  RDLVNDEMAKYVD  202629

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 67/118 (57%), Gaps = 2/118 (2%)
 Frame = -3

Query  270     YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLG  329
               YM  +SG+ F+ ++  QSI K  +G L +  T  D  +    F+ +++A GR P    +G
Sbjct  202103  YMS-RSGVTFVTQSHLQSIRKEADGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVG  201927

Query  330     LDKARVKLNEKTGRIWVKNEQTSTPNIYAIGD-VIDAPELTPVAIQAGRLLSRRLYNN  386
               LDK  V+L+     +    E T+ P +YAIGD  I   ELTPVAI AGR L+ RL+ +
Sbjct  201926  LDKTTVELSTDGFVVVDAQENTTVPGVYAIGDATITGWELTPVAIAAGRRLADRLFGH  201753

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 60/116 (52%), Gaps = 2/116 (2%)
 Frame = -3

Query  387     STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
               + A + Y +I T +F+    G  GL+E ++  +YG+ N+  Y  +F  L +SL +     
Sbjct  201374  ANACIHYHQIPTVIFSHPPIGTIGLTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHK  201195

Query  447     AESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                ++  +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  201194  PQTA-MKLVCIGVEET-VVGAHVAGLGADEMIQGFGVAIKMGAYKSDFDNIVAIHP  201033

>PHCA:scaffold_51 PHYCAscaffold_51
Length=529628

 Score = 112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 134/480 (28%), Positives = 214/480 (45%), Gaps = 41/480 (9%)
 Frame = +2

Query  35      TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
               ++ DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  380126  STNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  380281

Query  95      LMHQSSLIGELMHHDSANFGWNIASADGSASTF--SWKQLVANVDGYIRGINFKYKVELR  152
                +  S+ +     HD  ++G +      +      + ++ V  + G I  +  K KV   
Sbjct  380282  ALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVTTLTGGIESLFKKNKV---  380452

Query  153     SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA----I  208
                 Y+K   F             +  KG + +  ++++IA G     L     ++A    I
Sbjct  380453  -TYIK--GFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKII  380623

Query  209     SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  267
                S     + +  P   +VVGA  + LE     K +G  V V+        G D+    + 
Sbjct  380624  DSTGALSLTRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEF  380800

Query  268     GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDPD  324
                + ++ Q G++F   T    +T  E    +VK TTE    G++     DTVL ATGR   
Sbjct  380801  TKLLKKQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAF  380968

Query  325     VAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  383
                A LGL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A + G      +
Sbjct  380969  TAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENI  381145

Query  384     YNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                      ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   
Sbjct  381146  AGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PMMA--NSRA  381301

Query  444     RTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               RT AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  381302  RTVAEADGLVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  381478

>SAPA:scaffold_473 supercont2.473 dna:supercontig supercontig:ASM15154v2:supercont2.473:1:8349:1 
REF
Length=8349

 Score = 105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 99/184 (54%), Gaps = 5/184 (3%)
 Frame = +3

Query  321   RDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLL  379
             R P    LGL+   + L+          E TS PN++A+GDV     ELTPVAI AGR L
Sbjct  3111  RTPRTNDLGLETTDIALSADKFIQVDAQENTSVPNVHAVGDVTTTGWELTPVAIAAGRRL  3290

Query  380   SRRLY-NNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWS  438
             + RL+ N   A ++Y +I T VF+    G  GL+E  +  +YG  N++VY  +F  + ++
Sbjct  3291  ADRLFGNEPNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGAHNVKVYTSSFFNMFYA  3470

Query  439   LSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  498
             +SE+     +   +K+IC    ++ V+G H  G  A E+ Q  G+A+K+G       + V
Sbjct  3471  MSEQDD--KQKTAMKLIC-IGEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIV  3641

Query  499   GIHP  502
              IHP
Sbjct  3642  AIHP  3653

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 58/118 (49%), Gaps = 3/118 (3%)
 Frame = -3

Query  385   NNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETR  444
             N   A ++Y +I T VF+    G  GL+E  +  +YG  N+  +  +F  + +++  E  
Sbjct  1741  NEPNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGAHNVTTHTSSFSNMFYAMCPEKE  1562

Query  445   TAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                 +  +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  1561  KVQTA--MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  1397

>PHIF:NW_003303667.1 Phytophthora infestans T30-4 supercont1.92 
genomic scaffold, whole genome shotgun sequence
Length=551618

 Score = 73.6 bits (179),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 118/250 (47%), Gaps = 19/250 (8%)
 Frame = -1

Query  258     GFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTED---GESCEEAFDT  314
               G D++   +  + ++ Q G++F   T    +T  E    +VK TTE    G++     DT
Sbjct  230744  GSDKEAVKEFTKLLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDT  230577

Query  315     VLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAI  373
               VL ATGR    + LGL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A 
Sbjct  230576  VLVATGRRAFTSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAE  230400

Query  374     QAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433
               + G      +       ++Y  I   ++T  E+   G +EE+ K    E N+  +     
Sbjct  230399  EEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----  230238

Query  434     PLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  492
               P+    +   RT AE+   +KV+ DK  DK + G H +  NAGE+     + ++ G   +
Sbjct  230237  PM--MANSRARTIAEADGLVKVLADKKTDKLL-GVHIIAGNAGEMIAEGVIGIEYGAASE  230067

Query  493     QMVDTVGIHP  502
                +  T   HP
Sbjct  230066  DLARTCHAHP  230037

 Score = 50.4 bits (119),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/244 (25%), Positives = 110/244 (45%), Gaps = 22/244 (9%)
 Frame = -3

Query  6       LSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVC  65
               L ++  A  +++++ +    T  A+    +S DYD+VVIGGG GG   + +AA  G K  
Sbjct  231468  LMLRNVASLSRRSVALRSSVTARALS---SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTA  231298

Query  66      VLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSAS  125
                ++        +   LGGTC+NVGCIP K +  S+ +     HD  ++G      D    
Sbjct  231297  CIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGI-----DAPEV  231157

Query  126     TFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLEL-WHPRKGTKQIT  184
                 ++ Q++ + +  ++ +    ++  +   V Y    G       + +  +  KG + + 
Sbjct  231156  KANFPQMMKSKEKAVKTLTGGIELLFKKNKVTYIKGHGKISAQGEISVALNDNKGNETVK  230977

Query  185     TRDVVIAVGGRPKELTCPGGEHA----ISSDDIFWMKKKEPGKTLVVGASYVALECAGFL  240
                ++++IA G     L     ++A    I S     + K+ P   +VVGA  + LE     
Sbjct  230976  AKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALEL-KRVPEHLVVVGAGVIGLELGSVY  230800

Query  241     KGMG  244
               K +G
Sbjct  230799  KRLG  230788

>PYAR:scaffold_425 par_scaffold_425 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_425:1:18937:1 
REF
Length=18937

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 120/504 (24%), Positives = 211/504 (42%), Gaps = 69/504 (14%)
 Frame = -1

Query  39     YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
              YDLVVIG G     C+ E+A  G++V V+D        T  G+GG CV+ G IP K   +
Sbjct  15862  YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  15707

Query  99     SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLV-ANVDGYIRGINFKYKVELRSKYV  156
              + L +    HH      +++ +       +  K++V + VD          K +L++  +
Sbjct  15706  AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVD--------VIKAQLKAARI  15551

Query  157    KYENFLGSFVDAHTLELW-------HPRKGTKQITTRDVVIAVGGRPKE--LTCPGGEHA  207
               Y   L  F + H + +               ++     +IA G RP    L    G+  
Sbjct  15550  DYLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVI  15371

Query  208    ISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-----VRSILLRGFD  260
              + SD I     +E P   +VVGA  + +E A  L  + G+ V V+     VR++L     
Sbjct  15370  LDSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---S  15200

Query  261    QDMA------------------NKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTT  302
              +DM+                  ++I   ++ +  ++  R  + ++I K+E     VK   
Sbjct  15199  RDMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFL  15020

Query  303    EDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDV  362
                G+    + D +L   GR      L L+   +  N++      K  QT  P+IYA+GD 
Sbjct  15019  TSGKVT--SGDALLYTVGRQASTDGLNLEAVGLGRNKRGLLTVNKAYQTEKPHIYAVGDC  14846

Query  363    IDAPELTPVAIQAGRLLSRRLYNNS---TAQMDYDKICTAVFTPIEYGCCGLSEED-SKE  418
              I AP L   +++ GRL +  ++      T+Q++       ++T  E    G +E+  + E
Sbjct  14845  IGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSE  14666

Query  419    RYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
              +    N E+    +      L++   +      LK++ D    + V G H +G  A E+ 
Sbjct  14665  KV---NYEIGLAKY----SELAKGQMSGGAFGMLKILFDPDTLR-VHGVHAIGEGATEII  14510

Query  479    QAMGLAMKLGFTYDQMVDTVGIHP  502
                  +A+ +G +     D V  +P
Sbjct  14509  HIGQVAIAMGCSLTYFRDAVFNYP  14438

>PYVX:scaffold_675 pve_scaffold_675 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_675:1:16155:1 
REF
Length=16155

 Score = 63.5 bits (153),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 13/125 (10%)
 Frame = +1

Query  390    QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES  449
              ++ Y+ + T VF+    G  GL+E+ ++ ++G++ I++Y   FV + + +  E  +A   
Sbjct  10798  KISYENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKSTFVNMYYGVVNEVDSATGE  10977

Query  450    C------------YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  497
                             K++C    +K +VG H +G  A E+ Q  G+A+K+G T   +   
Sbjct  10978  AKPKPXXXXXXXXXXKLVCAGPDEK-IVGLHVIGMGADEMLQGFGVAVKMGATKADLDSC  11154

Query  498    VGIHP  502
              V IHP
Sbjct  11155  VAIHP  11169

 Score = 56.6 bits (135),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = +3

Query  307    SCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDA  365
              S    F++V+ A GR P    LGLD A V  +E+ G I V   +QT+ P+I A+GD    
Sbjct  10539  STHTGFESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGT  10715

Query  366    PELTPVAIQAGRLLS  380
                LTPVAI AGR L+
Sbjct  10716  IALTPVAIAAGRRLA  10760

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/225 (29%), Positives = 109/225 (48%), Gaps = 34/225 (15%)
 Frame = +2

Query  5      RLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF-GQK  63
              R+++  +A+ TK    +  P          T+ ++DL+VIG GSGG+A S+ AAS+   +
Sbjct  9476   RMTMMAAAMRTK---LLALPRGLPLARALSTAREFDLLVIGAGSGGMAASRRAASYPNTR  9646

Query  64     VCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGS  123
              V V++  +         LGGTCVNVGC+PKK+M+  + +   +H D+ ++G+  A++ G 
Sbjct  9647   VAVVERAR---------LGGTCVNVGCVPKKIMYTGASLSHALHRDAFHYGFEDAASPGK  9799

Query  124    A----STFSWKQLVANVDGYIRGINFKY-----------KVELRSKYVKYENFLGSFVDA  168
              +      F W++L    D Y+  +N  Y           KV + S  V   N   S V+ 
Sbjct  9800   SIGARVAFDWQKLKQRRDAYVLRLNGIYER*DEALTEGMKVPIDS-LVVCRNLANSKVEL  9976

Query  169    HTLELWHPRKGT-----KQITTRDVVIAVGGRPKELTCPGGEHAI  208
               T        G       ++  + V++AVGG+P     PG +  +
Sbjct  9977   LTGTARFNVDGKIEVDGVEVRAKKVLLAVGGKPLIPDIPGTDEQV  10111

 Score = 44.3 bits (103),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 50/110 (45%), Gaps = 10/110 (9%)
 Frame = +1

Query  168    AHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVV  227
              AH    W+ R G   +     V +V    KEL        I SD  F +++  P K  VV
Sbjct  10075  AHPGHPWYGRAGVVMVCCMVFVDSVAATGKELC-------IDSDGFFELEQL-PRKVAVV  10230

Query  228    GASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSG  276
              GA Y+A+E AG L  +G D  +  R   +LR FD      +G +  V SG
Sbjct  10231  GAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDVSAVLFLGCF-SVHSG  10377

>PYIW:scaffold_3308 piw_scaffold_3308 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3308:1:3352:1 
REF
Length=3352

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 94/187 (50%), Gaps = 5/187 (3%)
 Frame = +2

Query  318  ATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDV-IDAPELTPVAIQAG  376
            A GR+P    LGL+   VKLN+    +    E TS   IYAIGD  I   ELTPVAI AG
Sbjct  2    AIGREPLTKDLGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAG  181

Query  377  RLLSRRLYNNST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPL  435
            R L+ RL+     A + Y +I T VF+    G  G +E  + E++G  N++ Y   FV L
Sbjct  182  RRLADRLFGGEPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNL  361

Query  436  EWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
              ++++       +  L        D+ VVG H  G  A E+ Q  G+AMK+  T     
Sbjct  362  LHAMADPDHKGKTAMKL---VTVGEDEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFD  532

Query  496  DTVGIHP  502
            + V IHP
Sbjct  533  NIVAIHP  553

>APIN:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.4:1:2763071:1 
REF
Length=2763071

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 123/444 (28%), Positives = 195/444 (44%), Gaps = 53/444 (12%)
 Frame = +2

Query  81     LGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNI--ASADGSASTFSWKQLVANVDG  138
              LGGTC+NVGCIP K +   + +     HD  + G  +   S D +    S ++ V  + G
Sbjct  44333  LGGTCLNVGCIPSKALLHGTHLYHAAQHDFKSVGIKVDNVSIDFNQLMKSKEKTVKILTG  44512

Query  139    YIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR---  195
               I G+  K KV+    YVK     G  V    L +     G + + T++++IA G     
Sbjct  44513  GIEGLFKKNKVD----YVK---GFGKIVAKGQLSVALNGGGNQTLHTKNILIATGSEVTP  44671

Query  196    --PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  253
                P  +   GG+   S+  +    K+ P   +VVG   + LE       +G  + V+   
Sbjct  44672  LPPVPVDNEGGKIVDSTGALSL--KRIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV---  44836

Query  254    ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLL---------VKWTTE-  303
                      + A+KI   M+ +   EF +    Q +T  + GQ +         V  T E 
Sbjct  44837  --------EYADKICPTMDHELTKEFQKLLTKQGMT-FKLGQKVTASKVDGDTVTLTVEP  44989

Query  304    --DGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVK--NEQTSTPNIYAI  359
                 G++     D VL ATGR P  A LGL+   ++  ++ GRI V   N QT+   IYAI
Sbjct  44990  AAGGDATTIEADCVLVATGRRPYTAGLGLEDMGIQ-TDRFGRIKVNLSNFQTNVDGIYAI  45166

Query  360    GDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKER  419
              GDVI+   L   A + G  +   +       ++YD I   ++T  E    G +EE+ K  
Sbjct  45167  GDVIEGAMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEEELKAA  45343

Query  420    YGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
                  N+  Y+    P+    +   R   E+  ++KV+  K  DK ++G H +  NAGE+ 
Sbjct  45344  ----NV-AYNVGKFPMMA--NSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMI  45499

Query  479    QAMGLAMKLGFTYDQMVDTVGIHP  502
                  L ++ G + + +  T   HP
Sbjct  45500  SEGVLGIEYGASAEDIGRTCHAHP  45571

>APAS:scaffold_88 supercont1.88 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.88:1:223208:1 
REF
Length=223208

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 124/444 (28%), Positives = 193/444 (43%), Gaps = 53/444 (12%)
 Frame = -3

Query  81     LGGTCVNVGCIPKK-LMHQSSLIGELMHH-DSANFGWNIASADGSASTFSWKQLVANVDG  138
              LGGTC+NVGCIP K L+H + L     H+  S     +  S D      S  + V  + G
Sbjct  46416  LGGTCLNVGCIPSKALLHGTHLYHSAQHNFKSVGIKVDNVSIDFDQLMKSKDKTVKILTG  46237

Query  139    YIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR---  195
               I G+  K KV+    Y       G  V    + +     G + + T++++IA G     
Sbjct  46236  GIEGLFKKNKVDYIKGY-------GKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTP  46078

Query  196    --PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  253
                P  +   GG+  I S     +K+  P   +VVG   + LE       +G  + V+   
Sbjct  46077  LPPVPVDNEGGK-IIDSTGALALKRV-PKHLVVVGGGVIGLEMGSVYGRLGSKITVV---  45913

Query  254    ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQL---------LVKWTTE-  303
                      + A+KI   M+ +   EF +    Q +T  + GQ          +V  T E 
Sbjct  45912  --------EYADKICPTMDHEVTKEFQKLLTKQGMT-FKLGQKVTASKVDGDVVTLTVEP  45760

Query  304    --DGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVK--NEQTSTPNIYAI  359
                 GE+     D VL ATGR P  A LGL++  ++  +K GRI V   N QT+   I+AI
Sbjct  45759  AAGGEATTIEADCVLVATGRRPFTAGLGLEEMGIQ-TDKFGRIKVNLSNFQTNVDGIFAI  45583

Query  360    GDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKER  419
              GDVI+   L   A + G  +   +       ++YD I   ++T  E    G +EE+ K  
Sbjct  45582  GDVIEGAMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEEELKTA  45406

Query  420    YGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
                  N+  Y+    P+    +   R   E+  ++KV+  K  DK ++G H +  NAGE+ 
Sbjct  45405  ----NV-AYNVGKFPMMA--NSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMI  45250

Query  479    QAMGLAMKLGFTYDQMVDTVGIHP  502
                  L ++ G + + +  T   HP
Sbjct  45249  SEGVLGIEYGASAEDIGRTCHAHP  45178

>SAPA:scaffold_11 supercont2.11 dna:supercontig supercontig:ASM15154v2:supercont2.11:1:752600:1 
REF
Length=752600

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 85/156 (54%), Gaps = 5/156 (3%)
 Frame = -2

Query  349     EQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNSTAQMDYDKICTAVFTPIEY  406
               E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N   A ++Y +I T VF+    
Sbjct  400513  ENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQIPTVVFSHPPI  400334

Query  407     GCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVG  466
               G  GL+E  +  +YG  N+  +  +F  + +++  E      +  +K++C    +  VVG
Sbjct  400333  GTIGLTEPQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVHTA--MKLVCIGVEET-VVG  400163

Query  467     FHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  400162  VHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  400055

>PHPA:scaffold_31 NW_008649017.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.31, whole genome shotgun 
sequence
Length=700024

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 110/422 (26%), Positives = 184/422 (44%), Gaps = 34/422 (8%)
 Frame = -3

Query  93      KKLMHQSSLIGELMHHDSANFGWNIASADGSASTF--SWKQLVANVDGYIRGINFKYKVE  150
               K L+H + L+     HD  ++G +      +      + ++ V  + G I  +  K KV 
Sbjct  248426  KALLHSTHLL-HTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVKTLTGGIESLFKKNKV-  248253

Query  151     LRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA---  207
                   Y+K    + +          +  KG + +  ++++IA G     L     ++A   
Sbjct  248252  ---TYIKGHGKISA--QGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGK  248088

Query  208     -ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMAN  265
                I S     +K+  P   +VVGA  + LE     K +G  V V+        G D++   
Sbjct  248087  IIDSTGALELKRV-PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGMDKEAVK  247911

Query  266     KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRD  322
               +  + ++ Q G++F   T    +T  E    +VK TTE    G++     DTVL ATGR 
Sbjct  247910  EFTKLLKKQ-GLDFKFGT---KVTSSEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRR  247743

Query  323     PDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  381
                  A LGL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A + G     
Sbjct  247742  AFTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVE  247566

Query  382     RLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSE  441
                +       ++Y  +   ++T  E+   G +EE+ K    E N+  +     P+  +   
Sbjct  247565  NIAGKH-GHVNYGAVPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMAN--S  247410

Query  442     ETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  500
                 RT AES   +KV+ DK  DK + G H +  NAGE+     + ++ G   + +  T   
Sbjct  247409  RARTVAESDGLVKVLADKKTDKLL-GVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHA  247233

Query  501     HP  502
               HP
Sbjct  247232  HP  247227

>PYAR:scaffold_1175 par_scaffold_1175 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1175:1:9874:1 
REF
Length=9874

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 86/298 (29%), Positives = 131/298 (44%), Gaps = 34/298 (11%)
 Frame = -2

Query  218   KKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGI  277
             KK P   +V+G   + LE     K +G  V V+           + A+++   ++++ G 
Sbjct  4002  KKAPEHLVVIGGGVIGLELGSVYKRLGSKVTVV-----------EYADRVCPGLDLELGK  3856

Query  278   EFIRKTVPQSI-----TKLENGQL---LVKWTTED---GESCEEAFDTVLNATGRDPDVA  326
             EF +    Q +     TK+   Q+    V  T E    GE+     DTVL ATGR P   
Sbjct  3855  EFAKLLKKQGLDLQFKTKVTASQVNGDKVTLTVEPAAGGEATTIEADTVLVATGRRPFTN  3676

Query  327   KLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
              LGL++  ++  +K GRI V    +T  P+IYAIGDVI  P L   A + G      +  
Sbjct  3675  GLGLEQMGIQ-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAG  3499

Query  386   NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
                  ++Y+ I   ++T  E    G +EE  KE       E    N        +   R 
Sbjct  3498  LH-GHVNYNAIPGVIYTHPEVASVGKTEEQLKE-------EGIAYNVGKFPMMANSRARA  3343

Query  446   AAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               E   ++KV+ DKT DK ++G H +  NAGE+     L ++ G   + +  T   HP
Sbjct  3342  VGEGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHP  3172

 Score = 41.2 bits (95),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 8/77 (10%)
 Frame = -3

Query  38    DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
             +YDLVV+GGG GG   + +AA  G K   ++      +G+   LGGTC+NVGCIP K + 
Sbjct  4562  EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE-----SRGS---LGGTCLNVGCIPSKALL  4407

Query  98    QSSLIGELMHHDSANFG  114
              S+ +     HD   +G
Sbjct  4406  HSTHLFHTAQHDFKKYG  4356

>PYAP:scaffold_255 pag1_scaffold_255 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_255:1:39624:1 
REF
Length=39624

 Score = 68.9 bits (167),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 87/337 (26%), Positives = 145/337 (43%), Gaps = 40/337 (12%)
 Frame = -1

Query  39     YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
              YDLVVIG G     C+ E+A  G++V V+D      +G+S  +GG CV+ G IP K   +
Sbjct  35358  YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  35203

Query  99     SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLV-ANVDGYIRGINFKYKVELRSKYV  156
              + L +    HH      +++ +       +  K++V + VD          K +L++  V
Sbjct  35202  AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVD--------VIKAQLKAARV  35047

Query  157    KYENFLGSFVDAHTLELWHPRKGTK-------QITTR----DVVIAVGGRPKE--LTCPG  203
               Y      F + H + +      T        ++ TR      +IA G RP    L    
Sbjct  35046  DYIPGFARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPID  34867

Query  204    GEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFD  260
              G+    SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   D
Sbjct  34866  GKVVFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCD  34687

Query  261    QDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATG  320
               ++ + +   M V+ G  F+   + +SI K+E     VK     G+      D +L   G
Sbjct  34686  NEVVSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKVTSA--DALLYTVG  34525

Query  321    RDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIY  357
              R  +   L ++   +  N++      K+ QT   ++Y
Sbjct  34524  RQANTDGLNIEAVGLSRNQRGLLNVNKSYQTDKAHMY  34414

 Score = 35.8 bits (81),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/150 (23%), Positives = 65/150 (43%), Gaps = 10/150 (7%)
 Frame = -2

Query  357    YAIGDVIDAPELTPVAIQAGRLLSRRLYNN----STAQMDYDKICTAVFTPIEYGCCGLS  412
              YA+GD I AP L   +++ GRL +  +++     +T+Q++       ++T  E    G +
Sbjct  34346  YAVGDCIGAPALASTSMEQGRLAACHMWDGNCDIATSQLENGNYPYGIYTIPEISMVGKT  34167

Query  413    EEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGP  472
              E+       + N E+    +  L      +    + +  LK++ D    K   G H +G 
Sbjct  34166  EQQLTAE--KVNYEIGIAKYSELA---KGQMGGGSHNGILKILFDPDTLKL-HGVHAIGE  34005

Query  473    NAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               A E+     +A+ +G +     D V  +P
Sbjct  34004  GATEIIHIGQVAIAMGCSLTYFRDAVFNYP  33915

>SAPA:scaffold_72 supercont2.72 dna:supercontig supercontig:ASM15154v2:supercont2.72:1:180208:1 
REF
Length=180208

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 86/287 (30%), Positives = 126/287 (44%), Gaps = 65/287 (23%)
 Frame = +3

Query  25     STPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGT  84
              S  S+V+       YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGT
Sbjct  87354  SLQSSVNATTMQRMYDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGT  87506

Query  85     CVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGIN  144
              CVNVGC+PKK+M+ ++ +   M HD+  +G+         +T  W  L    D Y+  +N
Sbjct  87507  CVNVGCVPKKVMYAAADLAHSMRHDAPAYGFPAV----PNTTVDWATLKQRRDAYVTRLN  87674

Query  145    FKYKVELR-------SKYVKY-ENFLGSFVD-AHTLELWHPRKGTKQITTRDV-VIAVGG  194
                Y    R       + +V+   N  GS VD AH L  +    G  QI    + V     
Sbjct  87675  GIYARYARRVCSMAHTIHVRTCSNLQGSGVDFAHGLCSFGS-DGRVQIDATPLDVYDKAA  87851

Query  195    RPKELTCPGG---------------------EHAISSDDIFWMKKKEPG-----KTLVV-  227
               P +L   G                        A+     F   ++ PG     + LVV 
Sbjct  87852  MPCDLLTIGSRPRRRTFGGRRRPARDARHSWHRALH*LGWFL*TRRAPGPCCGKRRLVVE  88031

Query  228    -------------GASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  260
                           GA Y+A+E AG L+G+G D  +  R   +LR FD
Sbjct  88032  DVCSNYRPCT*VVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD  88172

 Score = 46.6 bits (109),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 66/277 (24%), Positives = 102/277 (37%), Gaps = 86/277 (31%)
 Frame = +2

Query  298    VKWTTEDGESCEEAFDTVLNATGRDPDVAKL----------------GLDKARVKLNEKT  341
              +  TT  G+     FD VL ATGR P   +L                GL+   ++L+   
Sbjct  88370  LSLTTTAGD-YHTGFDCVLVATGRTPMTKRLLERSRHLDSYSHHIDLGLEHRGIELSPN-  88543

Query  342    GRIWVKNEQ-TSTPNIYAIGDVID-APELTPVAIQA------------------------  375
              G I V   Q TS P ++A+GDV++   + T  +I +                        
Sbjct  88544  GFIPVDAYQATSAPGVFALGDVVNTVADFTIGSIMSCGIFLGGADPGRHCSGSRRL*SKG  88723

Query  376    ---------GRLLSRRLYNN-STAQMDYDKICTAVFTPIEYG-----------CCGLSEE  414
                       GR L+ RL+     A+ DY  I + VF+    G            C  +  
Sbjct  88724  RYYHLPPCVGRRLADRLFGGLPDAKADYTSIPSVVFSHPPIGTLYERSSLSQLVCF*ARS  88903

Query  415    DSKERYGEDNIE-------------------VYHKNFVPLEWSLSEETRTAAESCYLKVI  455
               S+ +    +                     VY   FV + +SL E       +  +K+I
Sbjct  88904  GSRSKRPARSTARTKSR*SHAASRVTPLWG*VYSSKFVNMHYSLYEHAHEKPTTA-MKLI  89080

Query  456    CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  492
              C    +K +VG H +G  A E+ Q  G+A+K+ F  D
Sbjct  89081  CVGPTEK-IVGLHVIGRGADEMLQGFGVAIKVAFGLD  89188

>SADI:scaffold_47 supercont1.47 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.47:1:482683:1 
REF
Length=482683

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 112/250 (45%), Gaps = 39/250 (16%)
 Frame = +2

Query  17      KNMQIH---DPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPS  73
               +N++ H    P+ P  +        YDLVV+GGGSGG+A ++ AA++G+KV V++  +  
Sbjct  262067  RNLRTHCNLRPTPPRTMQRV-----YDLVVMGGGSGGIASARRAATYGKKVLVVERGR--  262225

Query  74      PQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLV  133
                      LGGTCVNVGC+PKK+M+ ++ +   M HD+  +G+         +T  W  L 
Sbjct  262226  -------LGGTCVNVGCVPKKVMYAAADLAHSMRHDAPAYGFPAV----PNTTVDWATLK  262372

Query  134     ANVDGYIRGINFKYK-----VELRS-KYVKY-ENFLGSFVDAHTLELWHPRKGTKQI--T  184
                  D Y+  +N  Y        LRS K V    N  GS VD           G  QI  T
Sbjct  262373  QRRDAYVTRLNGIYSRCASPCLLRSLKLVPTCSNLQGSGVDFAQGLCSFGSDGRVQIDAT  262552

Query  185     TRDV--------VIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALEC  236
                 DV        ++  G RP+  TC     A  S   F        + +V   S  A   
Sbjct  262553  PLDVYDAAMRCDLVTNGYRPRRQTCSWPSAASPSCPTFQASSTALAR-MVSSNSTSARPA  262729

Query  237     AGFLKGMGYD  246
               + F+  +G D
Sbjct  262730  SRFVHVLGDD  262759

 Score = 36.2 bits (82),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 1/36 (3%)
 Frame = +3

Query  226     VVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  260
               VVGA Y+A+E AG L+G+G D  +  R   +LR FD
Sbjct  262782  VVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD  262889

>HYAP:scaffold_73 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_73:1:324626:1 
REF
Length=324626

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 96/219 (44%), Gaps = 21/219 (10%)
 Frame = -3

Query  38      DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
               DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  161544  DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  161389

Query  98      QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
                S+ +     H+  ++G      D    T ++ Q++   +  +R +    +       V 
Sbjct  161388  HSTHLLHTAQHEFKSYGI-----DAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  161224

Query  158     YENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSD  211
               Y   +G       + +    R+G   +T +++++A G       P  +    G+   S+ 
Sbjct  161223  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  161044

Query  212     DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  250
                +     + P   +VVGA  + LE     K +G  V V+
Sbjct  161043  ALALT--RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  160933

 Score = 41.2 bits (95),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 9/114 (8%)
 Frame = -2

Query  390     QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES  449
                ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   RT AE+
Sbjct  160126  HVNYGAIPNVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PM--MANSRARTVAEA  159968

Query  450     -CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                  +KV+ DK  DK + G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  159967  DGMVKVLADKKTDKLL-GVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  159809

>PYIW:scaffold_2918 piw_scaffold_2918 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_2918:1:3973:1 
REF
Length=3973

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (51%), Gaps = 8/116 (7%)
 Frame = +3

Query  212   DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD---QDMANKI  267
             D F+  + +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD   +D+ N+ 
Sbjct  3636  DGFFKLEAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEE  3815

Query  268   GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDP  323
             GE    ++GI F+R +  + I K  +G L +       E     FD VL A GR+P
Sbjct  3816  GE----KAGINFVRNSRIERIEKQADGSLTITAKVNGEEQVLAGFDQVLYAIGREP  3971

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 92/187 (49%), Gaps = 17/187 (9%)
 Frame = +3

Query  18    NMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGT  77
             N Q H P+       A+T YDY  + IGGGSGG+A ++ AA+FG KV V   V+   +  
Sbjct  2919  NKQHHSPTM-----SADTVYDY--ISIGGGSGGMASARRAATFGAKVLV---VERGRKYG  3068

Query  78    SWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADG-SASTFSWKQLVANV  136
               GLGGTCV+ GC+PKK+M  ++   E ++  +A++      A       F W  +    
Sbjct  3069  GAGLGGTCVHYGCVPKKIMFNAATHVEHLNR-AADYSITTNGAHKYQFGDFDWANMKTKR  3245

Query  137   DGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRP  196
             D YI  +N  Y+  L +  V     +   V  + +E+          T + +++AVGG+P
Sbjct  3246  DAYILRLNGIYERNLGNAQVDLVEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP  3410

Query  197   KELTCPG  203
                  PG
Sbjct  3411  SLPDIPG  3431

>PHRA:scaffold_5
Length=827719

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 92/372 (25%), Positives = 155/372 (42%), Gaps = 67/372 (18%)
 Frame = -3

Query  183     ITTRDVVIAVGGRP-KELTCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGF  239
               +T    ++ VG RP +    P  GE    SD + W K K  P + +VVGA  V +E A  
Sbjct  354020  LTADKFLVCVGTRPARHPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASM  353841

Query  240     LKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLL  297
               +  + G DV V+  R  +L   D++++  +  Y   Q+G  F+ +   +S+ K +NG++ 
Sbjct  353840  MTIIPGTDVTVIDGRKEILNMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIF  353664

Query  298     VKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNI  356
               V    E G++     D +L   GR  +V  L L+   +   +K GRI V N  QT+ P++
Sbjct  353663  VHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHM  353499

Query  357     Y------------------------AIGDVIDAPELTPVAIQAGRL----------LSRR  382
               Y                        A GD+I  P L   +++ GRL          L+ +
Sbjct  353498  YVMVLSEQQVKR*TETHVFVFLGSYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNNQ  353319

Query  383     LYNNSTAQMDYDKICT----------AVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKN  431
               + ++     D D++ T           ++T  E    G +E+  +KE+        Y   
Sbjct  353318  VLSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKEQ------TPYEVG  353157

Query  432     FVPLEWSLSEETRTAAESCYLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  490
                   E  L+          +LK+I C  T    ++G H +G  A E+     + M  G  
Sbjct  353156  MARYE-ELARGQMLGGVPGFLKIIFCPDTLK--ILGVHAIGEGATEIIHIGQVVMSTGGN  352986

Query  491     YDQMVDTVGIHP  502
                +   + V  +P
Sbjct  352985  LEYFRNAVFNYP  352950

 Score = 43.9 bits (102),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (52%), Gaps = 8/66 (12%)
 Frame = -1

Query  30      VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
               + E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G
Sbjct  354628  LRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRD--------MLGGVCVHTG  354473

Query  90      CIPKKL  95
                +P K+
Sbjct  354472  TVPSKV  354455

>PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.1, whole genome shotgun 
sequence
Length=4724858

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 92/371 (25%), Positives = 152/371 (41%), Gaps = 66/371 (18%)
 Frame = -1

Query  183      ITTRDVVIAVGGRP-KELTCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGF  239
                +T    ++ VG RP +    P  GE    SD++ W K K  P + ++VGA  V +E A  
Sbjct  3435242  LTADKFLVCVGTRPARRPDIPFDGETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYASM  3435063

Query  240      LKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLL  297
                +  + G DV V+  R  +L   D+ ++  +  Y   Q+G  F+     +S+ K   G++ 
Sbjct  3435062  MTIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMTQTGTRFLTGETIKSVEKSPKGEVF  3434886

Query  298      VKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNI  356
                V    E G++     D +L   GR  +V  L L+   +   +K GRI V N  QT+ P++
Sbjct  3434885  VHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLS-PDKRGRIKVDNNFQTAVPHM  3434721

Query  357      Y-----------------------AIGDVIDAPELTPVAIQAGRLLSRRL----------  383
                Y                       A GD+I  P L   +++ GRL S  +          
Sbjct  3434720  YVRVMAYTG*HNIRT*PVRLFCSYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLE  3434541

Query  384      YNNSTAQMDYDKICT----------AVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKNF  432
                 ++     D D++ T           ++T  E    G +E+  +KE       +V ++  
Sbjct  3434540  LSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKE-------QVPYEVG  3434382

Query  433      VPLEWSLSEETRTAAESCYLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  491
                V     L+          +LK+I C  T   F  G H +G  A E+     + M  G T 
Sbjct  3434381  VARYEELARGQMLGGVPGFLKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTL  3434208

Query  492      DQMVDTVGIHP  502
                +   + V  +P
Sbjct  3434207  EYFRNAVFNYP  3434175

 Score = 44.7 bits (104),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (52%), Gaps = 8/66 (12%)
 Frame = -2

Query  30       VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
                + E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G
Sbjct  3435850  LRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRD--------MLGGVCVHTG  3435695

Query  90       CIPKKL  95
                 +P K+
Sbjct  3435694  TVPSKV  3435677

>PHRA:scaffold_32
Length=498572

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 99/231 (43%), Gaps = 34/231 (15%)
 Frame = +1

Query  39      YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
               YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  210832  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  210987

Query  99      SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
               + L +    HH      +++ +       +  +++V++ +  +R      +V++   + +
Sbjct  210988  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFAR  211167

Query  158     YENFLGSFVDAHTLELWH-----PRKGTKQITTRD---------VVIAVGGRPKE--LTC  201
               +E+        H + +        +KG    +T D          +IA G RP    L  
Sbjct  211168  FES-------EHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVP  211326

Query  202     PGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
                 G+  I SD I      + P   +VVGA  + +E A  +  + G+ V V+
Sbjct  211327  IDGQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVV  211479

>PHIF:NW_003303668.1 Phytophthora infestans T30-4 supercont1.91 
genomic scaffold, whole genome shotgun sequence
Length=525183

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 98/232 (42%), Gaps = 35/232 (15%)
 Frame = +2

Query  39     YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
              YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  92588  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  92743

Query  99     SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
              + L +    HH      +++ +       +  +++V++ +  +R      +V++   + +
Sbjct  92744  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFAR  92923

Query  158    YENFLGSFVDAHTLELWH---PRKGTKQITTRDVV------------IAVGGRPKE--LT  200
              +EN        H + +      +K    +T R  V            IA G RP    L 
Sbjct  92924  FEN-------EHEISIVRDEDDKKKNSSVTGRSNVDSLSRIKADKFLIACGTRPAHNPLI  93082

Query  201    CPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
                 G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+
Sbjct  93083  PIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVV  93238

>ALLA:FR824069 dna:supercontig supercontig:ENA1:FR824069:1:177300:1 
REF
Length=177300

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 90/400 (23%), Positives = 157/400 (39%), Gaps = 54/400 (14%)
 Frame = +2

Query  148    KVELRSKYVKYENFLGSFVDAHTLELWHP-----RKGTKQITTRDVVIAVGGRPKE-LTC  201
              + + +S  + Y +    F D H + +         K TK++     ++A G RP      
Sbjct  94901  RTQFKSARIDYISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNI  95080

Query  202    P-GGEHAISSDDIF-WMKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLR  257
              P  G+    SD I  W  ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L 
Sbjct  95081  PIDGKVIFDSDQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILS  95260

Query  258    GFDQDMANKIGEYMEVQSG-------IEFIRKTVPQSITKLE----NGQLLVKWTTEDGE  306
                D ++ + +   M            IE +   V Q  ++L          V    + G+
Sbjct  95261  FCDDEIISTLTHEMRNHGARFLLGEIIESVEVGVHQYFSRLHIS**KSSRGVSVGLKSGK  95440

Query  307    SCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIY--------  357
                    D +L   GR  +   L L+ A +  N + G + V  + QT  P+++        
Sbjct  95441  KVHG--DALLYVVGRQANTDGLNLEAAGLSRNPR-GLLSVNTKYQTKKPHMFVFISFFDS  95611

Query  358    --------AIGDVIDAPELTPVAIQAGRLLSRRLYNNSTA-------QMDYDKICTAVFT  402
                      A+GD I AP L   +++ GRL S  ++N + A       Q+        ++T
Sbjct  95612  STNANFSFAVGDCIGAPSLASTSMEQGRLASCYMWNENEANDDSIPSQLTTGNFPYGIYT  95791

Query  403    PIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDK  462
                E    G +E++      + N E+    +  L      +   A+    LK++ D    K
Sbjct  95792  IPEISMVGKTEKELTSL--KMNYEIGVAKYSELAKG---QMSGASADGMLKILFDPISLK  95956

Query  463    FVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               + G H +G  A E+     +A+ +G T     D V  +P
Sbjct  95957  -LYGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYP  96073

 Score = 43.9 bits (102),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 39/77 (51%), Gaps = 9/77 (12%)
 Frame = +1

Query  38     DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
               YDL+VIG G     C+ +AA  G+ V ++D  K S       +GG CV+ G IP K   
Sbjct  94555  SYDLIVIGSGPSASNCALDAAKRGKHVAIID--KKS------SVGGVCVHTGTIPSKTFR  94710

Query  98     QSSL-IGELMHHDSANF  113
              ++ L +    HH   +F
Sbjct  94711  EAVLHLSGYRHHGYISF  94761

>PHSO:scaffold_7
Length=4006126

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 91/230 (40%), Gaps = 32/230 (14%)
 Frame = +2

Query  39      YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
               YDLVVIG G     C+ E+A  G+KV ++D      + TS  LGG CV+ G IP K   +
Sbjct  963470  YDLVVIGSGPSATQCALESAKRGKKVAIVD------KKTS--LGGVCVHTGTIPSKTFRE  963625

Query  99      SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
               + L      H S            S  T + + ++  V   +R      + +L++  V  
Sbjct  963626  AVL------HLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVRSEEDVVRAQLKAARVDV  963787

Query  159     ENFLGSFVDAHTLELWHPRKGTK--------------QITTRDVVIAVGGRPKE--LTCP  202
                     F   H + +       K              ++     +IA G RP    L   
Sbjct  963788  IPGFARFESEHEISVVRDEADAKRSSSNSSSNLDSLSRVMADKFLIACGTRPAHNPLVPI  963967

Query  203     GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
                G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+
Sbjct  963968  DGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVV  964117

>PHPA:scaffold_17 NW_008649003.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.17, whole genome shotgun 
sequence
Length=1143538

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 96/234 (41%), Gaps = 37/234 (16%)
 Frame = -1

Query  39      YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
               YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  318436  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  318281

Query  99      SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
               + L +    HH      +++ +       +  +++V++ +  +R      +V++   + +
Sbjct  318280  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFAR  318101

Query  158     YENFLGSFVDAHTLELWHPRKGTK-----------------QITTRDVVIAVGGRPKE--  198
               +EN        H + +       K                 +I     +IA G RP    
Sbjct  318100  FEN-------EHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNP  317942

Query  199     LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
               L    G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+
Sbjct  317941  LIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVV  317780

>HYAP:scaffold_298 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_298:1:33810:1 
REF
Length=33810

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 100/226 (44%), Gaps = 21/226 (9%)
 Frame = -2

Query  38     DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
               YDLVVIG G     C+ ++A  G++V ++D            LGG CV+ G IP K   
Sbjct  13826  SYDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  13671

Query  98     QSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
              ++ L +    HH      +++ +       +  +++V++ +  +R      +V++   + 
Sbjct  13670  EAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  13491

Query  157    KYENFL-------GSFVD-AHTLELWHPRKGTKQITTRDVVIAVGGRPKE--LTCPGGEH  206
              ++E+         G+  D A T +  +      ++     ++A G RP    L    G+ 
Sbjct  13490  RFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVPIDGKI  13311

Query  207    AISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
               I SD I     ++ P   +VVGA  + +E A  +  + G+ V V+
Sbjct  13310  VIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMINVVPGHSVTVV  13173

>PLHA:NW_020187364.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_444, whole genome shotgun sequence
Length=1242542

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 99/231 (43%), Gaps = 33/231 (14%)
 Frame = +3

Query  38      DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
               +YDL+VIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   
Sbjct  456369  NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  456524

Query  98      QSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
               ++ L +    HH      +++ +       +  +++V++ +  +R      +V++   + 
Sbjct  456525  EAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  456704

Query  157     KYENFLGSFVDAHTLELWH--PRKGTKQITTRDV-----------VIAVGGRPKE--LTC  201
               ++EN        H + +      +  K+I+   V           +IA G RP    L  
Sbjct  456705  RFEN-------EHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIP  456863

Query  202     PGGEHAISSDDIFWMKKK-EPGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
                 G+  I SD I        P   +V+GA  + +E A  +  + G+ V V+
Sbjct  456864  IDGKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVV  457016

>PHKE:scaffold_794 scf_22126_794.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_794.1_contig_1:1:8282:1 
REF
Length=8282

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/232 (24%), Positives = 97/232 (42%), Gaps = 35/232 (15%)
 Frame = +3

Query  39    YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
             YDLVVIG G     C+ E+A  G++V ++D      + TS  LGG CV+ G IP K   +
Sbjct  2292  YDLVVIGSGPSATQCALESAKQGKRVAIVD------KKTS--LGGVCVHTGTIPSKTFRE  2447

Query  99    SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
             + L +    HH      +++ +       +  +++V++    +R      +V++   + +
Sbjct  2448  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVIPGFAR  2627

Query  158   YENFLGSFVDAHTLELWHPR---------------KGTKQITTRDVVIAVGGRPKE--LT  200
             +EN        H + +                       ++     +IA G RP    L 
Sbjct  2628  FEN-------EHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLV  2786

Query  201   CPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
                G+  I SD I      + P   +VVGA  + +E A  +  + G+ V V+
Sbjct  2787  PIDGKVIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVV  2942

>PHPA:scaffold_175 NW_008649161.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.175, whole genome 
shotgun sequence
Length=46572

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -1

Query  34     ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
               T   YD +VIGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCVN GC+PK
Sbjct  35610  STDVVYDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPK  35440

Query  94     KLMHQSS  100
              K+M  ++
Sbjct  35439  KVMFNTA  35419

>PHIF:NW_003303629.1 Phytophthora infestans T30-4 supercont1.130 
genomic scaffold, whole genome shotgun sequence
Length=314235

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 69/159 (43%), Gaps = 10/159 (6%)
 Frame = -1

Query  345    WVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPI  404
              W      S P I+AIGDVI    L   A + G      +       ++Y  I   ++T  
Sbjct  50982  WPLERIKSVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAIPGVIYTFP  50806

Query  405    EYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKF  463
              E+   G +EE+ K    E N+  +     P+    +   RT AE+   +KV+ DK  DK 
Sbjct  50805  EFASVGKTEEELKAEGIEYNVGKF-----PM--MANSRARTIAEADGLVKVLADKKTDKL  50647

Query  464    VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              + G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  50646  L-GVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHP  50533

>PHCA:scaffold_71 PHYCAscaffold_71
Length=252329

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 97/239 (41%), Gaps = 44/239 (18%)
 Frame = -3

Query  39     YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
              YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  40593  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  40438

Query  99     SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
              + L +    HH      +++ +       +  +++V++ +  +R      +V++   + +
Sbjct  40437  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFAR  40258

Query  158    YE----------------------NFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR  195
              +E                      N  GS  +  +L   H  K          +IA G R
Sbjct  40257  FENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADK---------FLIACGTR  40105

Query  196    PKE--LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
              P    L    G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+
Sbjct  40104  PAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVV  39928

>APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.1:1:2817317:1 
REF
Length=2817317

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 9/72 (13%)
 Frame = -3

Query  38       DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
                +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  1831887  EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  1831732

Query  98       QSSL-IGELMHH  108
                ++ L +    HH
Sbjct  1831731  EAVLHLSGFNHH  1831696

>APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.14:1:1185136:1 
REF
Length=1185136

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 51/116 (44%), Gaps = 14/116 (12%)
 Frame = -1

Query  25      STPSAVDEA----ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWG  80
               S PS   E       S  +DLVVIG G  G  C+ ++A  G+KV ++D            
Sbjct  866914  SKPSDFSEVLRNLRASEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH-------  866756

Query  81      LGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANV  136
                GG CV+ G IP K   ++ L   L  H    F  N  +A  +    S ++++  V
Sbjct  866755  -GGVCVHTGTIPSKTFREAVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRV  866597

>PYIR:scaffold_818 pir_scaffold_818 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_818:1:15072:1 
REF
Length=15072

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 53/114 (46%), Gaps = 11/114 (10%)
 Frame = +3

Query  6    LSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVC  65
            L+ + + L +K ++        S +       +YDLVVIG G     C+ E+A  G++V 
Sbjct  444  LAARTALLRSKHHLNFQQQRLVSTIKPQVA--NYDLVVIGSGPSATQCAIESAKKGKRVA  617

Query  66   VLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSL-IGELMHHDSANFGWNIA  118
            V+D            +GG CV+ G IP K   ++ L +    HH  A + +N A
Sbjct  618  VVD--------KKTFVGGVCVHTGTIPSKTFREAVLHLSGYRHHGYARYLYNCA  755

>APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.15:1:1122121:1 
REF
Length=1122121

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 47/101 (47%), Gaps = 10/101 (10%)
 Frame = +2

Query  36      SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
               S  +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K 
Sbjct  846692  SEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKT  846847

Query  96      MHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANV  136
                 ++ L   L  H    F  N  +A  +    S ++++  V
Sbjct  846848  FREAVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRV  846964

>APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.2:1:2059303:1 
REF
Length=2059303

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 9/76 (12%)
 Frame = -1

Query  38      DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
               +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  924529  EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  924374

Query  98      QSSL-IGELMHHDSAN  112
               ++ L +    HH   N
Sbjct  924373  EAVLHLSGFNHHGYCN  924326

>PYVX:scaffold_528 pve_scaffold_528 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_528:1:20845:1 
REF
Length=20845

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 41/83 (49%), Gaps = 12/83 (14%)
 Frame = -3

Query  38     DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
              DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP K   
Sbjct  12209  DYDLVVIGSGPSATQCAMESAKQGKRVAIVDKRTR--------VGGVCVHTGTIPSKTFR  12054

Query  98     QSSL-IGELMHHD---SANFGWN  116
              ++ L +    HH    S  F W+
Sbjct  12053  EAVLHLSGYRHHG**ASWQFAWS  11985

>PYAR:scaffold_398 par_scaffold_398 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_398:1:19540:1 
REF
Length=19540

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 93/197 (47%), Gaps = 19/197 (10%)
 Frame = -3

Query  181    KQITTRDVVIAVGGRP--KELTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECA  237
              + +T    +IAVG RP  +E     G+    SD I W      P + +VVGA  + +E A
Sbjct  10289  RVLTADKFLIAVGTRPARREDIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYA  10110

Query  238    GFLKGM-GYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ  295
                +  + G +V V+  R  +L   D+++A  + +Y   QSG  F      +S+ K  NG+
Sbjct  10109  SMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQSGTRFYTDETIKSVEKAANGE  9933

Query  296    LLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL-NEKTGRIWV-KNEQTST  353
              ++VK  +  G++     D +L   GR       GL+ A V L  +K G + V  N +TS 
Sbjct  9932   VIVKLNS--GKTI--IGDGLLYTVGRQGSTD--GLNLAAVGLETDKRGLLQVDDNFRTSV  9771

Query  354    PNIYAIGDVIDAPELTP  370
              P++Y     +  P   P
Sbjct  9770   PHMY-----VSCPSFEP  9735

 Score = 42.0 bits (97),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 37/73 (51%), Gaps = 8/73 (11%)
 Frame = -3

Query  30     VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
              + + + S  +DL+VIG G  G  C+ + A  G+ V ++D            +GG C++ G
Sbjct  11039  LQDLKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKRD--------MVGGVCIHTG  10884

Query  90     CIPKKLMHQSSLI  102
               +P K+    SL+
Sbjct  10883  TVPSKVRSYPSLL  10845

>SAPA:scaffold_87 supercont2.87 dna:supercontig supercontig:ASM15154v2:supercont2.87:1:167146:1 
REF
Length=167146

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 53/116 (46%), Gaps = 11/116 (9%)
 Frame = +1

Query  6      LSIQESALNTKKNMQIHDPST-PSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKV  64
              + +  + L+T+   +  D S+  + +     S  +DLVVIG G  G  C+ ++A  G+KV
Sbjct  57772  VPVLRAGLSTEAEAKADDASSFTNILRNLRASEHFDLVVIGSGPSGQKCAIDSAKHGKKV  57951

Query  65     CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA  120
               ++D             GG CV+ G IP K   ++ L   L  H    F  N  SA
Sbjct  57952  AIIDKKDMH--------GGVCVHTGTIPSKTFREAVL--HLTAHRHKGFYGNAYSA  58089

>SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.13:1:908568:1 
REF
Length=908568

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 40/87 (46%), Gaps = 10/87 (11%)
 Frame = -2

Query  34      ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
                 S  +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP 
Sbjct  323288  RASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPS  323133

Query  94      KLMHQSSLIGELMHHDSANFGWNIASA  120
               K   ++ L   L  H    F  N  SA
Sbjct  323132  KTFREAVL--HLTAHRHKGFYGNAYSA  323058

>PYUU:scaffold_2014 scf1117875582014 dna:supercontig supercontig:pug:scf1117875582014:1:494327:1 
REF
Length=494327

 Score = 46.6 bits (109),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 9/72 (13%)
 Frame = +3

Query  38      DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
               DYDLVVIG G     C+ E+A  G++V ++D      + TS  +GG CV+ G IP K   
Sbjct  329151  DYDLVVIGSGPSATQCAIESAKQGKRVAIVD------KKTS--VGGVCVHTGTIPSKTFR  329306

Query  98      QSSL-IGELMHH  108
               ++ L +    HH
Sbjct  329307  EAVLHLSGYRHH  329342

 Score = 39.7 bits (91),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 67/151 (44%), Gaps = 12/151 (8%)
 Frame = +2

Query  357     YAIGDVIDAPELTPVAIQAGRLLSRRLYNNS----TAQMDYDKICTAVFTPIEYGCCGLS  412
               YA+GD I AP L   +++ GRL +  +++      T+Q++       ++T  E    G +
Sbjct  330518  YAVGDCIGAPSLASTSMEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKT  330697

Query  413     EED-SKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLG  471
               E+  +KE     N E+    +  L      +   +     LK++ D T  K + G H +G
Sbjct  330698  EQQLTKEGV---NFEIGIAKYSELA---KGQMSGSTAGGMLKILFDPTTLK-LFGVHAIG  330856

Query  472     PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                 A E+     +A+ +G +     D V  +P
Sbjct  330857  EGATEIIHIGQVAIAMGCSVTYFRDAVFNYP  330949

>PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 
genomic scaffold, whole genome shotgun sequence
Length=5928454

 Score = 45.8 bits (107),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 10/92 (11%)
 Frame = -1

Query  4        LRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQK  63
                LR +   S  +T+ + + + P T + + E   S  +DL+VIG G  G  C+ ++A  G+ 
Sbjct  4158007  LRAATARSTFSTEDSAE-NRPLTDT-LRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKS  4157834

Query  64       VCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
                V ++D            LGG CV+ G +P K+
Sbjct  4157833  VAIIDKRD--------MLGGVCVHTGTVPSKV  4157762

>PYIW:scaffold_924 piw_scaffold_924 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_924:1:12606:1 
REF
Length=12606

 Score = 44.3 bits (103),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 9/72 (13%)
 Frame = +3

Query  38    DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
              YDLVVIG G     C+ E+A  G++V V+D            +GG CV+ G IP K   
Sbjct  1485  SYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFR  1640

Query  98    QSSL-IGELMHH  108
             ++ L +    HH
Sbjct  1641  EAVLHLSGYRHH  1676

>ALCA:scaffold_1003 AcNc2_CONTIG_1003_length_4568 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_1003_length_4568:1:4568:1 
REF
Length=4568

 Score = 43.9 bits (102),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 35/71 (49%), Gaps = 9/71 (13%)
 Frame = -1

Query  39    YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
             YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K   +
Sbjct  4160  YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  4005

Query  99    SSL-IGELMHH  108
             + L +    HH
Sbjct  4004  AVLHLSGYRHH  3972

 Score = 37.7 bits (86),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 36/153 (24%), Positives = 64/153 (42%), Gaps = 13/153 (8%)
 Frame = -1

Query  357   YAIGDVIDAPELTPVAIQAGRLLSRRLYNNS-------TAQMDYDKICTAVFTPIEYGCC  409
             +A+GD I AP L   +++ GRL S  ++N          +Q+        ++T  E    
Sbjct  3002  FAVGDCIGAPSLASTSMEQGRLASCYMWNEDESNDDSIPSQLKTGNFPYGIYTIPEISMV  2823

Query  410   GLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHY  469
             G +E+    +  + N E+    +  L      +   A+    LK++ D    K + G H 
Sbjct  2822  GHTEKQLTSQ--QINYEIGVAKYSELA---KGQMSGASADGMLKILFDPHSLK-LFGVHA  2661

Query  470   LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             +G  A E+     +A+ +G T     D V  +P
Sbjct  2660  IGEGATEIIHIGQVAIAMGATLTYFRDAVFNYP  2562

>PYIW:scaffold_1034 piw_scaffold_1034 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1034:1:11717:1 
REF
Length=11717

 Score = 43.5 bits (101),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (52%), Gaps = 8/64 (13%)
 Frame = -1

Query  32    EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
             E + S  +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +
Sbjct  3839  ELKASEHFDLIVIGSGPAGQKCAIDHAKHGKTVAVIDK--------RDMLGGVCIHTGTV  3684

Query  92    PKKL  95
             P K+
Sbjct  3683  PSKV  3672

>PYVX:scaffold_1272 pve_scaffold_1272 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1272:1:5190:1 
REF
Length=5190

 Score = 43.5 bits (101),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 39/82 (48%), Gaps = 14/82 (17%)
 Frame = +2

Query  23   DPSTPSAVDEAET------SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  76
            DP  P     +ET      S  +DL+V+G G  G  C+ ++A  G+ V ++D        
Sbjct  17   DPRVPPGKPLSETLRELKASEHFDLIVVGSGPAGQKCAIDSAKHGKSVAIIDK-------  175

Query  77   TSWGLGGTCVNVGCIPKKLMHQ  98
                LGG CV+ G +P K+  Q
Sbjct  176  -RDMLGGVCVHTGTVPSKVSIQ  238

>HYAP:scaffold_26 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_26:1:584877:1 
REF
Length=584877

 Score = 43.1 bits (100),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (48%), Gaps = 8/88 (9%)
 Frame = +3

Query  11      SALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYV  70
               S+ +   N++ +       + E   S  +DL+VIG G  G  C+ ++A  G  V ++D  
Sbjct  151329  SSRSNSPNLEANKQLLTETLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--  151502

Query  71      KPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
                         LGG CV+ G +P K+ ++
Sbjct  151503  ------KRDMLGGVCVHTGTVPSKVPYR  151568

>PHKE:scaffold_15 scf_22126_15.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_15.1_contig_1:1:227166:1 
REF
Length=227166

 Score = 43.1 bits (100),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 81/199 (41%), Gaps = 26/199 (13%)
 Frame = -3

Query  178    KGTKQITTRDVVIAVGGRPKELTCPGGEHAI-------SSDDIFWMKKKEPGKTLVVGAS  230
              +G  ++ +  ++++ G   K L  PG E  +       ++ D F+ + KE    +V+G  
Sbjct  78346  EGMGELVSETLILSTGASAKYLGIPGEETNVGRGVSTCATCDGFFFRNKE---IIVIGGG  78176

Query  231    YVALECAGFLKGMGYDVKVMVRSILLRG--FDQDMANKIGEYMEVQSGIEFIRKTVPQSI  288
                ALE A FL   G  V ++ R   LRG    QD A            +E      P  +
Sbjct  78175  DSALEEASFLSRFGSKVTLVHRREELRGSKIMQDRARS-------NEKVEMALNRTPLEV  78017

Query  289    TKLENGQLLVK-WTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVK  347
                 +NG   +K    E GE        V  A G  P+   LG    ++  +E  G I   
Sbjct  78016  LAGDNGVTGLKVLNNETGEEEIIPASGVFVAIGHTPNTGFLG---GQITTDEH-GYILTT  77849

Query  348    --NEQTSTPNIYAIGDVID  364
                  +T+ P ++A GDV D
Sbjct  77848  PGTSETNIPGVFACGDVQD  77792

>PYIR:scaffold_33 pir_scaffold_33 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_33:1:77351:1 
REF
Length=77351

 Score = 43.1 bits (100),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 34/65 (52%), Gaps = 8/65 (12%)
 Frame = +1

Query  32     EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
              E + S  +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +
Sbjct  59287  ELKASEHFDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTV  59442

Query  92     PKKLM  96
              P K++
Sbjct  59443  PSKVL  59457

>ALCA:scaffold_5 AcNc2_CONTIG_5_length_245754 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_5_length_245754:1:245754:1 
REF
Length=245754

 Score = 42.7 bits (99),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 11/78 (14%)
 Frame = +1

Query  21     IHDPSTPSAVD---EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGT  77
              I  P T +  D   + + S  YDL+VIG G  G  C+ ++A  G+ V ++D  +      
Sbjct  10870  IPSPKTTALTDMLRDLKASEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH----  11037

Query  78     SWGLGGTCVNVGCIPKKL  95
                  GG CV+ G +P K+
Sbjct  11038  ----GGVCVHTGTVPSKV  11079

>PHSO:scaffold_3
Length=10773376

 Score = 42.7 bits (99),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 33/64 (52%), Gaps = 8/64 (13%)
 Frame = +2

Query  32       EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
                E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            +GG CV+ G +
Sbjct  5403842  ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMMGGVCVHTGTV  5403997

Query  92       PKKL  95
                P K+
Sbjct  5403998  PSKV  5404009

>PYIW:scaffold_7307 piw_scaffold_7307 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_7307:1:686:1 
REF
Length=686

 Score = 41.2 bits (95),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 48/114 (42%), Gaps = 9/114 (8%)
 Frame = +3

Query  390  QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES  449
             ++Y+ I   ++T  E    G +EE  KE       E    N        +   R   E+
Sbjct  21   HVNYNAIPGVIYTFPEVASVGKTEEQLKE-------EGVAYNVGKFPMMANSRARAVGEA  179

Query  450  -CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               +KVI DK  DK ++G H +  NAGE+     L M+ G   + +  T   HP
Sbjct  180  DGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHP  338

>PHKE:scaffold_65 scf_22126_65.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_65.1:1:120598:1 
REF
Length=120598

 Score = 42.7 bits (99),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 32/63 (51%), Gaps = 8/63 (13%)
 Frame = -1

Query  32     EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
              E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G +
Sbjct  39418  ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIVD--------KRDMLGGVCVHTGTV  39263

Query  92     PKK  94
              P K
Sbjct  39262  PSK  39254

>PHPA:scaffold_139 NW_008649125.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.139, whole genome 
shotgun sequence
Length=64693

 Score = 42.4 bits (98),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 8/82 (10%)
 Frame = +2

Query  35    TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
             +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  1142  SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  1297

Query  95    LMHQSSLIGELMHHDSANFGWN  116
              +  S+ +     HD  ++G +
Sbjct  1298  ALLHSTHLLHTAQHDFKSYGID  1363

>PLHA:NW_020187508.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_589, whole genome shotgun sequence
Length=103710

 Score = 42.0 bits (97),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (52%), Gaps = 8/66 (12%)
 Frame = -1

Query  30     VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
              + +   S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G
Sbjct  88527  LSKLRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTG  88372

Query  90     CIPKKL  95
               IP K+
Sbjct  88371  TIPSKV  88354

>PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:pug:scf1117875581402:1:979788:1 
REF
Length=979788

 Score = 41.6 bits (96),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 42/91 (46%), Gaps = 13/91 (14%)
 Frame = +3

Query  5       RLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKV  64
               R ++  SA  T     + D      + E + S  +DL+VIG G  G  C+ ++A  G+ V
Sbjct  621174  RRALSSSATTTSGGKPLSD-----MLRELKASEHFDLIVIGSGPAGQKCAIDSAKHGKSV  621338

Query  65      CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
                ++D             GG CV+ G +P K+
Sbjct  621339  AIIDKRDMH--------GGVCVHTGTVPSKV  621407

>ALLA:FR824046 dna:supercontig supercontig:ENA1:FR824046:1:580768:1 
REF
Length=580768

 Score = 40.8 bits (94),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 46/101 (46%), Gaps = 14/101 (14%)
 Frame = -1

Query  1       MAKLRLSIQESALNTKKNM---QIHDPSTPSAVD---EAETSYDYDLVVIGGGSGGLACS  54
               M +   ++    LN  ++     +  P T    D   + + S  YDL+V+G G  G  C+
Sbjct  456280  MTREHTTLLPKVLNLHRHCYSKSVSSPKTAVLTDMLRDLKASEHYDLIVVGSGPAGQKCA  456101

Query  55      KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
                ++A  G+ V ++D  +          GG CV+ G +P K+
Sbjct  456100  IDSAKHGKSVAIIDKNEMH--------GGVCVHTGTVPSKV  456002

>PYUU:scaffold_1314 scf1117875581314 dna:supercontig supercontig:pug:scf1117875581314:1:162732:1 
REF
Length=162732

 Score = 40.0 bits (92),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = -2

Query  188    VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP-GKTL-VVGASYVALECAGFLKGMGY  245
              VVIA G  P++L  PGG+H+     I  +K K P GK + V+GA  +  + + FL  +G 
Sbjct  48923  VVIATGVLPRDLKIPGGDHSKVLSYIDVLKHKAPVGKRVAVIGAGGIGFDVSEFLTHIGK  48744

Query  246    DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                 + V ++  + +  D +N       V+ G++ +++ VP
Sbjct  48743  SASLDV-NLFAKEWGIDTSN------SVRGGVQGVKQEVP  48645

>PYAP:scaffold_246 pag1_scaffold_246 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_246:1:40681:1 
REF
Length=40681

 Score = 39.7 bits (91),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 33/67 (49%), Gaps = 8/67 (12%)
 Frame = -2

Query  32     EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
              E + S  +DL+VIG G  G  C+ + A  G+ V ++D             GG CV+ G +
Sbjct  21912  ELKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTV  21757

Query  92     PKKLMHQ  98
              P K+  Q
Sbjct  21756  PSKVR*Q  21736

>PHSO:scaffold_5
Length=6830280

 Score = 39.7 bits (91),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 9/100 (9%)
 Frame = -3

Query  188      VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
                VVIA G  P+EL  PG +H      I  +K K P   K  V+GA  +  + A F+  +G 
Sbjct  3857974  VVIATGVLPRELKIPGADHPKVLSYIDVLKNKAPVGKKVAVIGAGGIGFDVAEFITHVGE  3857795

Query  246      DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                     V +   R +  DM N       V+ G+  I+ ++P
Sbjct  3857794  STSSSVDA-FAREWGIDMTN------SVRGGVAGIKPSIP  3857696

>PHIF:NW_003303230.1 Phytophthora infestans T30-4 supercont1.538 
genomic scaffold, whole genome shotgun sequence
Length=43771

 Score = 39.3 bits (90),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (51%), Gaps = 9/57 (16%)
 Frame = +3

Query  40    DLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
             D +VIG G GG   +  ++  G K  +++  +         LGG C +VGCIP K M
Sbjct  6387  DTLVIGSGPGGYVAALHSSRLGLKTVIVERDQ---------LGGVCTHVGCIPSKAM  6530

>SAPA:scaffold_1351 supercont2.1351 dna:supercontig supercontig:ASM15154v2:supercont2.1351:1:2108:1 
REF
Length=2108

 Score = 37.0 bits (84),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 39/81 (48%), Gaps = 9/81 (11%)
 Frame = +1

Query  10    ESALNTKKNMQIHDPST-PSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  68
              + L+T+   +  D S+  + +     S  +DLVVIG G  G  C+ ++A  G+KV ++D
Sbjct  1888  RAGLSTEAEAKADDASSFTNILRNLRASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIID  2067

Query  69    YVKPSPQGTSWGLGGTCVNVG  89
                          GG CV+ G
Sbjct  2068  KKDMH--------GGVCVHTG  2106

>PHPA:scaffold_15 NW_008649001.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.15, whole genome shotgun 
sequence
Length=1176021

 Score = 37.4 bits (85),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 9/100 (9%)
 Frame = -1

Query  188     VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
               VVIA G  P+ L  PG +H      I  +K K P   K  ++GA  +  + A FL  +G 
Sbjct  238518  VVIATGVLPRTLKIPGADHPKVLSYIDVLKHKAPVGKKVAIIGAGGIGFDVAEFLSHVGE  238339

Query  246     DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                    V  +  R +  D  N       V+ G+  I+ ++P
Sbjct  238338  STSSSV-DVFAREWGIDTTN------SVRGGVAGIKPSIP  238240

>PLHA:NW_020187445.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_525, whole genome shotgun sequence
Length=2102221

 Score = 36.6 bits (83),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 9/100 (9%)
 Frame = -3

Query  188      VVIAVGGRPKELTCPGGEH--AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGY  245
                VV+A G  P+ L  PG +H   +S  D+   K K   +  ++GA  +  + A FL  +G 
Sbjct  1671314  VVMASGVLPRPLKIPGADHPMVLSYMDVLKKKSKVGQRVAIIGAGGIGFDVAEFLTHVGE  1671135

Query  246      DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                     V  +  R +  D  N       V+ G+  I+ +VP
Sbjct  1671134  STSSSV-EVFAREWGIDTTN------SVRGGVAGIKSSVP  1671036

>PHIF:NW_003303758.1 Phytophthora infestans T30-4 supercont1.1 
genomic scaffold, whole genome shotgun sequence
Length=6928287

 Score = 36.2 bits (82),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 9/100 (9%)
 Frame = +2

Query  188      VVIAVGGRPKELTCPGGEH--AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGY  245
                VVIA G  P+ L  PG +H   +S  D+   K     K  ++GA  +  + A FL  +G 
Sbjct  3667661  VVIATGVLPRALKIPGADHPKVLSYLDVLKNKAPVGNKVAIIGAGGIGFDVAEFLAHVGE  3667840

Query  246      DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                     V  +  R +  D  N       V+ G+  ++ ++P
Sbjct  3667841  STSSSV-DVFAREWGIDTTN------SVRGGVAGVKPSIP  3667939

>SAPA:scaffold_680 supercont2.680 dna:supercontig supercontig:ASM15154v2:supercont2.680:1:3978:1 
REF
Length=3978

 Score = 36.2 bits (82),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 9/114 (8%)
 Frame = +1

Query  390  QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES  449
             ++Y+ I   V+T  E    G +EE+ K      N+  Y+    P+    +   RT  E+
Sbjct  70   HVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPM--MANSRARTVGET  228

Query  450  -CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              ++K++  K  DK ++G H +  NAGE+     L ++ G + + +  T   HP
Sbjct  229  DGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHP  387

>PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 
genomic scaffold, whole genome shotgun sequence
Length=4722445

 Score = 36.2 bits (82),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (57%), Gaps = 1/51 (2%)
 Frame = -2

Query  317      NATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPE  367
                N TG  PD+A+ GLD  R ++  +TG     +  TS P I+A    +DAPE
Sbjct  2645028  NPTGFLPDLARSGLDCVRSRVG-RTGFRAFTSAGTSCPRIFARASSMDAPE  2644879

>PHRA:scaffold_1829
Length=3783

 Score = 35.4 bits (80),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 9/100 (9%)
 Frame = -3

Query  188   VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
             VVI+ G  P+ L  PG +H      I  +KKK P   K  ++GA  +  + A F+  +G 
Sbjct  2917  VVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKVAIIGAGGIGFDVAEFITHVGE  2738

Query  246   DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                  V +   R +  D  N       V+ G+  I+ ++P
Sbjct  2737  STSSSVDA-FAREWGIDTTN------SVRGGVAGIKSSIP  2639

>PHRA:scaffold_104
Length=157244

 Score = 35.4 bits (80),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 9/100 (9%)
 Frame = +1

Query  188     VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
               VVI+ G  P+ L  PG +H      I  +KKK P   K  ++GA  +  + A F+  +G 
Sbjct  136840  VVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKVAIIGAGGIGFDVAEFITHVGE  137019

Query  246     DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                    V +   R +  D  N       V+ G+  I+ ++P
Sbjct  137020  STSSSVDA-FAREWGIDTTN------SVRGGVAGIKSSIP  137118

>HYAP:scaffold_17 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_17:1:650085:1 
REF
Length=650085

 Score = 34.3 bits (77),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 54/124 (44%), Gaps = 16/124 (13%)
 Frame = -1

Query  120     ADGSASTFSWKQLVANVDGYIRGIN-FKYKVELRSKYVKYENFLGSFVDAHTLELWHPRK  178
               AD     F+  ++V   + +   +  F+ +++LR   VK    LG  V+A  L      K
Sbjct  204018  ADAIGGQFNMAKIVPGKEEFYETLRYFEKQLKLRGVNVK----LGHRVEAAELMSGAFDK  203851

Query  179     GTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALEC  236
                        VVIA G  P+ LT PG +H      I  +K + P   K  ++GA  +  + 
Sbjct  203850  ---------VVIATGVVPRSLTIPGADHPKVLSYIDVLKNEAPVGQKVAIIGAGGIGFDV  203698

Query  237     AGFL  240
               A FL
Sbjct  203697  AEFL  203686

>PHKE:scaffold_220 scf_22126_220.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_220.1_contig_1:1:58807:1 
REF
Length=58807

 Score = 34.3 bits (77),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 26/49 (53%), Gaps = 4/49 (8%)
 Frame = +1

Query  39     YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGL--GGTC  85
              YD++VIGGGS GL     AA  G  V +LD  K    G   G+  GG C
Sbjct  50929  YDVIVIGGGSAGLMACVAAAEHGASVLLLD--KGDQLGRKLGISGGGRC  51069

Lambda      K        H        a         alpha
   0.317    0.134    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 167521147150

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40