Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHPA:scaffold_63252143255760121244120.0
PHSO:scaffold_12801037280390795741240.0
PHIF:NW_003303697.143217143508098034090.0
PHCA:scaffold_8410144610428096233660.0
PHKE:scaffold_98684217136998433240.0
PHRA:scaffold_5614711114949580331330.0
PLHA:NW_020189861.11841399184420996828170.0
PYAP:scaffold_162218662414579020560.0
PYIW:scaffold_711127701502879018850.0
PYUU:scaffold_20371309816131144456017090.0
PYIR:scaffold_8981379979557016840.0
ALCA:scaffold_904986726878113455e-156
ALLA:FR8241048328994155510141e-139
APAS:scaffold_127293347304853877528e-131
SAPA:scaffold_244277164289244095699e-125
SADI:scaffold_41748841752971404466e-105
APIN:scaffold_203784123788251404483e-96
PYAR:scaffold_2913664142271894627e-80
PYVX:scaffold_2754347451082464e-19
PYVX:scaffold_1323213395611794e-13
PYIW:scaffold_9631208312178321391e-06
PYIR:scaffold_59455544570952818.0
PHSO:scaffold_335109135125265819.3
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYSO_321157

Length=1180
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  1704       0.0   
PHSO:scaffold_1                                                       1593       0.0   
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  1317       0.0   
PHCA:scaffold_84 PHYCAscaffold_84                                     1301       0.0   
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  1285       0.0   
PHRA:scaffold_56                                                      1211       0.0   
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  1089       0.0   
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  796        0.0   
PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:pi...  730        0.0   
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  662        0.0   
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  653        0.0   
ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig sup...  522        5e-156
ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:...  395        1e-139
APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_a...  294        8e-131
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  223        9e-125
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  176        6e-105
APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_i...  177        3e-96 
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  182        7e-80 
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  99.4       4e-19 
PYVX:scaffold_1323 pve_scaffold_1323 dna:supercontig supercontig:...  73.6       4e-13 
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  58.2       1e-06 
PYIR:scaffold_59 pir_scaffold_59 dna:supercontig supercontig:pir_...  35.8       8.0   
PHSO:scaffold_3                                                       35.8       9.3   

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 1704 bits (4412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 947/1212 (78%), Positives = 1043/1212 (86%), Gaps = 54/1212 (4%)
 Frame = +2

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
               MEKVQQQ HVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSA+VTTAEVQAFN
Sbjct  252143  MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  252322

Query  61      AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
               AILQQTE ELR+KAELVLNGMVNSS++AQNNQ+QSG  LPAVTVAA PST+HRSGY    
Sbjct  252323  AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  252502

Query  121     VAKSMDASSIPMEFFRE----------------------QFRNSSVEVRQTLMPSPLHLQ  158
                 + MDASSIPMEFFRE                      QFRNSSVE+RQ+LMPSP   Q
Sbjct  252503  KPRQMDASSIPMEFFREVSAVG*SCEKEIPNVSLLYGLQQFRNSSVEIRQSLMPSPEPWQ  252682

Query  159     RHLGIHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYAD  218
               RH G+HHGRLMRKKTTQHCRLLPSVNKVDPSAP PELREEDAKHGVLNLVTRGFLPAYAD
Sbjct  252683  RHFGVHHGRLMRKKTTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYAD  252862

Query  219     LTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL--Rap  276
               LTPAFAGP+G ++GS GG+MKQRATRI+DRSEQ+VR TPFTQSTGYNLA+LKFDL     
Sbjct  252863  LTPAFAGPNGTSNGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPT  253042

Query  277     ftppppapessppatattrrrstrrgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSA  336
                 PP P  +   P  +TTRRRS R+ SA  GP++VTMSFP+S    K+ RS  Q+SL+SA
Sbjct  253043  PPPPIPESKDLMPPESTTRRRSVRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSA  253222

Query  337     AIAAFTNQSDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNE  396
               A+AAFTNQ +D+++NR RFS+    +   E  E+ ++E  E  E   LGANVDKIRGYNE
Sbjct  253223  AVAAFTNQGEDMDNNRGRFSDDDVSDEDQENDENGKDEDAEMEE---LGANVDKIRGYNE  253393

Query  397     LLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYAD  456
               LLDAYSLHQFLIHKGRTMRDTPEF+SFRRVAQELWGSVEEALRALE LLTQYFVPLAY D
Sbjct  253394  LLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVD  253573

Query  457     GQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRM  516
               GQRLL+LA TGQPRFSKRELLSCIVNE+Q+M+VLRRPGQRYKGRDRKRRAATT+QAC+RM
Sbjct  253574  GQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRM  253753

Query  517     WSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWH  576
               W +RRRY RSRASD +ATKIQLAWRA+SCH ALK RLRE+RRE+L+ WE +M  LK+QW 
Sbjct  253754  WLVRRRYARSRASDINATKIQLAWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWS  253933

Query  577     QIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELT  636
               QIA RRRVVVHVPSLSLDEH RLSAENFAVQQNLQLTR+CA ALDSNVDLLVYV+PFELT
Sbjct  253934  QIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELT  254113

Query  637     ADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAG  696
               ADV  YFLKLLQLGGL DS PRVK VFPEQ+ RFPAHFSLSS+LLYSPHCLRRIRHYT G
Sbjct  254114  ADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTG  254293

Query  697     KDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYEL  756
               K+AYLVMGLPG EDQRLAIALDLPILGAPP QALPLLTRSGGKRLLIRADVNVP GTYEL
Sbjct  254294  KEAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYEL  254473

Query  757     YDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYW  816
               YDEHEL AALAKLA+AHMDQP+WL+KLDYDPLGVGEAVVDLS +QAMRELRREK+TPEYW
Sbjct  254474  YDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYW  254653

Query  817     RQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSF  876
               RQPGPRDAA+K++LAELERPG+LARLA PMH+E+FP+WR+Y +A+ HFGCV+EAVPPT+ 
Sbjct  254654  RQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAI  254833

Query  877     VASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS-GGGLNRKTVAFTFPQTVAPH  935
                ASPE +++ VEPAYVRANLF+DPDG+VH+TSTQNVLA+ GGGLNRKTVAFTFPQT APH
Sbjct  254834  AASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPH  255013

Query  936     EAVK-----------------------GACTAAGKLLVETNVWGYVSLDFVVFQDDKSGG  972
               EA+K                       GAC AAGKLLVETNVWGYVSLDFVVFQD+KS G
Sbjct  255014  EAIKVRLWCIVVQHYHPRTDCC*FSL*GACNAAGKLLVETNVWGYVSLDFVVFQDEKSNG  255193

Query  973     APRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGT  1032
               APRLWALAVHPFLTDSAASFACFHLLARGVLD +SG YR+A+ + T     +GR+G G T
Sbjct  255194  APRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTV---TGRNGSGCT  255364

Query  1033    TDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGT  1092
               TDLLLREASLAK + AG PRC+VVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGT
Sbjct  255365  TDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGT  255544

Query  1093    LFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGN  1152
               LFLL DSLTAGVFGVLS+GET +GALAF+RTALEVIGREAG+T+ M +SPSRP S RSGN
Sbjct  255545  LFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSSPSRPVSGRSGN  255724

Query  1153    FAQVLSAVRAST  1164
               FAQVLSAVRAST
Sbjct  255725  FAQVLSAVRAST  255760

>PHSO:scaffold_1
Length=13391543

 Score = 1593 bits (4124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 939/957 (98%), Positives = 939/957 (98%), Gaps = 18/957 (2%)
 Frame = +3

Query  1        MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
                MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN
Sbjct  2801037  MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  2801216

Query  61       AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
                AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR
Sbjct  2801217  AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  2801396

Query  121      VAKSMDASSIPMEFFRE------------------QFRNSSVEVRQTLMPSPLHLQRHLG  162
                VAKSMDASSIPMEFFRE                  QFRNSSVEVRQTLMPSPLHLQRHLG
Sbjct  2801397  VAKSMDASSIPMEFFREVSPLLMC*ITS*LTLYAQQFRNSSVEVRQTLMPSPLHLQRHLG  2801576

Query  163      IHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPA  222
                IHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPA
Sbjct  2801577  IHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPA  2801756

Query  223      FagpsgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapftpppp  282
                FAGPSGANDGSGGGVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPFTPPPP
Sbjct  2801757  FAGPSGANDGSGGGVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPFTPPPP  2801936

Query  283      apessppatattrrrstrrgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFT  342
                APESSPPATATTRRRSTRRGSAGHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFT
Sbjct  2801937  APESSPPATATTRRRSTRRGSAGHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFT  2802116

Query  343      NQSDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNELLDAYS  402
                NQSDDLEDNRERFSEQPDEEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYS
Sbjct  2802117  NQSDDLEDNRERFSEQPDEEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYS  2802296

Query  403      LHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLS  462
                LHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLS
Sbjct  2802297  LHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLS  2802476

Query  463      LASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRR  522
                LASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRR
Sbjct  2802477  LASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRR  2802656

Query  523      YVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRR  582
                YVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRR
Sbjct  2802657  YVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRR  2802836

Query  583      RVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHY  642
                RVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHY
Sbjct  2802837  RVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHY  2803016

Query  643      FLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLV  702
                FLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLV
Sbjct  2803017  FLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLV  2803196

Query  703      MGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHEL  762
                MGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHEL
Sbjct  2803197  MGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHEL  2803376

Query  763      FAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPR  822
                FAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPR
Sbjct  2803377  FAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPR  2803556

Query  823      DAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPET  882
                DAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPET
Sbjct  2803557  DAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPET  2803736

Query  883      ASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVK  939
                ASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVK
Sbjct  2803737  ASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVK  2803907

 Score = 459 bits (1181),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 225/225 (100%), Positives = 225/225 (100%), Gaps = 0/225 (0%)
 Frame = +2

Query  940      GACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLA  999
                GACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLA
Sbjct  2803976  GACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLA  2804155

Query  1000     RGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSY  1059
                RGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSY
Sbjct  2804156  RGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSY  2804335

Query  1060     VFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALA  1119
                VFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALA
Sbjct  2804336  VFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALA  2804515

Query  1120     FMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
                FMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST
Sbjct  2804516  FMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  2804650

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 1317 bits (3409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 751/980 (77%), Positives = 833/980 (85%), Gaps = 41/980 (4%)
 Frame = +3

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
               M+KVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRH+A+VTTAEVQAFN
Sbjct  432171  MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  432350

Query  61      AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
               AILQQTE ELRAKAELVLNGMVNSSSSA+NNQ+QSGTLLPAVTVAA PS  HRSGY K  
Sbjct  432351  AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  432530

Query  121     VAKSMDASSIPMEFFRE----------------------------QFRNSSVEVRQTLMP  152
                 + MDASSIP+EFFRE                            QFRN+SVE+RQ+L P
Sbjct  432531  KPRQMDASSIPVEFFREVSAFE*DILL*GNLYVTVYLCISLCSFQQFRNNSVEIRQSL-P  432707

Query  153     SPLHLQRHLGIHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGF  212
                P   +RH GIHHGRLMRKKTTQHCRLLPSVNK DPS PTPELREEDAKHGVLNLVTRGF
Sbjct  432708  EPW--ERHFGIHHGRLMRKKTTQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGF  432881

Query  213     LPAYADLTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFD  272
               LPAYADLTP F+G S  + G    VMKQRATRI++RSEQ VR TPFTQSTGYNLA+LKFD
Sbjct  432882  LPAYADLTPVFSGTSDGSGGG---VMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFD  433052

Query  273     LRapftppppapessppatattrrrstrrgsagHGPSKVTMSFPESARADKSGRSVRQSS  332
               LRAP TPPP  PE++ P + T RR + R  +   GP+  T S P S+   K+GRS   +S
Sbjct  433053  LRAPPTPPPVVPEATFPDSTTRRRSTRRSSAL-QGPNPFTRSVPISSSKIKNGRSAHPTS  433229

Query  333     LVSAAIAAFTNQSDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIR  392
               L+SAA+AAFTNQ +D E+NR+RFS+    +   E  E+D++E  E  +   LGANVDKIR
Sbjct  433230  LMSAAVAAFTNQGEDTENNRDRFSDDDISDEEQESDENDKDEYAEMEK---LGANVDKIR  433400

Query  393     GYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPL  452
               GYNELLD YSLHQFLIHKGRTMRDTPEFVSFRRV QELWGSVEEALRALETLL QYFVPL
Sbjct  433401  GYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVEEALRALETLLAQYFVPL  433580

Query  453     AYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQA  512
               AY DGQRLL+LA TGQPRFSKRELLSCIVNE+QVM+VLRRPGQRYKGRDRKRRAATTI+A
Sbjct  433581  AYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEA  433760

Query  513     CVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLK  572
               CVRMW +RRRY R+RASDF+A+KIQLAWRA+SCH +LKARLRE+  E+L+ WE +M++LK
Sbjct  433761  CVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLK  433940

Query  573     TQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAP  632
               + W QIAGRRRVVVHVPSLSLDEHSRL AENFA+QQNLQLTR+CAAALDSNV+LL+YV+P
Sbjct  433941  SHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSP  434120

Query  633     FELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRH  692
               FELT+DVS YFLKLLQLGGL DSRPRVKLVFPEQ  RFPAHFSLSS+LLYSPHCLRRIRH
Sbjct  434121  FELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRH  434300

Query  693     YTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTG  752
               YT GK+AYLVMGLPG EDQRLA+ALDLPILGAPP QALPLLTRSGGKRLLIRADVNVP G
Sbjct  434301  YTTGKEAYLVMGLPGAEDQRLAMALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNG  434480

Query  753     TYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKT  812
               TYELYDEHE+ AALAKLA+AHMDQPRWL+KLDYDPL VGEAVVDLS MQAMRELRREK+T
Sbjct  434481  TYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRT  434660

Query  813     PEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVP  872
               PEYWRQPGPRDAA+KL+LAELERPG+LAR+ATPM TEIFP WRE+ +A+ HFGCVVEAVP
Sbjct  434661  PEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVP  434840

Query  873     PTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS-GGGLNRKTVAFTFPQT  931
               PT+  AS E ++  VEPAYVRANLF+DPDG+VHI+STQNVLA+ GGGLNRKTVAFTFPQT
Sbjct  434841  PTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGGGGLNRKTVAFTFPQT  435020

Query  932     VAPHEAVK--GACTAAGKLL  949
                AP+EA+K    C A    L
Sbjct  435021  AAPYEAIKVRYGCIAVHSFL  435080

 Score = 366 bits (939),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 196/226 (87%), Gaps = 3/226 (1%)
 Frame = +1

Query  940     GACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLA  999
               GAC AAGKLLVETNVWGYVSLDFVVFQD+KS  APRLWALAVHPFLTDSA SFACFHLLA
Sbjct  435106  GACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLA  435285

Query  1000    RGVLDASSGGYRMAAANSTLAAVNSGR-SGGGGTTDLLLREASLAKGAQAGTPRCYVVCS  1058
               RGVLD +SG YR+A  N +L   NSGR S  G  TDLLLREA LAK +  G  RC+V CS
Sbjct  435286  RGVLDTNSGVYRVA--NKSLTTANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACS  435459

Query  1059    YVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGAL  1118
               YVFHPHV TMQYTAFFHACRLHGVCFDVERTLGTLFLL DSLTAGVFG+LS+GETT+GAL
Sbjct  435460  YVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGAL  435639

Query  1119    AFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
               AF+RTALEVIGREAG+T+ +A+SPSR  ++RSGNFAQ+LSA+R ST
Sbjct  435640  AFLRTALEVIGREAGSTISVASSPSRSVASRSGNFAQILSAIRVST  435777

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 1301 bits (3366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 763/962 (79%), Positives = 836/962 (87%), Gaps = 40/962 (4%)
 Frame = +1

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
               MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEAN+SPMRHSAVVTTAEVQAFN
Sbjct  101446  MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANSSPMRHSAVVTTAEVQAFN  101625

Query  61      AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
               AILQ+TE ELRAKAELVLNGMVNSS     +    GT+LPAVTVA PPS + RSGY +  
Sbjct  101626  AILQRTETELRAKAELVLNGMVNSSFEPSQS----GTVLPAVTVANPPSIKRRSGYRRAY  101793

Query  121     VAKSMDASSIPMEFFRE---------------------QFRNSSVEVRQTLMPSPLHLQR  159
                 +  DASSIPMEFFRE                     QFRNSSVE+RQ+LMPSP H QR
Sbjct  101794  KPRRTDASSIPMEFFREVNGGVNVVLC*NAILM*SCL*QFRNSSVEIRQSLMPSPQHWQR  101973

Query  160     HLGIHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADL  219
               HLG+ HGRLMRKKTTQHCRLLPSVNK DP+APTPELREEDAKHGV NLVTRGFLPAYADL
Sbjct  101974  HLGLQHGRLMRKKTTQHCRLLPSVNKADPTAPTPELREEDAKHGVFNLVTRGFLPAYADL  102153

Query  220     TPAFagpsgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapftp  279
               TPAFA  +         VMKQRATRI+DRSEQS RPTP TQSTGYNLAALKFDLRAP TP
Sbjct  102154  TPAFASGANDG------VMKQRATRIYDRSEQSARPTPITQSTGYNLAALKFDLRAPPTP  102315

Query  280     pppapessppatattrrrstrrg-sagHGPSKVTMSFPESARADKSGRSVRQSSLVSAAI  338
               PPPAPE+S  ++A + RR + R  SA  G S+VTM+FP SA  DK+ RS RQ SLVSAAI
Sbjct  102316  PPPAPETSSTSSADSTRRQSTRRGSARQGASRVTMAFPASAN-DKNRRSARQKSLVSAAI  102492

Query  339     AAFTNQSDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNELL  398
               AAFTNQ DD+EDNR+RFS+QPD+   +E++++D++E+ EE     LGANVDKIRGYNELL
Sbjct  102493  AAFTNQ-DDVEDNRDRFSDQPDDVSDEEQKDEDKDEETEE-----LGANVDKIRGYNELL  102654

Query  399     DAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQ  458
               DAYSLHQFLIHKGRTMRDTPEF+SF RVAQELWGSVEEALRALETLLT YFVPLAY DGQ
Sbjct  102655  DAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVPLAYVDGQ  102834

Query  459     RLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWS  518
               RLLSLA+TGQPRFSKRELLSCIVNEEQVMA LRRPGQRYKGRDRKRRAATTIQA VRMW+
Sbjct  102835  RLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQAFVRMWA  103014

Query  519     IRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQI  578
                RRRY RSRA D +AT+IQLAWRA+SCHAALKARLRE+RREQL+ WEA+M+ LK+QW QI
Sbjct  103015  ARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRLKSQWAQI  103194

Query  579     AGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTAD  638
               A  RRVVVHVPSLSLDE+SRLSAEN AV+QNLQLTRICAAALDS VDLLVYV+PFELT D
Sbjct  103195  ASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVSPFELTTD  103374

Query  639     VSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKD  698
               VS YF+KLLQLGGLADSRPRVKL+FPEQA RFPAHFSLSS+LLYSPHCLRRIRHYTAGK+
Sbjct  103375  VSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIRHYTAGKE  103554

Query  699     AYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYD  758
               AYLVMGLPG EDQRLA+ LDLPILGAPP QALPLLTRSGGKRLLIRADVNVP GTYELYD
Sbjct  103555  AYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPAGTYELYD  103734

Query  759     EHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQ  818
               EHELF+ALAKLAVAHMDQP+WL KLDYDPLGVGEAVVDLSGMQAMRELRREK+TPEYWRQ
Sbjct  103735  EHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQ  103914

Query  819     PGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVA  878
               PGPRDAA+KLVL ELERPG LARLA P+H +IFPSW E+ EAI HFGCV+EAVP T+   
Sbjct  103915  PGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAVPLTAIAV  104094

Query  879     SPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS-GGGLNRKTVAFTFPQTVAPHEA  937
               +PET+++ +EPAY+RANLF+DPDG+VH+TST N+LA+ GGGLNR+TVAFTFPQT APHEA
Sbjct  104095  TPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQTAAPHEA  104274

Query  938     VK  939
               VK
Sbjct  104275  VK  104280

 Score = 399 bits (1026),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 202/264 (77%), Positives = 224/264 (85%), Gaps = 5/264 (2%)
 Frame = +3

Query  901     DGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSL  960
               D  VH+++  +   SG G +R T        V      +GAC+AAGKLLVETNVWGYVSL
Sbjct  104229  DCGVHVSTDCSATRSG*GESRLTSLMLV--VVLISNL*QGACSAAGKLLVETNVWGYVSL  104402

Query  961     DFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLA  1020
               DFVVFQDDKS GAPRLWALAVHPFLTDSAASFACFHLLARGVLDA+SG YRMAAA+S+L 
Sbjct  104403  DFVVFQDDKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDANSGVYRMAAASSSLM  104582

Query  1021    AVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLH  1080
                 N+GRSG GGTT+LLLREA+LAKG+ AG PRC+VVCSYVFHPHVTTMQYTAFFHACRLH
Sbjct  104583  TANAGRSGNGGTTNLLLREAALAKGSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLH  104762

Query  1081    GVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMAT  1140
               GVCFDVERTLGTLFLL DSLTAGVFGVLS+GETT+GALAF+RTALEVIGRE GAT+EM++
Sbjct  104763  GVCFDVERTLGTLFLLADSLTAGVFGVLSIGETTEGALAFLRTALEVIGREVGATIEMSS  104942

Query  1141    SPSRPGSARSGNFAQVLSAVRAST  1164
               S SRP    SGNFA VLSAVRA+T
Sbjct  104943  STSRP---VSGNFAHVLSAVRAAT  105005

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 1285 bits (3324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 751/984 (76%), Positives = 827/984 (84%), Gaps = 46/984 (5%)
 Frame = +3

Query  1      MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
              MEK+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS VVTTAEVQAFN
Sbjct  68421  MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTVVTTAEVQAFN  68600

Query  61     AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGY---A  117
              AILQ+TE ELRAKAELVLNGMVNSSS+ Q+NQ+Q GTLLPAVTV APPS R R GY    
Sbjct  68601  AILQKTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVG  68780

Query  118    KPRVAKSMDASSIPMEFFRE------------------------------QFRNSSVEVR  147
              KP++    D  SIPMEFFRE                              +FRNS+VEVR
Sbjct  68781  KPKMTTRKDGGSIPMEFFREVSDLVCIASIACYRDDTKPENIGCCVVPLQRFRNSNVEVR  68960

Query  148    QTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNL  207
               + M SP H QRH+    GRL+RKKTTQHCRLLPSVNK DPSAPTPEL EEDA++GVL+L
Sbjct  68961  SSSMHSPQHWQRHIEPQQGRLIRKKTTQHCRLLPSVNKADPSAPTPELCEEDARYGVLDL  69140

Query  208    VTRGFLPAYADLTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLA  267
              VTRGFLPAYADLTPAF+GP G  DG GGG MKQRATRI++RSEQ  RPTPFTQSTGYNLA
Sbjct  69141  VTRGFLPAYADLTPAFSGPGGTRDGPGGGAMKQRATRIYNRSEQFARPTPFTQSTGYNLA  69320

Query  268    ALKFDLR-------apftppppapessppatattrrrstrrgsagHGPSKVTMSFPESAR  320
              ALKFDLR       AP      +  +   +T  +   +      GHGPSKVTMSF  S+ 
Sbjct  69321  ALKFDLRGPPTPPSAPLAETTQSSTTRKRSTRRSSSSAPLPEKRGHGPSKVTMSFQGSSS  69500

Query  321    ADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSeqpdeeisdeeqeddenekdeeae  380
               D  G++ R  S+VSAA+AAFTNQ+DD E +RER   Q D+++SDE+Q    N++DE+AE
Sbjct  69501  GDAGGKNAR-PSVVSAAVAAFTNQTDDREGDRERLGVQQDDDLSDEDQGAAGNDRDEDAE  69677

Query  381    meeLGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealra  440
              MEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQE WG+VE+ALRA
Sbjct  69678  MEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQEQWGNVEDALRA  69857

Query  441    letlltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGR  500
              LE LLTQYFVPLAY DGQRLLSLA+TGQ RFSK ELLSCIVNE+QV A+LRRPGQRYKGR
Sbjct  69858  LEALLTQYFVPLAYIDGQRLLSLAATGQSRFSKWELLSCIVNEDQVTAILRRPGQRYKGR  70037

Query  501    DRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreq  560
              DRKRRAATT+QA VRMWS+RRRY RS  +  SATKIQLAWRA+SCH ALK RLR+LR++Q
Sbjct  70038  DRKRRAATTLQASVRMWSLRRRYARSCKNVGSATKIQLAWRAYSCHEALKTRLRDLRQKQ  70217

Query  561    lDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAAL  620
              L+ WE +M+ LK QW QIA RRRVVVHVPSLSLDEHSRL AENFAVQQNLQLTRICAAAL
Sbjct  70218  LEKWEVRMHALKNQWSQIAARRRVVVHVPSLSLDEHSRLGAENFAVQQNLQLTRICAAAL  70397

Query  621    DSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVL  680
              DSNVDLLVYV+PFELTADVS YFLKLLQLGGLADSRPRVKLVFPEQA RFP+HFSLSS+L
Sbjct  70398  DSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPSHFSLSSLL  70577

Query  681    LYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKR  740
              LYSPHCLRRIRHYTAGKDAYLVMGLPG EDQRLAIALDLPILGAPP QALPLLTRSGGKR
Sbjct  70578  LYSPHCLRRIRHYTAGKDAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKR  70757

Query  741    LLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGM  800
              LLIRADVNVPTGTYELYD+HELFAALAKLAV HMDQPRWLLKLDYDPLGVGEA++DLSGM
Sbjct  70758  LLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGM  70937

Query  801    QAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEA  860
              QAMRELRREK+ PEYWRQPGPRDAA+KL+LAELE+PG+LA+ A P+HTEIFPSWRE+TEA
Sbjct  70938  QAMRELRREKRAPEYWRQPGPRDAAAKLLLAELEKPGMLAKHAAPVHTEIFPSWREFTEA  71117

Query  861    ISHFGCVVEAVPPTSF-----VASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS  915
              I+HFGCV+EA PPT+        SPE  ++SVEP+YVRANLF++PDGTVH+TSTQNVLAS
Sbjct  71118  IAHFGCVIEAAPPTAISGLNVAVSPEAPATSVEPSYVRANLFVNPDGTVHVTSTQNVLAS  71297

Query  916    GGGLNRKTVAFTFPQTVAPHEAVK  939
              G GLNRKTVA+TFPQT APHEAVK
Sbjct  71298  GSGLNRKTVAYTFPQTAAPHEAVK  71369

 Score = 367 bits (943),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 202/226 (89%), Gaps = 4/226 (2%)
 Frame = +1

Query  940    GACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLA  999
              GAC+A G+LLVE +VWGYVS+DFVVFQD+KS GAPRLWALAVHP+LT+SAASFACFHLLA
Sbjct  71437  GACSATGRLLVEISVWGYVSVDFVVFQDEKSSGAPRLWALAVHPYLTNSAASFACFHLLA  71616

Query  1000   RGVLDASSGGYRMAAANSTLAAVNSGRSG-GGGTTDLLLREASLAKGAQAGTPRCYVVCS  1058
              RG LD++SG Y++A+ N TLA  N GRS  GGG T+LLLREASLAK    GTPR YVVCS
Sbjct  71617  RGSLDSNSGVYKVASTN-TLATGNPGRSSSGGGMTELLLREASLAKDRHLGTPRSYVVCS  71793

Query  1059   YVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGAL  1118
              YVFHPHVTTMQY+AFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGAL
Sbjct  71794  YVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGAL  71973

Query  1119   AFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
              AF+RTALEVIGREAGAT+EMA   SR  SA SGNFAQVLSA+RAST
Sbjct  71974  AFLRTALEVIGREAGATIEMA--ASRSHSAHSGNFAQVLSAIRAST  72105

>PHRA:scaffold_56
Length=334739

 Score = 1211 bits (3133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/803 (84%), Positives = 722/803 (90%), Gaps = 9/803 (1%)
 Frame = -1

Query  138     QFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELRE  197
               QF NSSVEVRQ+LMPSP H QRHLGI HGRL+RKKTTQHCRLLPSVNKVDP+APTPELRE
Sbjct  149495  QFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLLPSVNKVDPTAPTPELRE  149316

Query  198     EDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRPTP  257
               EDAKHGVLNLVTRGFLPAYADLTPAFAG SG  DGSG  VMKQRATRI+DRSEQ  R TP
Sbjct  149315  EDAKHGVLNLVTRGFLPAYADLTPAFAGSSGTKDGSG--VMKQRATRIYDRSEQPARATP  149142

Query  258     FTQSTGYNLAALKFDLRapftppppapessppatattrrrstrrgsagHGPSKVTMSFPE  317
               FTQSTGYNLAALKFDLRAP TPPPPAPE++  ++   R           GP+KV MSFP 
Sbjct  149141  FTQSTGYNLAALKFDLRAPPTPPPPAPEAARTSSTRRRSSRRGSAI--QGPNKVIMSFPG  148968

Query  318     SARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSeqpdeeisdeeqeddenekde  377
               S    K+ RSVRQ+SLVSAAIAAFTNQ+DD+E NRE    +  +E       D + E + 
Sbjct  148967  STGTGKNDRSVRQNSLVSAAIAAFTNQNDDMEGNREHIDGEISDEDQGGADNDKDEEAEM  148788

Query  378     eaemeeLGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeea  437
               E     LGANVDKIRGYN+LLDAYSLHQFLIHKGR+MRDTPEFVSFRRVAQELWGSVEEA
Sbjct  148787  EE----LGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEA  148620

Query  438     lraletlltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRY  497
               LRALETLLTQYFVPLAY DGQRLLSLA+TGQPRFSK ELL+CIVNEEQVM+VLRRPGQRY
Sbjct  148619  LRALETLLTQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRY  148440

Query  498     KGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelr  557
               KGRDRKRRAATTIQACVRMWSIRRRYVRSRASD SAT+IQLAWR++SCHAALK RLRE+R
Sbjct  148439  KGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVR  148260

Query  558     reqlDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICA  617
               REQL+ WEA+M DL+TQW QIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICA
Sbjct  148259  REQLERWEARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICA  148080

Query  618     AALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLS  677
               AALDS+VDLLVYV+PFELTADVS YFLKLLQLGGLADSRPRVKLVFPEQAARFP HFSLS
Sbjct  148079  AALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLS  147900

Query  678     SVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSG  737
               S+LLYSPHCLRRIRHYTAGK+AYLVMGLPG EDQRLA+ALDLPILGAPP QALPLLTRSG
Sbjct  147899  SLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSG  147720

Query  738     GKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDL  797
               GKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHM+QP+WLLKLDYDPLG+GEAVVDL
Sbjct  147719  GKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDL  147540

Query  798     SGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREY  857
               SGMQAMRELRREK+TPEYWRQPGPRDAA+KLVLAELERPGVLARLATPMHTEIFP+WR++
Sbjct  147539  SGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDF  147360

Query  858     TEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLA-SG  916
               TEAI HFGCV+EAVPP    A+PE++S  VEPAYVRANLF+ PDG V+ITSTQNVLA SG
Sbjct  147359  TEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDGKVYITSTQNVLASSG  147180

Query  917     GGLNRKTVAFTFPQTVAPHEAVK  939
               GGLNRKTVAFTFPQT APHEAV+
Sbjct  147179  GGLNRKTVAFTFPQTAAPHEAVQ  147111

 Score = 383 bits (984),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 189/225 (84%), Positives = 204/225 (91%), Gaps = 3/225 (1%)
 Frame = -3

Query  940     GACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLA  999
               GAC A GKLLVET+VWGYVSLDFVVFQD+K+GG+PRLWALAVHPFLTDSAASFACFHLLA
Sbjct  147045  GACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACFHLLA  146866

Query  1000    RGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSY  1059
               RG LDA+SG YR+AA+NS + A N GRSG GG  DLLLREASL K A AG PRC+VVCSY
Sbjct  146865  RGALDANSGAYRVAASNSMVNA-NPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSY  146689

Query  1060    VFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALA  1119
               VFHPHVTTMQY+AFFHACRLHGVCFDVERTLGTLFLL DSLTAGVFG+LSVGETT+GALA
Sbjct  146688  VFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALA  146509

Query  1120    FMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
               F+RTALEVIGRE GAT+EMAT  SRP S R+GNFAQVLSAVRAST
Sbjct  146508  FLRTALEVIGREVGATIEMAT--SRPVSTRNGNFAQVLSAVRAST  146380

 Score = 199 bits (506),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 127/140 (91%), Gaps = 3/140 (2%)
 Frame = -2

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
               MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN
Sbjct  150004  MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  149825

Query  61      AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYA---  117
               AILQQTE ELRAKAELVL GMVNSSSSAQ NQSQSGTLLP VTVAAPPSTRHRSGY    
Sbjct  149824  AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYGGAN  149645

Query  118     KPRVAKSMDASSIPMEFFRE  137
               KP +    DASSIP+EFFRE
Sbjct  149644  KPTLTSRTDASSIPIEFFRE  149585

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/968 (65%), Positives = 738/968 (76%), Gaps = 55/968 (6%)
 Frame = -3

Query  1        MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
                MEKVQQ +HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RHS+V+T AEVQAF+
Sbjct  1844209  MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  1844030

Query  61       AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
                A+LQQTE+ELRAKAELVLNG++NSS+S  N+Q Q  T LPAV+VAAP   +HR G ++  
Sbjct  1844029  ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  1843850

Query  121      V---AKSMDASSIPMEFFRE--------------------QFRNSSVEVRQTLMPSPLHL  157
                       +D +S  MEFFR+                    QFRN+ VE+RQ+LM SP + 
Sbjct  1843849  EFGHINRIDNNSTSMEFFRQVRIDDSRCVEW*V**MSAVQQFRNNRVEIRQSLMTSPENW  1843670

Query  158      QRHLGIHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYA  217
                +R  G    R +RKKTTQH RLLP VNK DPS PTP+LREEDA  G+LNLVTRGFLPAYA
Sbjct  1843669  RRKSG---ARRVRKKTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYA  1843499

Query  218      DLTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapf  277
                DLTPAFAGP+G ++GSGG  +K RAT I+DRS++S R TP   S G+NLA LKFD R   
Sbjct  1843498  DLTPAFAGPNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSS  1843319

Query  278      tppppapessppatattrrrstrrgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSAA  337
                TP      +     +                S     F    +   SG + R S +V   
Sbjct  1843318  TPSSAPKPNHSATVSA---------------SMPNTKFSSIMQTVSSGPAKRNSLVV---  1843193

Query  338      IAAFTNQSDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNEL  397
                 AA  NQ++D+E+N    +   +++  +E  +D +  KDE    ++L  NV KIR YN+L
Sbjct  1843192  -AAPRNQNEDIENN---CTHSFEDQEDEEGSDDSDIIKDEGFSTKDLAVNVAKIREYNDL  1843025

Query  398      LDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADG  457
                +DAYSLHQ LI+KGR +RDTPEF SFRRV  +LWGSVEE LRALE +L QYFVPLA+ DG
Sbjct  1843024  VDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDG  1842845

Query  458      QRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMW  517
                QRL++LAST QP+FS+RELLSCIVN+EQVM+VLRRPGQRY GRDRK RAATTIQAC RMW
Sbjct  1842844  QRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMW  1842665

Query  518      SIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQ  577
                 +  RYV+SR+S+ +A KIQ A+RA+S   ALKARLRE+R E+   WEA+M + K+QW Q
Sbjct  1842664  MVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQ  1842485

Query  578      IAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTA  637
                IA RRR+VVHVPS+SL EHSRL+AENFAVQQNLQLTRICAAALD  VDLLVYV+P+ELTA
Sbjct  1842484  IAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTA  1842305

Query  638      DVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGK  697
                DVS YF KLLQL G ADSRPRVK V+PEQAARFPAHFSLSS++LYSP+CLRRIRHYTAG 
Sbjct  1842304  DVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGN  1842125

Query  698      DAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELY  757
                +AYLVMGLPG EDQRLAI LDLPILGA P QALPLLTRSGGKRLLI+AD+NVPTGTYELY
Sbjct  1842124  EAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELY  1841945

Query  758      DEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWR  817
                DEHE+  ALAKLAVAH+DQ +WL+KLDYDPLGVGEAVVDLS MQAMREL REK+TPEYWR
Sbjct  1841944  DEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWR  1841765

Query  818      QPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFV  877
                QPG RDAA+ L L E ERPG LARL TP+HTE++P+WREY  AI HFGCV+EAVPPT+  
Sbjct  1841764  QPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASA  1841585

Query  878      ASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASG-GGLNRKTVAFTFPQTVAPHE  936
                AS E      EP Y+RAN+F+DP+GTVH+TSTQNVL +  GGL+RK+  F FPQTVAPH 
Sbjct  1841584  ASME------EPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHA  1841423

Query  937      AVKGACTA  944
                A+K  CT 
Sbjct  1841422  AIKVCCTC  1841399

 Score = 307 bits (786),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 171/227 (75%), Gaps = 3/227 (1%)
 Frame = -1

Query  938      VKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHL  997
                ++GAC A GK L ETNVWGYVSLDFVVFQD KS  A RLWALA+HPFLT+SAA+FACFHL
Sbjct  1841352  IQGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHL  1841173

Query  998      LARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVC  1057
                L RG LDA+SG YR+        A  + +SG     DLLLREASL K    G  RCYVVC
Sbjct  1841172  LTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVC  1840993

Query  1058     SYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGA  1117
                SYVFHP+VT  QYT FF  CRLHGVCFDV R LGTLFLL DSLTAGVFG+LS+GET   A
Sbjct  1840992  SYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDA  1840813

Query  1118     LAFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
                L+++RTALEVIGREAGAT  + +S SR   +  GNFA VLS VRAST
Sbjct  1840812  LSYLRTALEVIGREAGATKGIVSSSSR---SVLGNFADVLSTVRAST  1840681

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/790 (54%), Positives = 558/790 (71%), Gaps = 42/790 (5%)
 Frame = +2

Query  384    LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
              L  NV+KIRGYNELLDAYSLHQF+IHKGR +RDTPEF SF+RVAQE+WGS+EE ++ALE 
Sbjct  21866  LRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEI  22045

Query  444    lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
              LLT+YFVPLAY DGQRL++LAS    + S  ELL+C+VNE+QV +++RRPGQRYKG+DRK
Sbjct  22046  LLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRK  22225

Query  504    RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
              RRAATT+QA  RM   R R+ + R +  SA  IQ  WR+++C  +L+ RL  +R E+L  
Sbjct  22226  RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGE  22405

Query  564    WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
              W+AK+  +++QW  I  +RRVV+HV S+S+DE +RLS ENF+V+QNLQL+R+ A  +D N
Sbjct  22406  WKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRL-AGLVDQN  22582

Query  624    VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
              V+ +VYV PFEL+ +VS YF+KLLQL G+A++  RV+LVFPE AA+FP HFSL++ L+YS
Sbjct  22583  VE-IVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYS  22759

Query  684    PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDl-pilgapppqalpllTRSGGKRLL  742
              P+C+RRI+    GK+AYLVMG+PG EDQRLA+AL +  +    P   LPL+TRSG KR  
Sbjct  22760  PNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFF  22939

Query  743    IRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQA  802
              I+ADVNVPTGTY++YD  EL  +LAKL ++H++Q  WLLKLD DPLG G A++D+S M  
Sbjct  22940  IKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTT  23119

Query  803    MRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAIS  862
              +R++RREK+ PEYW+QPG RD  ++ +L ELER   +  L  P H EIF SW+E+  AI 
Sbjct  23120  LRDIRREKRPPEYWKQPGIRDTIARALLQELERE--IGSLLKPSHPEIFASWKEFASAIP  23293

Query  863    HFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGL---  919
               FG VVEA+P    VA             +R N+FI+P G VH+ ST +VL+  G     
Sbjct  23294  EFGVVVEALP--FHVA-----------GVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQ  23434

Query  920    -NRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVW-GYVSLDFVVFQDD---KSGGAP  974
                R+  AF FPQT+ PHEA+ GA +A G++L E + + GY S+D  + Q++       A 
Sbjct  23435  RQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAE  23614

Query  975    RLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGR-SGGGGTT  1033
              RLWA+++ P+LTDSAA+FA FH L RGVL+ ++G Y + A  ST    +S   S   GT 
Sbjct  23615  RLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIGTL  23794

Query  1034   DLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  1093
              D +            G PR Y V  YVFHP+V+ M Y AFFH CRLHGVCFDVER +G++
Sbjct  23795  DRI------------GAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSV  23938

Query  1094   FLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSA--RSG  1151
              FLL DSLTAG+FGVLS GE+   AL ++RTA EVIGRE G T  M +  S  GS+   SG
Sbjct  23939  FLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVG-TQSMVSGDSDIGSSVQLSG  24115

Query  1152   NFAQVLSAVR  1161
              NFA++L  +R
Sbjct  24116  NFAEILGLLR  24145

 Score = 175 bits (443),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 162/284 (57%), Gaps = 28/284 (10%)
 Frame = +2

Query  1      MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
              ME++QQ+HHVEDVGR+LLQTQ+QLR +REQ+  +         P   S + +        
Sbjct  20813  MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSN-------GPGNGSVIASNNAGAEIE  20971

Query  61     AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
               ILQ+ E ELR KAELVL+ +V +  ++     + G L+P  TV  PP  R R   A+  
Sbjct  20972  EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELH  21151

Query  121    VAKSMDASSIPMEFFREQFRNSSVEVRQTLM----------PSPLHLQRHLGIHHGRLMR  170
                 S D   + +E+FR++F+ ++V+   + M          P+P H        HG++++
Sbjct  21152  DGGSYD---LDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHA-------HGKVVK  21301

Query  171    KKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsg-a  229
               KTT + RLLP VNK DP+AP P L   DAK GVL+L+ RGFLP   DLTPAF   S   
Sbjct  21302  HKTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPK  21481

Query  230    ndgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
              + G+   V++  + ++H R EQ VR T ++    +NLA LKFD+
Sbjct  21482  SQGNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDM  21613

>PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_711:1:15030:1 
REF
Length=15030

 Score = 730 bits (1885),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 408/790 (52%), Positives = 536/790 (68%), Gaps = 56/790 (7%)
 Frame = -3

Query  169    MRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsg  228
              ++ K  QH RLLPSVNK DPSAPTPEL E+DAK+G+L+LV RGFLP   DLT AF    G
Sbjct  15028  VKNKMAQHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHG  14849

Query  229    andgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapf-------tppp  281
                      +++   TRI+DR EQ +R  P T  +G+N+A LKFDL A         +  P
Sbjct  14848  G-------IIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSP  14690

Query  282    papessppatattrrrstrrgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSAAI---  338
                 +++      ++       +   GP+ +T+SF   AR      +VR +    + I   
Sbjct  14689  SQHKAALAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHH  14510

Query  339    AAFTNQSDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNELL  398
              A+   +++  E N +                  + + D+   M+EL  NV+KIRGYNELL
Sbjct  14509  ASANQEAESPETNVDE-------------DLMYDEKDDDANAMDELRKNVEKIRGYNELL  14369

Query  399    DAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQ  458
              D YSLHQF+IHKGR MR+TPEFVSF+RVAQE+WGSV+E ++ALE LLT+YFVPLAY DGQ
Sbjct  14368  DTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQ  14189

Query  459    RLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWS  518
              RL+++A+     +SKR+LLSCIVNE+QV +++RRPGQRYKG+DRKRRAA TIQ   RMW 
Sbjct  14188  RLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWW  14009

Query  519    IRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQI  578
               +++Y R R    S   IQ  WR ++ H  LK R++  R +Q   WEAKM  LK  W +I
Sbjct  14008  NQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRI  13829

Query  579    AGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTAD  638
               G RRVV+HVPS S+DE  RLSA+NF+V+QNLQL+R+C   +DSNVD+ VYV+PFELT D
Sbjct  13828  KGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGL-VDSNVDI-VYVSPFELTTD  13655

Query  639    VSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKD  698
              V  Y +KLLQLGG+AD   RVKLVFPE A RFP HFSL+++LLYSPHCLRRI+ Y   K+
Sbjct  13654  VVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKE  13475

Query  699    AYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYD  758
              AYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SGGKR  +RADVNVPTGTY++YD
Sbjct  13474  AYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYD  13295

Query  759    EHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQ  818
              E EL  +LAKL V+H++Q  W+LK+DYDP   G A++D+S M A+RE+RREK++PEYWRQ
Sbjct  13294  EDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQ  13115

Query  819    PGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVA  878
              PG RD A+++++AELER   L  L TP+H E++PSW++Y +AI  FG VVEA P      
Sbjct  13114  PGTRDNAARVIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAP------  12959

Query  879    SPETASSSVEPAYVRANLFIDPDGTVHITSTQNVL---------ASGGGLNRKTVAFTFP  929
                     S    +VRANLF++P G VH++STQ++L           GG    K+V + FP
Sbjct  12958  -------SAVVGHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAFP  12800

Query  930    QTVAPHEAVK  939
              QT AP+EA++
Sbjct  12799  QTAAPYEAIR  12770

 Score = 236 bits (602),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 164/235 (70%), Gaps = 11/235 (5%)
 Frame = -1

Query  939    KGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLL  998
              +GA TA GKLL E NV+GY S+DF+VFQ+DKS  A RLWA+A+ P+LTDSAA+F  FHLL
Sbjct  12687  QGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSAATFTTFHLL  12511

Query  999    ARGVLDASSGGYRMAAANSTLAAV------NSGRSGGGGTTDLLLREAS---LAKGAQAG  1049
               RG L+ +SG Y + AA  T A++      ++  + G    DL+L EA+   L    + G
Sbjct  12510  NRGALNTTSGLYYLPAATVTSASLVQLQSSSAAFASGASAADLVLHEATHSGLVSLEKVG  12331

Query  1050   TPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLS  1109
                  YVV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++FLL DSLTAGVFG++ 
Sbjct  12330  AQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMC  12151

Query  1110   VGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
                +T  GAL F+RTALEV+GRE G T  +    +  G A +GNFA VL+A+RA T
Sbjct  12150  CSDTASGALGFLRTALEVVGREVG-TQALTDEFTSGGEAETGNFADVLAAIRALT  11989

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 662 bits (1709),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 332/560 (59%), Positives = 436/560 (78%), Gaps = 18/560 (3%)
 Frame = +1

Query  384      LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
                L  NV+KIRGYNELLD YSLHQF+IHKG+ MR+TPEFVSF+RVAQE+WG VEE ++ALET
Sbjct  1309816  LRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALET  1309995

Query  444      lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
                LLT+YFVPLAY DGQRL+++AS     FSK++LLSCIVNE+QV +++RRPGQRYKG+DRK
Sbjct  1309996  LLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  1310175

Query  504      RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
                RRAA TIQ   RMWS +++Y R R    S   IQ  WRA++ H  L+ +L+  R++Q + 
Sbjct  1310176  RRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHEQ  1310355

Query  564      WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
                WEA+M  L+ +W +I   RRV++HVPSLS+DE  R+ A+NFAV+QNLQL+R+C   +D+N
Sbjct  1310356  WEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-IDAN  1310532

Query  624      VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
                VD+ VYV+PFELT++V  YF+KLLQLGG+AD   RVKLVFPEQA RFPAHFSL++VLLYS
Sbjct  1310533  VDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYS  1310709

Query  684      PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLI  743
                PHCLRRIR    GK+AYLV G+PG ED+RLA+AL++PILG  P   LPL+T+SG KR  +
Sbjct  1310710  PHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFM  1310889

Query  744      RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803
                RADVNVPTGTY++YDE EL  +LAKL V+H++Q  WLLK+DYDP G G A+VD S + A+
Sbjct  1310890  RADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTAL  1311069

Query  804      RELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISH  863
                RE+RREKK+PEYWRQPG RD A+++++AELER   + +L TP+H E++P+W+E+ +AI+ 
Sbjct  1311070  REIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADAIAQ  1311243

Query  864      FGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNRKT  923
                FG V+EA P             S    Y+RANLF++P G VH++STQ+V+ S   ++++ 
Sbjct  1311244  FGVVIEAAP-------------SAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRK  1311384

Query  924      VA-FTFPQTVAPHEAVKGAC  942
                VA + FPQT AP+EA++  C
Sbjct  1311385  VAGYAFPQTTAPYEAIRVRC  1311444

 Score = 227 bits (579),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 163/243 (67%), Gaps = 19/243 (8%)
 Frame = +3

Query  939      KGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLL  998
                +GA  A GK+LV+ +V+GY S+D++VF++DK+   PRLWA+A+HP+LTDSA++FA FHLL
Sbjct  1311516  QGASMAIGKVLVDDSVFGYSSVDYLVFREDKTH-VPRLWAMALHPYLTDSASTFAVFHLL  1311692

Query  999      ARGVLDASSGGYRMAAANST--------------LAAVNSGRSGGGGTTDLLLREAS---  1041
                 RG L+  +G Y + A  ++              L A ++  +G   + +L+L+EA+   
Sbjct  1311693  NRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSANLVLQEATHLG  1311872

Query  1042     LAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLT  1101
                L    +AG  R Y V  Y+FHP+V+TMQY++FFH CRLHGVCFDVER  GT+F+L DSLT
Sbjct  1311873  LVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTIFMLADSLT  1312052

Query  1102     AGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVR  1161
                AGVFG++  G+T   AL F+RTALEVIGRE G T  +       G   SGNFA+VL+ VR
Sbjct  1312053  AGVFGIICCGDTASAALGFLRTALEVIGREVG-TQALTDDLRGGGDCESGNFAEVLTVVR  1312229

Query  1162     AST  1164
                  T
Sbjct  1312230  TLT  1312238

 Score = 130 bits (326),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 93/138 (67%), Gaps = 15/138 (11%)
 Frame = +1

Query  137      EQFRNSSVEVRQTLMPSPLH-LQRHLGIHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPEL  195
                ++F+NS+VE    L P+P   +QR   I  GRL++ K T H RLLPSVNK DPSAP PEL
Sbjct  1309105  QRFQNSAVE----LKPTPFSPVQR---ITKGRLVKSKMTHHARLLPSVNKCDPSAPPPEL  1309263

Query  196      REEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRP  255
                 E DAK G+ +L+ RGF+P  ADLTPAF         S G ++K   TRI++R EQ +RP
Sbjct  1309264  FEHDAKSGMFSLINRGFVPVGADLTPAF-------VNSHGSIIKNSKTRIYNRQEQPIRP  1309422

Query  256      TPFTQSTGYNLAALKFDL  273
                 P+T  +G+++A+LKFDL
Sbjct  1309423  MPYTNPSGFSMASLKFDL  1309476

 Score = 92.4 bits (228),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 8/137 (6%)
 Frame = +3

Query  1        MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
                M+++QQQHHVEDVGR+LLQTQEQLR+MREQM +  AA                A+V AF 
Sbjct  1308606  MDQIQQQHHVEDVGRILLQTQEQLRLMREQMASTTAATTPTRFHQ-----TAPADVAAFQ  1308770

Query  61       AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRS-GYAKP  119
                 ILQ+ E E+RAKAELVLNG+VN+SS A    +   + LPAV  ++ P+TR ++ G    
Sbjct  1308771  EILQRAELEIRAKAELVLNGLVNTSSQAAAASTL--STLPAVVSSSSPTTRKQNLGAFLV  1308944

Query  120      RVAKSMDASSIPMEFFR  136
                R     +   + +++FR
Sbjct  1308945  RHQSRSENYEMDLDYFR  1308995

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 653 bits (1684),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 339/570 (59%), Positives = 432/570 (76%), Gaps = 31/570 (5%)
 Frame = -1

Query  384    LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
              L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEFVSF+RVAQE+WGSVEE +RALE 
Sbjct  99795  LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEA  99616

Query  444    lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
              LLT+YFVPLAY DGQRL+++A+     FSKR+LLSCIVNE+QV +++RRPGQRYKG+DRK
Sbjct  99615  LLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  99436

Query  504    RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
              RRAA TIQ   RMW  +++Y R R    S   IQ  WRAF+ H +LK +L+  R +Q + 
Sbjct  99435  RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQ  99256

Query  564    WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
              WEAKM  LK  W  I G RRVV+HVPSLS+DE SR+SA+NF+V+QN+QL+R+C   +D N
Sbjct  99255  WEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPN  99079

Query  624    VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
              VD +VYV+PFELTADV+ Y +KLLQLGG+AD   RVKLV+PEQAARFPAHFSL+++LLYS
Sbjct  99078  VD-IVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYS  98902

Query  684    PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLI  743
              PHCLRRI+ Y   K+AYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SG KR  +
Sbjct  98901  PHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFM  98722

Query  744    RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803
              RADVNVPTGTY++YDE EL  +LAKL ++H++Q  W+LK+DYDP G G A++D+S M  +
Sbjct  98721  RADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVL  98542

Query  804    RELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISH  863
              RE+RREKK+PEYW+QP  RD A++ ++AELER   LA L TP+H E++PSW+E+ +AIS 
Sbjct  98541  REIRREKKSPEYWKQPSTRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQ  98368

Query  864    FGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS--------  915
              FG VVEA P             S    +VRANLFI+P G VH++STQ+++ +        
Sbjct  98367  FGVVVEAAP-------------SAVIGHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSG  98227

Query  916    ------GGGLNRKTVAFTFPQTVAPHEAVK  939
                     G    KTV + FPQT AP+EA++
Sbjct  98226  GGAGKKAGAYRSKTVGYAFPQTAAPYEAIR  98137

 Score = 225 bits (574),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 161/235 (69%), Gaps = 15/235 (6%)
 Frame = -2

Query  943    TAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGV  1002
              TA GKLL +  V+GY S+D++VFQ+DK+  A RLWA+A+HP+LTDSA++FA FHLL RG 
Sbjct  98048  TAIGKLLADECVFGYSSIDYLVFQEDKTH-AARLWAMALHPYLTDSASTFATFHLLNRGA  97872

Query  1003   LDASSGGYRMAAANSTLAAVNSGRSGGGGT----------TDLLLREAS---LAKGAQAG  1049
              L+ASSG Y +    ++ ++ ++       +           DL+++EA+   L    +AG
Sbjct  97871  LNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADLVMQEATHSGLVSLEKAG  97692

Query  1050   TPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLS  1109
                R YVV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++FLL DSLTAGVFG++ 
Sbjct  97691  AQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMC  97512

Query  1110   VGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
                ++  GAL F+RTALEVIGRE G T  +       G + +GNFA VL+ +RA T
Sbjct  97511  CSDSASGALGFLRTALEVIGREVG-TQALMDEFMGGGESETGNFADVLAVIRALT  97350

 Score = 131 bits (330),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 95/138 (69%), Gaps = 13/138 (9%)
 Frame = -1

Query  137     EQFRNSSVE-VRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLLPSVNKVDPSAPTPEL  195
               ++F N +VE V   ++PSP+  QR   I  G+L++KK  Q+ RLLPSVNK DPSAPTPEL
Sbjct  100539  QRFHNPAVEFVSSPVLPSPV--QR---ITKGQLVKKKMAQNARLLPSVNKSDPSAPTPEL  100375

Query  196     REEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRP  255
                E+DAK G+L+LV RGFLP  ADLTPAF         + G ++K   TRI+DR EQ +R 
Sbjct  100374  SEQDAKSGMLSLVNRGFLPVGADLTPAF-------INNHGSIIKNSKTRIYDRQEQPIRS  100216

Query  256     TPFTQSTGYNLAALKFDL  273
                P T  +G+N+A+LKFD+
Sbjct  100215  MPSTNPSGFNVASLKFDI  100162

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = -3

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRH-SAVVTTAEVQAF  59
               M++ QQQHHVEDVGR+LLQTQEQLR+MREQM    A     +S MR  S+  +  +V AF
Sbjct  101023  MDQFQQQHHVEDVGRILLQTQEQLRLMREQMA---ATSTTPSSSMRFASSGASQPDVLAF  100853

Query  60      NAILQQTEAELRAKAELVLNGMV  82
                 ILQ+ E E+RAKAELVLNG V
Sbjct  100852  QEILQRAEVEIRAKAELVLNGFV  100784

>ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_90_length_79489:1:79489:1 
REF
Length=79489

 Score = 522 bits (1345),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 302/781 (39%), Positives = 444/781 (57%), Gaps = 58/781 (7%)
 Frame = -3

Query  404   HQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSL  463
             + F+IH+G   R  PEF +F+R+A  +W SV+  L AL  +L+ YF+P+AY +GQR+L+L
Sbjct  7268  YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  7089

Query  464   ASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRY  523
             A       + ++L+SCI NE++V  +L +PGQR++G +R +RA   +Q+ +RM   R+R+
Sbjct  7088  AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  6909

Query  524   VRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRRR  583
             +  R   +  T IQ  WR FS H A K ++   R  Q   +   M    + W +I  +RR
Sbjct  6908  LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  6729

Query  584   VVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYF  643
              ++H+PS+S+D   R+  E F++QQNLQL R+C A +D NV+ L+Y+ PFELT D+  Y+
Sbjct  6728  TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLC-AVIDENVE-LIYICPFELTDDIVQYY  6555

Query  644   LKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVM  703
             +KLLQLGG++D+  R+KL+ PE A+RFP+HFSLSSV+LYSP  L R+     G++AY+V 
Sbjct  6554  MKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVP  6375

Query  704   GLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELF  763
             G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL 
Sbjct  6374  GFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELI  6195

Query  764   AALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRD  823
              +LAKL  +H  Q   +L+LDYDP G G A++D+S +Q+++E+R   KT E W QP  + 
Sbjct  6194  FSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQA  6015

Query  824   AASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETA  883
                + ++ E++    ++     +H EIFPS + + +AI  +G ++E  P           
Sbjct  6014  KLIRNLVLEMQNN--ISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK---------  5868

Query  884   SSSVEPAYVRANLFIDPDGTVHITSTQNV-----------------LASGGGLNRKTVAF  926
                    +VRANLFI+P   V ++ST  +                 L        +T   
Sbjct  5867  ----RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGV  5700

Query  927   TFPQTVAPHEAVK-----------------GACTAAGKLLVETNVWGYVSLDFVVFQDDK  969
             TFPQT+  HE +K                  A  A G+ L +  + GY+S+DFVV  DD+
Sbjct  5699  TFPQTLIDHEVLKVSDTVDVNFI*PRCMV*DASLAIGQALAKDGICGYISVDFVVCLDDQ  5520

Query  970   SGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGG  1029
             +     L+A  + PFLT++AASFA F LL+RG    S  G         L  V +     
Sbjct  5519  TQKKT-LYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSS  5343

Query  1030  GGTTDLLLREASLAKGAQAGTP----RCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFD  1085
                TDL++REA L+       P    R Y +  YV +P V T+  ++FF  CR  GV FD
Sbjct  5342  LSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFD  5163

Query  1086  VERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRP  1145
              ER  GT+FLL DSLTAGVFG++ + +T   AL+  R A+E I   AG   +M+ S S  
Sbjct  5162  TERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGT--KMSVSKSSD  4989

Query  1146  G  1146
             G
Sbjct  4988  G  4986

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = -1

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaS--------PMRHSAVVT  52
             M+ ++Q+HH ED+GR+LLQTQ++LR +R +++      E   +        P    +V  
Sbjct  8389  MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  8210

Query  53    TAEVQAFNAILQQTEAELRAKAELVLNGM  81
             + +++    IL + E E++AK +L+  G+
Sbjct  8209  SKDLETLQNILDRAEREIQAKVDLLYKGV  8123

 Score = 37.4 bits (85),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -2

Query  237   VMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
             V+ QR   +H+R E+ ++ TP+T +  +N+ ++KFD 
Sbjct  7701  VLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF  7591

>ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:1 
REF
Length=105594

 Score = 395 bits (1014),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 219/555 (39%), Positives = 336/555 (61%), Gaps = 34/555 (6%)
 Frame = -2

Query  402   SLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLL  461
             S H F IH+G   R   +F SF+  A ++W +VEE +  LE LL+ YF+P+A+ +GQR+L
Sbjct  9941  SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRIL  9762

Query  462   SLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRR  521
             +L+       + R+LLSC+ NE +V  +L +PGQR++G ++  RAA  +Q+ +RM + RR
Sbjct  9761  TLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRR  9582

Query  522   RYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGR  581
              Y+   ++      IQ  WR ++ + A K ++  +R  Q   +   M    + W +I  +
Sbjct  9581  TYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQ  9402

Query  582   RRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSH  641
             RR V+H+PS+S+D   R+  E F++QQNLQL R+CA  +D NV+L +Y+ PFELT D+  
Sbjct  9401  RRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQ  9228

Query  642   YFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYL  701
             Y++KLLQL G++D+  R+KL+ PE A+RFP+HFSLS+V+L SPH ++R+  Y  G++AYL
Sbjct  9227  YYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYL  9048

Query  702   VMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHE  761
             V G PGTED+RLA  L +PILG  P +   + T SG KR   + + N   G+ +LYDE+E
Sbjct  9047  VPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENE  8868

Query  762   LFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGP  821
             L  +LAKL  A+  Q   +LKLDYDP   G A+VD+S +Q+++ LR   +T +YWRQP  
Sbjct  8867  LIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPI  8688

Query  822   RDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPE  881
             ++   + ++ E++   +++ L   ++ E++PSW+ + +AI  +G V+E  P         
Sbjct  8687  QNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKN-------  8535

Query  882   TASSSVEPAYVRANLFIDPDGTVHITSTQNVLA-----------------SGGGLNRKTV  924
                      YVRANLFI+P   V I+STQ  L+                        +T+
Sbjct  8534  ------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTI  8373

Query  925   AFTFPQTVAPHEAVK  939
              FTFPQT+  HE +K
Sbjct  8372  GFTFPQTLIDHEVLK  8328

 Score = 128 bits (321),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 110/197 (56%), Gaps = 19/197 (10%)
 Frame = -3

Query  938   VKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHL  997
             ++ A    G+ L +  + GY+S+DF+V  DD++     L+A+A+ PFLT+SAASF+ F  
Sbjct  8281  LQSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQPFLTNSAASFSLFQF  8105

Query  998   LARGVLDASSGGYRMA--------AANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAG  1049
             L+RG      GGY           A  S     ++  S     TDL++REA L+      
Sbjct  8104  LSRG------GGYNSKTGLFHLPRAITSHGVTSDTPSSSSLSATDLMIREARLSGIVSNE  7943

Query  1050  TP----RCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVF  1105
              P    R YV+  YV +P+V T+ Y +FF  CR  GV FD+ER +GT+FLL DSLTAGV 
Sbjct  7942  LPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVL  7763

Query  1106  GVLSVGETTDGALAFMR  1122
             G++ + +T   AL   R
Sbjct  7762  GIMCISDTRKNALLSCR  7712

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 68/116 (59%), Gaps = 17/116 (15%)
 Frame = -1

Query  1      MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaa---aveanaSPMR--HSAVVT---  52
              ME+V+Q++H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H+++     
Sbjct  11100  MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  10921

Query  53     TAEVQAFNAILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPP  108
              + +++  + IL + E E++AK +L+  G  N     Q       T LPAVT  +PP
Sbjct  10920  SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQ-------TGLPAVT--SPP  10780

 Score = 35.8 bits (81),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  238    MKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
              + QR  ++H+R E+ +R TP T +  +++ +LKFD 
Sbjct  10364  LMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDF  10257

>APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.12:1:1206637:1 
REF
Length=1206637

 Score = 294 bits (752),  Expect(4) = 8e-131, Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 238/387 (61%), Gaps = 56/387 (14%)
 Frame = +1

Query  384     LGANVDKIRGYNELLDAY------------------------------SLHQFLIHKGRT  413
               L  NV+KIRGYNELLD Y                              SLHQF+I KG+T
Sbjct  729334  LRRNVEKIRGYNELLDTYR*VRIDVVWEHES*HDEPI*LGLGCLFAFVSLHQFIIRKGKT  729513

Query  414     MRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSLASTGQPRFSK  473
               + DTPEF+SF+R  ++LWGSV  +++ LET+LT Y VPLAY DGQ+L+ +A+        
Sbjct  729514  LSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGT  729693

Query  474     RELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSA  533
                ELLSCI+N ++V +++RRPGQRYKG      A   IQ+  RM+  ++R +++   +  A
Sbjct  729694  TELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKR-LKNHHGNEDA  729870

Query  534     TKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQI---------------  578
                 IQ  +R++ C + L+ RL+ +R   L  W+A+M   +  W  +               
Sbjct  729871  AVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTVHT*FSKTALCRLVDS  730050

Query  579     --------AGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYV  630
                         +RRVVVHVPS + D+ +RL  +NF+++QNLQ+ R+CA A D NVD ++Y+
Sbjct  730051  TLQIDA*MKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-DPNVD-IIYI  730224

Query  631     APFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRI  690
               +PFEL+ D+  Y ++LLQLGG+ D + R++++ PE   RFP HFSL+++LLYSPHCL++I
Sbjct  730225  SPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKI  730404

Query  691     RHYTAGKDAYLVMGLPGTEDQRLAIAL  717
               + +  GK+AY+V G  G ED+RLAIAL
Sbjct  730405  KRFVRGKNAYIVTGNVGPEDKRLAIAL  730485

 Score = 114 bits (286),  Expect(4) = 8e-131, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 121/253 (48%), Gaps = 39/253 (15%)
 Frame = +3

Query  940     GACTAAGKLLVETNVWGYVSLDFVVFQDDKS---GGAPR--LWALAVHPFLTDSAASFAC  994
               GA  A    +    + GY S+D++ F D K+   GG PR  LWA+ V P LT++A SF  
Sbjct  731421  GASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTNTAVSFVM  731600

Query  995     FHLLARGVLDASSGGYRM-------AAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQ  1047
               F  L+    +  +G   +        AA++T+A +   +       + +L          
Sbjct  731601  FAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQK----AVETILSARPPNGAVV  731768

Query  1048    AGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDV-------------------ER  1088
                G  R Y+V  Y++HP++ T+ ++ FF+ CRL+GV FD+                   +R
Sbjct  731769  CGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQVQSHPKNIQ*RGC*RLVRQR  731948

Query  1089    TLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSA  1148
                +G  F+L DSLTAGV G++ +GE    A    R A+E+IG + G    +   P      
Sbjct  731949  AIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG----VQALPDSLSGE  732116

Query  1149    RSGNFAQVLSAVR  1161
               R GNF  +L+ VR
Sbjct  732117  RLGNFPHLLAIVR  732155

 Score = 64.3 bits (155),  Expect(4) = 8e-131, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  734     TRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDY  785
               T SGGKR+ + ADVN+P G +++YDE EL  +L+KL  A +DQ  WL+K+ Y
Sbjct  730592  T*SGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKVRY  730747

 Score = 63.9 bits (154),  Expect(4) = 8e-131, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 87/190 (46%), Gaps = 31/190 (16%)
 Frame = +1

Query  780     LLKLDYDPLGVGEAVVDLSGMQAMRELRREKK-----TPEYWRQPGPRDAASKLVLAELE  834
               LL +D D    G A +++  MQ++ ++R EK+       EY++QP  RDA  + +  EL 
Sbjct  730789  LL*IDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELT  730968

Query  835     R-----------PGVL-ARLATPMHTE------IFPSWREYTEAISHFGCVVE------A  870
                           P V  ARL T +         ++ SW E        G V+E      +
Sbjct  730969  ESYFAANITPCFPDVREARLGTSVMLSSLCTR*VYASWAELRPVALRVGVVIEVRMS*WS  731148

Query  871     VPPTSFVASPET-ASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNRKTVAFTFP  929
                 P    A+  + A  S   + VRAN+FI+P G VHITS  ++  S    +    A  FP
Sbjct  731149  RIPLHLTATISS*AYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLPQCAL-FP  731325

Query  930     QTVAPHEAVK  939
               QT  P++A++
Sbjct  731326  QTSVPYQAIR  731355

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 76/132 (58%), Gaps = 29/132 (22%)
 Frame = +3

Query  163     IHHGRLMRKKTTQHCRLLPSV---------------------NKVDPSAPTPELREEDAK  201
               I  G L++KKTT+  RLLP V                     N+ DP+AP+P+L EEDA+
Sbjct  728703  IKAGSLVKKKTTKPHRLLPKVHISTIHD*IPCLLPVILSW*MNRTDPTAPSPDLVEEDAR  728882

Query  202     HGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRPTPFTQS  261
                GV NLVTRGFLP   D+TPAF          G  V++    +I+DR+ Q V+  P+T  
Sbjct  728883  GGVHNLVTRGFLPPSVDVTPAF--------THGTSVIQNSRVKIYDRASQPVKSMPYTNP  729038

Query  262     TGYNLAALKFDL  273
               +G+N+A+LKFD+
Sbjct  729039  SGFNMASLKFDM  729074

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 17/76 (22%)
 Frame = +3

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
               M+K+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   N
Sbjct  728103  MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEK-----------------NNVDVNEIN  728231

Query  61      AILQQTEAELRAKAEL  76
               AIL++ EA+LRAKAE+
Sbjct  728232  AILERAEADLRAKAEV  728279

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 223 bits (569),  Expect(5) = 9e-125, Method: Compositional matrix adjust.
 Identities = 151/409 (37%), Positives = 223/409 (55%), Gaps = 53/409 (13%)
 Frame = +3

Query  578     IAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTA  637
               I  +RRVVVHVPS S +E +RL+ +NFA++QNLQ+ R+CA A D NVD+ +Y++PFEL+ 
Sbjct  427716  IKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSV  427889

Query  638     DVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGK  697
               D+  Y ++LLQLGG+AD   RV+++ PE A RFP HFSL+++LLYSPHCL++I+ Y  GK
Sbjct  427890  DIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGK  428069

Query  698     DAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGG--KRLLIRADVNVPTGTYE  755
               +AY+V G  G ED+RLAI L LP+LG  P +AL   TR      RLL+   V      Y 
Sbjct  428070  EAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRVRCLFCRLLMLGVVGCEAAFYA  428249

Query  756     LYDEHEL--------FAALAKLAVAHMDQ--PRWLLK--------------LDYDPLGVG  791
                  +H +          A ++L  AH  Q  PR +                LD DP   G
Sbjct  428250  SRRQHSVRRPRHLRRRRADSELGQAHGRQLAPRHVAHQGALTFSHPYHSA*LDADPSDTG  428429

Query  792     EAVVDLSGMQAMRELRREK---KTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHT  848
                A +D+  ++ + ++R EK   K  EY+ QP  ++   + ++AEL       RL +P   
Sbjct  428430  LAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQ--FHRLISPCFP  428603

Query  849     E--------------IFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEP----A  890
               +              ++P+W+     ++  G V+E V     V   ++  +   P    A
Sbjct  428604  DVCDSTL*SDPHLQ*VYPTWQHMRPVVNRIGAVIE-VRAY*LVGIRQSTPA*AYPPKVLA  428780

Query  891     YVRANLFIDPDGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVK  939
                VRAN+FI+P G VH+TS Q  L        ++V   +P T  P+ A++
Sbjct  428781  RVRANVFIEPSGGVHVTSAQEQLMHVKN-KHQSVGAVYPPTAVPYAAIR  428924

 Score = 134 bits (337),  Expect(5) = 9e-125, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 114/191 (60%), Gaps = 1/191 (1%)
 Frame = +1

Query  394     YNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLA  453
               + E L   SLHQF+I KG+T+ +TPEF+SF+R+ ++LWGSV  A+R LETLL  Y VPLA
Sbjct  427123  FVETLRVRSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLA  427302

Query  454     YADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQAC  513
               Y DGQ+LL +A+      SK ELL+C++N ++V   + RPGQR+KG D +  AA  IQ+ 
Sbjct  427303  YIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSV  427482

Query  514     VRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKT  573
                RM    RR +R       AT IQ  +R + C   ++ +LR  R      WE +M     
Sbjct  427483  YRMHRT-RRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHA  427659

Query  574     QWHQIAGRRRV  584
                W ++   R +
Sbjct  427660  NWDKVEWTRWI  427692

 Score = 91.7 bits (226),  Expect(5) = 9e-125, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 82/157 (52%), Gaps = 13/157 (8%)
 Frame = +1

Query  940     GACTAAGKLLVETNVWGYVSLDFVVFQDDKS----GGAP--RLWALAVHPFLTDSAASFA  993
               GA  A  + +  + + GY S+D+V F D K+     G P  RLWAL + P LT +A SF 
Sbjct  428977  GASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFV  429156

Query  994     CFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQA---GT  1050
                F  L+   LDA++G   +       A   S  +G   T   L  E  L + + A   G 
Sbjct  429157  LFTFLSCATLDAATGRSFLPLP----APRPSSLAGPPATETQLAVEKILGESSPAATMGA  429324

Query  1051    PRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVE  1087
                R Y+   Y+FHP++ T+QY  FF+ CR+HGV FD++
Sbjct  429325  ERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQ  429435

 Score = 57.4 bits (137),  Expect(5) = 9e-125, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +3

Query  1088    RTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGS  1147
               +++G  F+L DSLTAGV G+L +GE+   A+   R ALE+IG + G    +  +P     
Sbjct  429486  KSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDALTG  429653

Query  1148    ARSGNFAQVLSAVR  1161
                R GNFA VL A+R
Sbjct  429654  ERLGNFAAVLGAIR  429695

 Score = 30.8 bits (68),  Expect(5) = 9e-125, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +3

Query  384     LGANVDKIRGYNELLDAY  401
               L  NV+KIRGYN+LLD Y
Sbjct  427041  LRNNVEKIRGYNDLLDTY  427094

 Score = 59.7 bits (143),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 11/67 (16%)
 Frame = +2

Query  183     VNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQRA  242
               VN++DP AP P+L ++DAK GVLNLV RGF+P  AD++ AF          G G+M+ R 
Sbjct  426521  VNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADISLAF--------THGDGIMQNRC  426676

Query  243     ---TRIH  246
                  TRIH
Sbjct  426677  TSPTRIH  426697

 Score = 41.6 bits (96),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  244     RIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
               R++DRSEQ V+  P+  S+G+N+A+LK DL
Sbjct  426720  RLYDRSEQPVKSQPYMNSSGFNVASLKLDL  426809

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  736     SGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKL  783
               SG KRL  +ADVN+P G +++YDE EL  +LAKL  A++ Q  WL+K+
Sbjct  428224  SGAKRLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKV  428367

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 17/76 (22%)
 Frame = +1

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
               M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +                    +V A  
Sbjct  425827  MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDVDALQ  425955

Query  61      AILQQTEAELRAKAEL  76
               AIL++ E +LR+KAE+
Sbjct  425956  AILERAELDLRSKAEV  426003

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 176 bits (446),  Expect(6) = 6e-105, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 111/140 (79%), Gaps = 2/140 (1%)
 Frame = -1

Query  578     IAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTA  637
               I  +RRVVVHVPS S +E +RL+ +NFA++QNLQ+ R+CA A D NVD+ +Y++PFEL+A
Sbjct  175297  IKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSA  175124

Query  638     DVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGK  697
               D+  Y ++LLQLGG+AD   RV+++ PE A RFP HFSL+++LLYSPHCL++I+ Y  GK
Sbjct  175123  DIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGK  174944

Query  698     DAYLVMGLPGTEDQRLAIAL  717
               +AY+V G  G ED+RLAI L
Sbjct  174943  EAYIVAGTVGPEDKRLAIRL  174884

 Score = 127 bits (320),  Expect(6) = 6e-105, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 109/178 (61%), Gaps = 1/178 (1%)
 Frame = -2

Query  402     SLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLL  461
               SLHQF+I KG+T+ +TPEF+SF+R+ ++LWGSV  A+R LETLL  Y VPLAY DGQ+LL
Sbjct  175863  SLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLL  175684

Query  462     SLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRR  521
                +A+      SK ELL+C++N ++V   + RPGQR+KG D +  AA  +Q+  RM   RR
Sbjct  175683  KIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRR  175504

Query  522     RYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIA  579
               R +R       A+ IQ  +R +     ++ +LR  R      WE +M      W ++ 
Sbjct  175503  R-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAFHANWDKVG  175333

 Score = 58.2 bits (139),  Expect(6) = 6e-105, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -2

Query  736     SGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKL  783
               SG KRL  +ADVN+P G +++YDE EL  +LAKL  A++ Q  WL+K+
Sbjct  174786  SGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKV  174643

 Score = 51.2 bits (121),  Expect(6) = 6e-105, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 50/104 (48%), Gaps = 18/104 (17%)
 Frame = -3

Query  783     LDYDPLGVGEAVVDLSGMQAMRELRREK---KTPEYWRQPGPRDAASKLVLAELER----  835
               LD DP   G A +D+  ++ + ++R EK   K  EY+ QP  ++   + ++AEL      
Sbjct  174596  LDADPSDTGLASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHR  174417

Query  836     ----------PGVLARLATPMHTEIFPSWREYTEAISHFGCVVE  869
                         P    R+ TP+H  ++P+W+     ++  G V+E
Sbjct  174416  LISPCFPDVSPSSWNRMPTPLH-*VYPTWQHMRPVVNRIGAVIE  174288

 Score = 45.1 bits (105),  Expect(6) = 6e-105, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 35/63 (56%), Gaps = 1/63 (2%)
 Frame = -2

Query  890     AYVRANLFIDPDGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLL  949
               A VRAN+FI+P G VH+TS Q  L        ++V   +P T  P+ A++  C  +  +L
Sbjct  174222  ARVRANVFIEPSGGVHLTSAQEQLMQAKN-KHQSVGAVYPSTTVPYAAIRVRCRLSYCVL  174046

Query  950     VET  952
               V +
Sbjct  174045  VRS  174037

 Score = 32.7 bits (73),  Expect(6) = 6e-105, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  384     LGANVDKIRGYNELLDAY  401
               L  NV+KIRGYN+LLD Y
Sbjct  175961  LRNNVEKIRGYNDLLDTY  175908

 Score = 90.9 bits (224),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 83/165 (50%), Gaps = 24/165 (15%)
 Frame = -1

Query  938     VKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS----GGAP--RLWALAVHPFLTDSAAS  991
               +KGA  A  + +  + + GY S+D+V F D K+     G P  RLWAL + P LT +A S
Sbjct  174037  IKGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMS  173858

Query  992     FACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLA--------  1043
               F  F  L+   LDA++G        S L       S   G   L + E  LA        
Sbjct  173857  FVLFTFLSCATLDAATG-------RSFLPQPAPHPSPATG--QLPVTETQLAVEKILSES  173705

Query  1044    -KGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVE  1087
                + +  G  R Y+   Y+FHP++ T+QY  FF+ CR+HGV FD++
Sbjct  173704  PRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQ  173570

 Score = 58.9 bits (141),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = -3

Query  1088    RTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGS  1147
               +++G  F+L DSLTAGV G+L +GE+   A+   R ALE+IG + G    +  +P     
Sbjct  173522  KSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDALTG  173355

Query  1148    ARSGNFAQVLSAVRA  1162
                R GNFA VL A+R+
Sbjct  173354  ERLGNFAAVLGAIRS  173310

 Score = 60.5 bits (145),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  183     VNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAF  223
               VN++DP AP P+L ++DAK GVLNLV RGF+P  ADL+ AF
Sbjct  176487  VNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF  176365

 Score = 39.3 bits (90),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -1

Query  244     RIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
               R++DRSEQ V+  P+  S+ +N+A+LK DL
Sbjct  176281  RLYDRSEQPVKSQPYMNSSSFNVASLKLDL  176192

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 17/76 (22%)
 Frame = -3

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
               M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +                    ++ A  
Sbjct  177176  MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  177048

Query  61      AILQQTEAELRAKAEL  76
               AIL++ E +LR+KAE+
Sbjct  177047  AILERAELDLRSKAEV  177000

>APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.20:1:1003253:1 
REF
Length=1003253

 Score = 177 bits (448),  Expect(5) = 3e-96, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = -3

Query  578     IAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTA  637
               I  +RRVVVHVPS S +E +RL  ENF++QQNLQ+ R+CA A D NVD+ +Y++PFEL+ 
Sbjct  378825  IKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-DPNVDI-IYISPFELSP  378652

Query  638     DVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGK  697
               D+  Y ++LLQLGG+AD + R++++ PE   RFP HFSL++VLLYSPHCL++I+ +  GK
Sbjct  378651  DIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGK  378472

Query  698     DAYLVMGLPGTEDQRLAIAL  717
               DAY+V G  G ED+RLAIAL
Sbjct  378471  DAYIVTGNVGPEDKRLAIAL  378412

 Score = 130 bits (327),  Expect(5) = 3e-96, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = -1

Query  402     SLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLL  461
               SLHQF+I KG+T+ DTPEF+SF+R  ++LWGSV ++++ LE +LT Y VPLAY DGQ+L+
Sbjct  379400  SLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLM  379221

Query  462     SLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRR  521
                +A+         ELLSCI+N ++V +++RRPGQR+KG+     AA  +Q+  RM+  ++
Sbjct  379220  KIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKK  379041

Query  522     RYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQI  578
               R +++   +  A  IQ  +R++ C + L+ RL+ +R   L  W+A+M   +  W  +
Sbjct  379040  R-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSV  378873

 Score = 63.2 bits (152),  Expect(5) = 3e-96, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  736     SGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKL  783
               SGGKR+ + ADVN+P G +++YDE EL  +L+KL  A +DQ  WL+K+
Sbjct  378307  SGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKV  378164

 Score = 38.9 bits (89),  Expect(5) = 3e-96, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 6/74 (8%)
 Frame = -3

Query  783     LDYDPLGVGEAVVDLSGMQAMRELRREKK-----TPEYWRQPGPRDAASKLVLAELERPG  837
               +D D    G A +++  MQ++ + R EK+       EY++QP  RDA  + V +EL    
Sbjct  378114  IDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESY  377935

Query  838     VLARLATPMHTEIF  851
                 A + TP   E+F
Sbjct  377934  FAANV-TPCFPEVF  377896

 Score = 32.3 bits (72),  Expect(5) = 3e-96, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  384     LGANVDKIRGYNELLDAY  401
               L  NV+KIRGYNELLD Y
Sbjct  379506  LRRNVEKIRGYNELLDTY  379453

 Score = 148 bits (374),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 155/314 (49%), Gaps = 47/314 (15%)
 Frame = -2

Query  890     AYVRANLFIDPDGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVK----------  939
               ++VR N+FI+P G VHITS  +V       +    A  FPQ+  P++A++          
Sbjct  377728  SHVRTNIFIEPSGGVHITSAHDVFMCPVNKHLPQCA-VFPQSSVPYQAIRVRALASWHGR  377552

Query  940     --------GACTAAGKLLVETNVWGYVSLDFVVFQDDKS--GGAPR--LWALAVHPFLTD  987
                       GA  A    +    + GY S+D++ F D K+   G PR  LWA+ V P LT+
Sbjct  377551  FD*STHV*GASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTN  377372

Query  988     SAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGT----TDLLLREASLA  1043
               +A SF  F  L+    +  +G   +  A + +A +++  +    T      +L   +S A
Sbjct  377371  TAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILSPPSSAA  377192

Query  1044    KGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDV----------------E  1087
                 +  G  R Y+V  Y++HP++ T+Q+  FF+ CRLHGV FD+                +
Sbjct  377191  AASVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQVQHS*A*W*LTHDVRQ  377012

Query  1088    RTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGS  1147
               R +G  ++L DSLTAGV G++ +GE+   A    R A+E+IG + G    +   P+    
Sbjct  377011  RAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVG----VQALPNSLSG  376844

Query  1148    ARSGNFAQVLSAVR  1161
                R GNF  +L+ VR
Sbjct  376843  ERLGNFPHLLAIVR  376802

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 74/129 (57%), Gaps = 26/129 (20%)
 Frame = -1

Query  163     IHHGRLMRKKTTQHCRLLPSV------------------NKVDPSAPTPELREEDAKHGV  204
               +  G L++ KTT+  R+LP V                  N++DP+AP P L ++DA+ GV
Sbjct  380174  VKAGSLVKHKTTKPRRILPKVCDSTVSVTLIRSCRRW*MNRLDPTAPPPALLDDDARGGV  379995

Query  205     LNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGY  264
                NL+TRGFLP   D+TPAF          G  V++    +I+DR+ Q V+  P+T  +G+
Sbjct  379994  HNLLTRGFLPPSVDVTPAF--------THGTSVIQNTRVKIYDRASQPVKSMPYTNPSGF  379839

Query  265     NLAALKFDL  273
               N+A+LKFD+
Sbjct  379838  NMASLKFDM  379812

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 17/76 (22%)
 Frame = -3

Query  1       MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
               MEK+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  380796  MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  380668

Query  61      AILQQTEAELRAKAEL  76
               AIL++ EA+LRAKAE+
Sbjct  380667  AILERAEADLRAKAEV  380620

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 182 bits (462),  Expect(3) = 7e-80, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 136/189 (72%), Gaps = 1/189 (1%)
 Frame = -3

Query  457    GQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRM  516
              GQRL+ +A+     F    LLSC+VNE+QV ++LRRPGQRYKG+DRKRRAATT+QA  RM
Sbjct  14227  GQRLMVVAAMEMASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRM  14048

Query  517    WSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWH  576
                 R R+ R      SAT+IQ  WR F+   +L+  L   R EQL  W+ +M  L++QW 
Sbjct  14047  LFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWR  13868

Query  577    QIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELT  636
              +I+ +RRVVVHVPSLSLDEH+R+S ++FAVQQNLQL R+ AA +D+ V+ +VYV+PFEL 
Sbjct  13867  EISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-AAVVDATVEYVVYVSPFELP  13691

Query  637    ADVSHYFLK  645
               D+S Y +K
Sbjct  13690  TDLSQYVVK  13664

 Score = 102 bits (254),  Expect(3) = 7e-80, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  384    LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
              L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEF SF+RV QE+WG+V+E +RALE 
Sbjct  14483  LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  14304

Query  444    lltQYFVPLAY  454
              LLT+YFVPLA+
Sbjct  14303  LLTRYFVPLAF  14271

 Score = 60.5 bits (145),  Expect(3) = 7e-80, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  649    LGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRR  689
              L G+A++  RVK+V PE AA FP HFSL++ LLYSPHCLRR
Sbjct  13611  LSGVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHCLRR  13489

 Score = 140 bits (353),  Expect(4) = 1e-63, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 119/211 (56%), Gaps = 25/211 (12%)
 Frame = -2

Query  779    WLLKLD-YDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPG  837
              W+L+LD +D    G A++D+S +  +RE+RR  K P YW+QPG RD  ++ +L ELER  
Sbjct  13202  WVLRLDAHDVRATGTALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--  13029

Query  838    VLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLF  897
               +  LA P H+E FP WR + +AI   G V+EA+P            + V    VR N+F
Sbjct  13028  AIGTLAKPCHSERFPDWRAFAQAIGRDGVVIEALP------------ARVR-GVVRVNIF  12888

Query  898    IDP-----DGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVET  952
              + P     D  V + STQ  L +  G  R  +AF  PQT+ PH+AV GA  A G+LL E 
Sbjct  12887  VTPASSDHDADVPVVSTQEALRASAG--RAPLAFACPQTLVPHDAVVGAAQAIGRLLRED  12714

Query  953    NVW-GYVSLDFVVFQDDKSG-GAPRLWALAV  981
                + GY S+D  + +D+ S     RLWA+A+
Sbjct  12713  YAFCGYASVDLQLCRDETSSLPVERLWAVAL  12621

 Score = 65.9 bits (159),  Expect(4) = 1e-63, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  734    TRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMD  775
              TR+G KRL ++ADVNVPTGTY+LYD  EL  ALAKL ++H+D
Sbjct  13354  TRAGAKRLFLKADVNVPTGTYDLYDVDELLFALAKLIISHLD  13229

 Score = 58.5 bits (140),  Expect(4) = 1e-63, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 12/97 (12%)
 Frame = -1

Query  1001   GVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAK------GAQAGTPRCY  1054
              G +DA+SG Y + +     +A  S        T L+L+EA L         + + +PRC+
Sbjct  12510  GAVDATSGLYLLPSPAVDTSAPLSP------ATPLVLQEAHLLARSSRPLASPSASPRCF  12349

Query  1055   VVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLG  1091
              V   +  HP++ TM   AFF ACR  GVCFDV R +G
Sbjct  12348  VSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTRRVG  12238

 Score = 46.2 bits (108),  Expect(4) = 1e-63, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 10/66 (15%)
 Frame = -2

Query  1096   LTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQ  1155
              L DSLTAGVF V S G +   A+ ++RTA EV+ RE G+        S P S   GNF  
Sbjct  12194  LPDSLTAGVFAVWSSGVSPLQAMQYLRTAFEVLAREVGS--------STPSS--DGNFGD  12045

Query  1156   VLSAVR  1161
              VL+ +R
Sbjct  12044  VLALLR  12027

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  1      MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
              ME++QQQHHVEDVGR+LL TQ+QLR +REQ++
Sbjct  15764  MEQLQQQHHVEDVGRILLHTQDQLRHLREQLS  15669

 Score = 37.7 bits (86),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  237    VMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKF  271
              V++  A R++ R EQ VR  P+   T +NLA LKF
Sbjct  14833  VIQNGAVRLYRREEQPVRAVPYANPTNFNLATLKF  14729

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = -3

Query  166  GRLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFag  225
            GR +R KTT   RLLPSVN+ DP+AP PEL   DA  GVL+L++RG LP  ADLTPA   
Sbjct  745  GRRVRGKTTTPARLLPSVNRRDPAAPRPELTSRDADAGVLDLLSRGLLPPTADLTPAL--  572

Query  226  psgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
                ++GS  GV++   TR+H R E   R  PF+  +G+N A L+ DL
Sbjct  571  --AGSNGSSSGVLRNTRTRLHQRGESPARALPFSSRSGFNAATLRLDL  434

 Score = 47.0 bits (110),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  51    VTTAEVQAFNAILQQTEAELRAKAELVLNGMV  82
             V  A+VQAF+AILQ+ E EL+AKAELVL+G+V
Sbjct  1175  VAAADVQAFDAILQRAERELQAKAELVLHGLV  1080

 Score = 42.7 bits (99),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -1

Query  1     MEKVQQQHHVEDVGRLLLQTQEQL  24
             ME ++QQHH EDVGR+LLQTQE +
Sbjct  1356  MEPLEQQHHAEDVGRILLQTQEHV  1285

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -3

Query  384  LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRV  426
            LGANV KIRGY   L A   HQFL+ +GR  R++PEF +F R 
Sbjct  130  LGANVAKIRGYTAQLAASGAHQFLVVRGRAARESPEFAAFARA  2

>PYVX:scaffold_1323 pve_scaffold_1323 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1323:1:4715:1 
REF
Length=4715

 Score = 73.6 bits (179),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  1051  PRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSV  1110
             PRCYV+  YV H  V      AFF  CRLHGVC DV    G++FLL DSL AG  GVL++
Sbjct  213   PRCYVLSDYVRHAGVAARPAGAFFQTCRLHGVCLDVAAARGSVFLLPDSLAAGAIGVLAL  392

Query  1111  G  1111
              
Sbjct  393   A  395

 Score = 26.6 bits (57),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 3/42 (7%)
 Frame = +2

Query  1120  FMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVR  1161
             F+R ALEV+ REAG                  NF Q+L+AVR
Sbjct  434   FLRAALEVLAREAGTGGVCGGEGD---GTEGDNFGQILAAVR  550

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  1      MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
              M++ QQ HHVEDVGR+LLQTQEQLR+MREQMT
Sbjct  12083  MDQFQQHHHVEDVGRILLQTQEQLRLMREQMT  12178

>PYIR:scaffold_59 pir_scaffold_59 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_59:1:65065:1 
REF
Length=65065

 Score = 35.8 bits (81),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 27/52 (52%), Gaps = 1/52 (2%)
 Frame = +2

Query  664    PEQAARFPAHFSLSSVLLYSPHCLRRIRH-YTAGKDAYLVMGLPGTEDQRLA  714
              P Q   FP HFS + V+ Y+   LRR RH   A ++ ++   L   + Q LA
Sbjct  45554  PIQIPHFPVHFSFNIVIWYAREQLRRQRHSLKAAREHFIAEMLKQVQKQNLA  45709

>PHSO:scaffold_3
Length=10773376

 Score = 35.8 bits (81),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 13/65 (20%)
 Frame = +1

Query  587     HVPSLSLDEHSRLSAENFAVQQNLQLTRICA--AALDSNVDLLVYVAPFELTADVSHYFL  644
               H  +L+    SR SA++FA+QQNL  T IC+  +A+D      V  APF+L+A      L
Sbjct  351091  HQSTLNYPPTSRQSAQSFAIQQNLLPTSICSRTSAVDD-----VATAPFQLSA------L  351237

Query  645     KLLQL  649
               +L Q+
Sbjct  351238  RLFQV  351252

Lambda      K        H        a         alpha
   0.321    0.132    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 441447971286

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40